Your browser is old and dusty. Try Google Chrome!

Details for ssl3379

ORF ssl3379
Accession NP_440999.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -278 -264 12.8809 0.201
NP_442711.1_1 Reverse -269 -283 11.5043 0.242
NP_441061.1_2 Reverse -270 -284 15.7325 0.0328
NP_441061.1_2 Forward -277 -263 13.5693 0.0392
NP_441061.1_2 Forward -182 -168 5.70279 0.131
NP_440557.1_1 Forward -277 -258 -1.67217 0.276
NP_440795.1_7 Forward -277 -270 14.6904 0.0123
NP_440795.1_7 Reverse -270 -277 14.6904 0.0123
NP_441418.1_6 Reverse -269 -288 8.25926 0.00469
NP_441418.1_6 Forward -278 -259 -22.125 0.169
NP_441418.1_6 Reverse -165 -184 -29.6965 0.234
NP_441453.1_1 Forward -285 -267 5.52492 0.246
NP_441453.1_4 Reverse -269 -277 16.539 0.00633
NP_441453.1_4 Forward -278 -270 16.539 0.00633
NP_442151.1_6 Forward -278 -264 15.9292 0.0192
NP_441818.1_9 Reverse -165 -184 -5.11376 0.248
NP_440226.1_1 Forward -278 -259 2.26107 0.271
NP_442655.1_10 Reverse -266 -285 -10.4236 0.22
NP_442173.1_1 Forward -277 -269 15.4574 0.00633
NP_442173.1_1 Reverse -270 -278 15.4574 0.00633
NP_442173.1_1 Reverse -10 -18 8.18089 0.111
NP_442752.1_4 Forward -278 -271 13.8055 0.0199
NP_442752.1_4 Reverse -269 -276 13.8055 0.0199
NP_442752.1_4 Forward -51 -44 5.25066 0.256
NP_443027.1_4 Reverse -267 -277 15.3197 0.0437
NP_443027.1_4 Forward -280 -270 13.943 0.0452
NP_441812.1_3 Forward -119 -105 7.27608 0.282
NP_442975.1_10 Forward -282 -268 21.6317 0.000774
NP_442975.1_10 Reverse -265 -279 3.63724 0.252
NP_440784.1_7 Forward -277 -270 15.9687 0.0123
NP_440784.1_7 Reverse -270 -277 15.9687 0.0123
NP_440061.1_9 Forward -175 -161 6.39049 0.248
NP_442405.1_3 Reverse -22 -34 18.1313 0.252
NP_441054.1_1 Reverse -262 -276 17.8958 0.129
NP_441476.1_5 Forward -283 -264 8.65258 0.0933
NP_441476.1_5 Reverse -264 -283 1.67108 0.188
NP_439979.1_2 Reverse -266 -285 7.96426 0.26
NP_439979.1_2 Forward -177 -158 6.78429 0.291
NP_442062.1_8 Reverse -269 -279 19.4496 0.000558
NP_442062.1_8 Forward -278 -268 10.3048 0.0493
NP_442062.1_8 Forward -159 -149 4.69992 0.201
NP_440761.1_4 Forward -283 -264 -13.7669 0.257
NP_441900.1_2 Forward -177 -159 -1.9482 0.273
NP_441859.1_3 Reverse -268 -287 17.5998 0.0394
NP_441859.1_3 Forward -279 -260 14.4533 0.0704
NP_441802.1_1 Reverse -190 -209 4.12936 0.298
NP_440304.1_4 Reverse -267 -277 18.9579 0.00406
NP_440304.1_4 Forward -280 -270 9.91146 0.051
NP_440304.1_4 Reverse -166 -176 3.61828 0.295
NP_442242.1_4 Forward -277 -270 14.3954 0.0124
NP_442242.1_4 Reverse -270 -277 14.3954 0.0124
NP_440044.1_8 Reverse -270 -289 15.9291 0.0239
NP_441781.1_7 Forward -177 -158 -2.65548 0.289
NP_441208.1_9 Reverse -266 -280 16.8142 0.0647
NP_441208.1_9 Forward -281 -267 7.76774 0.219
NP_441594.1_6 Reverse -260 -279 12.7825 0.109
NP_441594.1_6 Forward -287 -268 0.687771 0.282
NP_442742.1_9 Reverse -344 -363 -12.6852 0.269
NP_442110.1_7 Forward -278 -264 19.6658 0.0138
NP_442110.1_7 Reverse -269 -283 1.27789 0.233
NP_441925.1_4 Forward -182 -163 -10.2277 0.237
NP_440856.1_4 Reverse -262 -281 6.19431 0.0772
NP_440856.1_7 Reverse -266 -285 -9.24366 0.284
NP_441083.1_5 Reverse -269 -279 11.3864 0.0159
NP_441083.1_5 Forward -278 -268 11.2881 0.0159
NP_442827.1_8 Forward -286 -267 9.14342 0.0736
NP_442827.1_8 Reverse -261 -280 -1.67294 0.253
NP_440645.1_10 Forward -370 -351 8.45592 0.245
NP_441738.1_2 Forward -276 -269 15.28 0.0102
NP_441738.1_2 Reverse -271 -278 15.28 0.0102
NP_441738.1_2 Forward -391 -384 8.29857 0.176
NP_441558.1_5 Reverse -267 -286 5.30933 0.254
NP_440209.1_1 Reverse -269 -277 18.1123 0.00295
NP_440209.1_1 Forward -278 -270 18.1123 0.00295
NP_442889.1_8 Forward -281 -267 3.63724 0.273
NP_441713.1_1 Reverse -263 -282 -16.5201 0.284
NP_442111.1_4 Forward -279 -265 13.0776 0.0399
NP_442111.1_4 Reverse -268 -282 9.83269 0.0575
NP_440906.1_5 Forward -277 -270 15.8704 0.0124
NP_440906.1_5 Reverse -270 -277 15.8704 0.0124
NP_440747.1_10 Reverse -266 -278 7.80712 0.00223
NP_440747.1_10 Forward -281 -269 -2.02597 0.0196
NP_441130.1_10 Reverse -267 -281 10.521 0.112
NP_441130.1_10 Forward -280 -266 9.73436 0.12
NP_441854.1_10 Forward -280 -261 10.2259 0.139
NP_441486.1_1 Forward -281 -267 -3.44199 0.178
NP_442634.1_4 Forward -280 -266 14.3559 0.0195
NP_442634.1_4 Reverse -267 -281 4.22782 0.0819
NP_440403.1_4 Forward -287 -268 4.62101 0.111
NP_440403.1_10 Forward -287 -268 7.57094 0.208
NP_440403.1_10 Reverse -165 -184 2.55606 0.279
NP_440057.1_4 Reverse -300 -319 12.6226 0.299
NP_441014.1_10 Forward -326 -307 0.293673 0.244
NP_442848.1_1 Forward -284 -270 5.70279 0.0803
NP_442848.1_1 Reverse -263 -277 -2.75368 0.263
NP_442848.1_5 Forward -196 -178 -3.42244 0.291
NP_441012.1_4 Forward -181 -168 7.00078 0.272
NP_443018.1_3 Forward -277 -270 14.8871 0.0123
NP_443018.1_3 Reverse -270 -277 14.8871 0.0123
NP_441316.1_7 Forward -280 -265 13.7462 0.0486
NP_441634.1_8 Reverse -267 -281 5.60446 0.114
NP_440376.1_1 Forward -278 -269 19.4693 0.000692
NP_440376.1_1 Reverse -269 -278 19.4693 0.000692
NP_440376.1_1 Forward -159 -150 3.63797 0.2
NP_440376.1_1 Reverse -174 -183 1.37636 0.252
NP_440376.1_1 Forward -124 -115 -0.0986038 0.285
NP_441588.1_4 Reverse -271 -281 6.96153 0.178
NP_442687.1_7 Forward -279 -269 15.8113 0.0125
NP_442687.1_7 Reverse -268 -278 9.02648 0.0994
NP_442191.1_4 Reverse -168 -182 10.9931 0.276
NP_442485.1_3 Forward -289 -270 3.34271 0.201
NP_441846.1_10 Reverse -164 -183 -4.03212 0.156
NP_441846.1_10 Reverse -166 -185 -22.715 0.264
NP_441846.1_10 Reverse -167 -186 -23.4033 0.285
NP_440042.1_1 Forward -221 -202 15.1424 0.136
NP_441422.1_7 Forward -280 -263 15.3785 0.0565
NP_442658.1_1 Forward -280 -270 18.7607 0.00222
NP_442658.1_1 Reverse -267 -277 15.9091 0.00966
NP_441855.2_4 Reverse -261 -280 12.8973 0.174
NP_441855.2_4 Forward -286 -267 10.8728 0.24
NP_442782.1_2 Reverse -168 -182 4.32615 0.256
NP_442782.1_2 Forward -278 -264 2.45787 0.275
NP_442205.1_9 Reverse -263 -279 1.04184 0.255
NP_440656.1_8 Forward -289 -270 1.17943 0.124
NP_441256.1_8 Forward -130 -111 1.96607 0.285
NP_442937.1_5 Forward -283 -264 12.8808 0.0991
NP_442937.1_5 Reverse -258 -277 11.2092 0.144
NP_442937.1_5 Reverse -264 -283 6.88262 0.268
NP_442937.1_5 Forward -37 -18 6.09597 0.288
NP_441958.1_5 Reverse -268 -278 21.2195 0.000805
NP_441958.1_5 Forward -279 -269 12.2714 0.00183
NP_441127.1_1 Reverse -263 -277 7.76774 0.3
NP_440950.1_1 Forward -176 -157 9.24257 0.144
NP_440203.1_5 Forward -275 -265 12.7626 0.138
NP_441097.1_2 Reverse -333 -350 9.38028 0.223
NP_439990.1_5 Reverse -264 -277 9.95071 0.128
NP_442376.1_2 Reverse -163 -182 -13.1769 0.286
NP_442376.1_2 Reverse -264 -283 -13.2752 0.292
NP_442376.1_2 Forward -283 -264 -13.5702 0.297
NP_442690.1_1 Forward -41 -22 -7.96535 0.182
NP_442911.1_2 Reverse -259 -278 13.3725 0.0118
NP_442911.1_2 Forward -288 -269 1.47442 0.0585
NP_441580.1_6 Forward -289 -270 -4.91709 0.235
NP_440153.1_5 Forward -277 -263 4.22782 0.199
NP_440153.1_5 Reverse -270 -284 0.687908 0.291
NP_440153.1_8 Forward -177 -164 2.77255 0.21
NP_443055.1_6 Reverse -114 -132 1.98502 0.222
NP_440993.1_2 Reverse -264 -280 15.5948 0.0631
NP_440993.1_2 Forward -283 -267 11.5633 0.0799
NP_440993.1_3 Reverse -259 -278 1.57197 0.226
NP_440827.1_3 Forward -283 -264 11.6025 0.268
NP_440138.1_6 Forward -277 -258 7.86512 0.201
NP_439975.1_2 Forward -251 -233 4.34571 0.3
NP_441913.1_2 Forward -37 -18 19.3707 0.103
NP_442995.1_5 Reverse -264 -283 13.5691 0.183
NP_442002.1_1 Forward -258 -240 -9.42063 0.281
NP_442002.1_9 Forward -279 -272 10.7572 0.185
NP_440475.1_1 Reverse -58 -77 16.4202 0.102
NP_441294.1_7 Forward -282 -268 13.0902 0.0747
NP_441646.1_1 Reverse -262 -281 4.52268 0.191
NP_442438.1_10 Reverse -264 -278 11.996 0.0412
NP_442438.1_10 Forward -283 -269 9.63603 0.0617
NP_441000.1_1 Forward -138 -120 17.4659 0.184
NP_441000.1_5 Reverse -25 -44 20.7464 0.068
NP_441000.1_6 Reverse -268 -282 -3.34366 0.221
NP_442771.1_1 Forward -280 -262 3.06741 0.0672
NP_442771.1_1 Reverse -267 -285 -6.66736 0.168
NP_441110.1_7 Forward -254 -235 21.2389 0.0993
NP_440147.1_4 Forward -280 -267 12.2123 0.0326
NP_440147.1_4 Reverse -267 -280 11.819 0.0326
NP_440147.1_4 Forward -208 -195 2.47756 0.208
NP_441550.1_8 Reverse -267 -277 17.4824 0.00754
NP_441550.1_8 Forward -280 -270 10.501 0.066
NP_441916.1_7 Forward -278 -268 18.9579 0.00144
NP_441916.1_7 Reverse -269 -279 18.4663 0.00144
NP_440465.1_10 Reverse -266 -285 -0.295539 0.29
NP_441041.1_4 Forward -124 -105 -9.14533 0.213
NP_441041.1_4 Reverse -257 -276 -11.9969 0.256
NP_441041.1_7 Forward -281 -269 19.5648 0.00277
NP_441041.1_7 Reverse -266 -278 14.9975 0.0309
NP_440569.1_10 Forward -215 -196 2.33913 0.293
NP_443063.1_7 Reverse -149 -165 6.84337 0.288
NP_442004.1_6 Forward -278 -264 13.8643 0.0811
NP_441725.1_4 Reverse -264 -278 12.2903 0.0693
NP_441725.1_5 Reverse -270 -280 9.02648 0.0553
NP_441725.1_5 Forward -277 -267 8.92815 0.0553
NP_439966.1_7 Forward -280 -270 17.4824 0.00636
NP_439966.1_7 Reverse -267 -277 13.8442 0.0234
NP_439966.1_9 Forward -280 -271 10.7178 0.0863
NP_439966.1_9 Reverse -267 -276 0.983037 0.253
NP_442941.1_3 Forward -277 -267 10.9931 0.0116
NP_442941.1_3 Reverse -270 -280 2.53664 0.14
NP_440289.1_2 Forward -281 -268 12.9006 0.0132
NP_440289.1_2 Reverse -266 -279 -4.50394 0.288
NP_441514.1_1 Reverse -29 -39 14.727 0.274
NP_442281.1_1 Forward -283 -269 18.3868 0.00441
NP_442281.1_1 Reverse -264 -278 13.6669 0.0249
NP_442281.1_1 Reverse -110 -124 6.78381 0.115
NP_442281.1_1 Reverse -318 -332 1.5723 0.296
NP_441334.1_7 Reverse -267 -286 -8.65367 0.12
NP_441334.1_7 Forward -280 -261 -9.24366 0.12
NP_440177.1_9 Reverse -1 -20 13.9625 0.221
NP_442012.1_1 Forward -284 -265 5.50599 0.152
NP_442012.1_1 Reverse -263 -282 5.211 0.153
NP_441457.1_7 Reverse -267 -286 7.66927 0.166
NP_441556.1_10 Forward -331 -317 14.2126 0.178
NP_441556.1_10 Forward -195 -181 11.7792 0.214
NP_442982.1_5 Reverse -259 -278 -1.47551 0.266
NP_441644.1_6 Forward -278 -268 19.0557 0.000803
NP_441644.1_6 Reverse -269 -279 10.1076 0.0628
NP_441644.1_6 Forward -177 -167 4.30615 0.242
NP_442501.1_10 Reverse -180 -199 9.73422 0.283
NP_440867.1_6 Forward -275 -256 14.3549 0.238
NP_442215.1_2 Forward -280 -264 -3.48138 0.216
NP_440253.1_2 Reverse -269 -287 8.7706 0.0526
NP_440929.1_8 Forward -278 -269 19.2726 0.000701
NP_440929.1_8 Reverse -269 -278 19.2726 0.000701
NP_440929.1_8 Forward -183 -174 2.65466 0.253
NP_442933.1_10 Forward -278 -269 17.601 0.00325
NP_442933.1_10 Reverse -269 -278 17.601 0.00325
NP_441751.2_8 Forward -277 -263 14.9459 0.0119
NP_441751.2_8 Reverse -270 -284 -3.83532 0.156
NP_442926.1_3 Reverse -258 -277 3.44104 0.281
NP_442554.1_8 Forward -277 -267 19.1546 0.00369
NP_442554.1_8 Reverse -270 -280 16.008 0.0065
NP_441762.1_7 Reverse -268 -280 12.527 0.0142
NP_441762.1_7 Forward -279 -267 11.7404 0.0142
NP_442142.1_4 Reverse -266 -279 15.4566 0.0264
NP_442142.1_4 Forward -281 -268 14.4733 0.0311
NP_442142.1_9 Forward -285 -266 1.76941 0.282
NP_442292.1_1 Forward -277 -268 17.5026 0.00435
NP_442292.1_1 Reverse -270 -279 9.63616 0.0183
NP_441525.1_1 Reverse -164 -177 15.7522 0.206
NP_439989.1_6 Forward -308 -289 10.1275 0.127
NP_442381.1_8 Forward -281 -262 -13.4719 0.273
NP_443009.1_5 Reverse -268 -279 19.626 0.00102
NP_443009.1_5 Forward -279 -268 7.82632 0.118
NP_443009.1_5 Forward -160 -149 4.77807 0.23
NP_442408.2_1 Reverse -269 -288 -5.01543 0.267
NP_441715.1_4 Reverse -270 -280 9.32148 0.097
NP_441715.1_4 Forward -277 -267 7.25653 0.108
NP_440279.1_8 Reverse -189 -208 17.699 0.242
NP_440015.1_9 Forward -190 -172 -0.964162 0.266
NP_441448.1_1 Forward -228 -209 3.44104 0.297
NP_441198.1_8 Reverse -267 -277 15.4199 0.0427
NP_440379.1_5 Reverse -260 -279 -9.73531 0.264
NP_441468.1_1 Forward -277 -270 15.8704 0.0124
NP_441468.1_1 Reverse -270 -277 15.8704 0.0124
NP_441020.2_6 Reverse -267 -284 21.2783 0.00316
NP_441020.2_6 Forward -280 -263 12.4285 0.0949
NP_441015.1_10 Reverse -264 -283 3.53937 0.136
NP_441015.1_10 Reverse -165 -184 -2.65548 0.18
NP_441673.1_1 Forward -278 -269 20.8459 0.000698
NP_441673.1_1 Reverse -269 -278 20.8459 0.000698
NP_441956.1_10 Reverse -362 -376 18.7801 0.233
NP_441826.1_2 Forward -284 -270 10.9143 0.0428
NP_441826.1_2 Reverse -263 -277 6.98109 0.0899
NP_441826.1_5 Reverse -162 -181 3.93269 0.259
NP_442490.1_9 Reverse -257 -276 -0.39387 0.179
NP_442868.1_6 Reverse -267 -277 8.63316 0.0555
NP_442868.1_6 Forward -280 -270 8.53483 0.0555
NP_442719.1_2 Reverse -67 -85 0.903388 0.162
NP_442719.1_2 Reverse -58 -76 -5.09477 0.218
NP_441251.1_2 Forward -273 -255 14.8671 0.199
NP_442227.1_2 Forward -181 -162 8.45592 0.171
NP_442227.1_2 Forward -178 -159 -2.65548 0.278
NP_442361.1_3 Forward -284 -271 8.67241 0.285
NP_442808.1_1 Forward -279 -269 18.4657 0.00201
NP_442808.1_1 Reverse -268 -278 8.73102 0.0481
NP_442808.1_1 Forward -184 -174 5.68278 0.144
NP_442808.1_1 Reverse -41 -51 5.48612 0.151
NP_442808.1_1 Reverse -149 -159 4.7978 0.19
NP_442808.1_1 Reverse -362 -372 1.45457 0.285
NP_441101.1_1 Reverse -267 -285 9.16393 0.289
NP_442775.1_6 Forward -93 -74 10.1275 0.279
NP_440145.1_3 Reverse -259 -278 -5.11376 0.258
NP_442542.1_9 Forward -285 -271 11.897 0.111
NP_442050.1_5 Reverse -267 -277 17.1874 0.00812
NP_442050.1_5 Forward -280 -270 8.23937 0.234
NP_442342.1_9 Forward -280 -264 17.6598 0.0732
NP_440558.1_2 Reverse -105 -124 -7.27704 0.291
NP_441048.1_4 Forward -272 -253 9.0459 0.283
NP_442789.1_4 Forward -280 -261 -6.68705 0.287
NP_442789.1_4 Reverse -267 -286 -8.06369 0.299
NP_441518.1_3 Forward -288 -269 -5.70374 0.126
NP_441878.1_6 Reverse -268 -278 10.5014 0.0176
NP_441878.1_6 Forward -279 -269 10.4031 0.0176
NP_441878.1_6 Reverse -167 -177 -7.78811 0.266
NP_441036.1_8 Forward -279 -269 17.7779 0.000554
NP_441036.1_8 Reverse -268 -278 15.713 0.00724
NP_442650.1_2 Forward -278 -264 7.07942 0.13
NP_442721.1_4 Forward -350 -331 20.7473 0.0723
NP_442721.1_4 Reverse -76 -95 14.6508 0.291
NP_441557.1_5 Forward -278 -269 19.9609 0.000699
NP_441557.1_5 Reverse -269 -278 19.9609 0.000699
NP_441557.1_8 Reverse -248 -258 10.9926 0.269
NP_441557.1_8 Reverse -307 -317 10.0093 0.3
NP_441590.1_2 Forward -320 -307 17.7189 0.295
NP_441590.1_3 Forward -294 -275 11.6025 0.205
NP_442066.2_4 Forward -278 -259 -8.16202 0.294
NP_442066.2_9 Forward -282 -269 8.37742 0.185
NP_440738.1_5 Reverse -201 -220 1.27776 0.293
NP_441308.1_8 Reverse -267 -277 12.4681 0.218
NP_441308.1_8 Forward -280 -270 9.22315 0.226
NP_440101.1_3 Reverse -163 -182 2.0644 0.259
NP_440101.1_10 Forward -284 -265 3.44104 0.236
NP_442830.1_5 Forward -395 -381 4.03056 0.239
NP_442830.1_5 Reverse -148 -162 4.03056 0.239
NP_442183.1_1 Reverse -269 -283 20.6491 0.00378
NP_442183.1_1 Forward -278 -264 15.4376 0.021
NP_442183.1_1 Forward -159 -145 11.8976 0.0663
NP_440676.1_3 Forward -275 -256 7.57094 0.278
NP_442397.1_9 Reverse -143 -162 13.4708 0.22
NP_442397.1_9 Forward -159 -140 3.6377 0.264
NP_442397.1_9 Forward -190 -171 2.55606 0.273
NP_441116.1_9 Forward -86 -72 17.6008 0.126
NP_441116.1_9 Forward -220 -206 15.6342 0.178
NP_442135.1_2 Forward -46 -28 16.8661 0.287
NP_441574.1_1 Forward -278 -259 -2.45882 0.226
NP_441549.1_9 Forward -282 -264 -7.45401 0.207
NP_441238.1_9 Forward -205 -186 13.5691 0.296
NP_442347.1_2 Reverse -270 -279 11.1111 0.056
NP_442347.1_2 Reverse -301 -310 8.06287 0.116
NP_442347.1_2 Forward -277 -268 3.34298 0.284
NP_442645.1_2 Forward -161 -142 -17.3068 0.253
NP_442645.1_2 Reverse -267 -286 -21.1417 0.29
NP_441037.1_4 Reverse -267 -277 16.5761 0.0168
NP_441037.1_4 Forward -280 -270 16.2838 0.0168
NP_441037.1_4 Reverse -166 -176 5.95329 0.289
NP_442594.1_8 Forward -257 -238 13.3725 0.147
NP_441633.1_3 Forward -280 -267 5.91914 0.0481
NP_441633.1_3 Reverse -267 -280 3.95252 0.0699
NP_440136.1_2 Forward -277 -270 15.9687 0.0123
NP_440136.1_2 Reverse -270 -277 15.9687 0.0123
NP_442590.1_10 Forward -189 -170 5.30933 0.264
NP_442590.1_10 Reverse -168 -187 3.93269 0.283
NP_441728.2_4 Reverse -89 -108 14.1801 0.23
NP_442998.1_5 Forward -44 -34 8.92815 0.26
NP_442998.1_10 Forward -276 -269 15.5754 0.0102
NP_442998.1_10 Reverse -271 -278 15.5754 0.0102
NP_442998.1_10 Reverse -25 -32 10.4622 0.0819
NP_440299.1_1 Reverse -265 -278 12.7034 0.0356
NP_440299.1_1 Forward -282 -269 11.4251 0.0489
NP_441799.1_1 Reverse -265 -279 9.34041 0.0942
NP_441799.1_1 Forward -282 -268 3.44058 0.298
NP_442802.1_6 Reverse -268 -287 1.17943 0.204
NP_441007.1_10 Reverse -264 -277 13.0973 0.0499
NP_441007.1_10 Forward -283 -270 3.16588 0.182
NP_442334.1_2 Forward -288 -271 -4.87771 0.2
NP_440256.1_1 Reverse -266 -285 10.3242 0.0186
NP_442961.1_7 Reverse -270 -289 7.96426 0.263
NP_441559.1_8 Reverse -264 -278 1.27789 0.156
NP_441559.1_8 Forward -164 -150 1.17956 0.156
NP_441559.1_8 Forward -178 -164 -3.83532 0.211
NP_441559.1_8 Reverse -252 -266 -6.09693 0.274
NP_441559.1_8 Forward -283 -269 -6.19526 0.275
NP_441559.1_8 Reverse -274 -288 -7.17857 0.287
NP_440915.1_6 Forward -282 -268 24.9757 0.000297
NP_440915.1_6 Reverse -265 -279 13.3726 0.0187
NP_441939.1_3 Forward -277 -258 16.8141 0.035
NP_441199.1_6 Forward -282 -263 17.6007 0.0257
NP_441199.1_6 Reverse -265 -284 9.93088 0.0819
NP_441199.1_6 Forward -178 -159 2.85105 0.194
NP_441494.1_6 Reverse -264 -277 18.6038 0.059
NP_441494.1_6 Reverse -192 -205 10.344 0.227
NP_442993.1_1 Reverse -174 -190 -4.07137 0.137
NP_442993.1_1 Forward -278 -262 -10.5612 0.222
NP_442386.1_9 Forward -279 -270 15.7322 0.0144
NP_442386.1_9 Reverse -268 -277 6.39082 0.219
NP_441340.1_5 Forward -277 -270 15.6737 0.0124
NP_441340.1_5 Reverse -270 -277 15.6737 0.0124
NP_441947.1_10 Forward -280 -262 3.3624 0.276
NP_440168.1_8 Forward -284 -265 5.99764 0.205
NP_442240.1_1 Reverse -261 -280 5.50519 0.264
NP_442240.1_1 Forward -185 -166 4.32522 0.273
NP_442240.1_2 Forward -277 -258 -12.8819 0.163
NP_440161.1_3 Reverse -195 -214 11.8975 0.196
NP_440586.1_1 Reverse -262 -281 -4.72043 0.278
NP_440586.1_1 Reverse -160 -179 -6.39206 0.299
NP_440586.1_4 Forward -256 -238 13.1955 0.25
NP_440586.1_8 Forward -277 -270 13.2151 0.026
NP_440586.1_8 Reverse -270 -277 13.2151 0.026
NP_440586.1_8 Reverse -241 -248 7.02027 0.279
NP_442251.1_6 Forward -277 -270 15.2804 0.0124
NP_442251.1_6 Reverse -270 -277 15.2804 0.0124
NP_440192.1_4 Forward -352 -333 9.78569 0.264
NP_441262.1_3 Reverse -269 -276 14.7888 0.0223
NP_441262.1_3 Forward -278 -271 14.7888 0.0223
NP_443051.1_1 Reverse -268 -277 19.5676 0.00335
NP_443051.1_1 Forward -279 -270 10.4228 0.00754
NP_439937.1_8 Forward -280 -261 9.63589 0.19
NP_439937.1_8 Forward -292 -273 -0.688862 0.241
NP_439937.1_8 Reverse -267 -286 -3.04881 0.265
NP_439937.1_9 Forward -279 -262 -8.41828 0.176
NP_439937.1_9 Forward -396 -379 -12.7448 0.276
NP_439937.1_9 Reverse -242 -259 -12.9415 0.278
NP_440398.1_6 Reverse -246 -265 2.45773 0.294
NP_440408.1_7 Reverse -168 -187 7.66927 0.284
NP_440408.1_10 Reverse -263 -282 18.0924 0.0923
NP_440439.1_1 Reverse -266 -279 17.5222 0.0105
NP_440439.1_1 Forward -281 -268 9.36073 0.0465
NP_440439.1_1 Forward -162 -149 1.69091 0.147
NP_440372.1_2 Forward -277 -270 16.3621 0.0124
NP_440372.1_2 Reverse -270 -277 16.3621 0.0124
NP_440171.1_3 Reverse -162 -181 2.3594 0.287
NP_442511.1_5 Forward -298 -279 10.4615 0.291
NP_441789.1_7 Forward -182 -163 -2.45958 0.257
NP_440819.1_5 Forward -45 -37 7.8859 0.266
NP_441803.1_2 Reverse -264 -283 18.1907 0.0309
NP_439977.1_5 Forward -284 -265 13.2741 0.0531
NP_439977.1_5 Reverse -263 -282 7.57094 0.117
NP_440210.1_2 Reverse -142 -161 16.0274 0.173
NP_442384.1_10 Forward -278 -265 9.36073 0.054
NP_442384.1_10 Reverse -269 -282 2.2809 0.23
NP_442114.1_4 Reverse -269 -280 12.1534 0.107
NP_441877.1_7 Forward -283 -264 10.7167 0.141
NP_441877.1_7 Reverse -252 -271 5.99684 0.218
NP_442790.1_4 Forward -287 -268 11.9958 0.0638
NP_442790.1_4 Reverse -260 -279 -8.35868 0.168
NP_442790.1_4 Reverse -273 -292 -8.55534 0.172
NP_442790.1_4 Forward -133 -114 -15.5368 0.294
NP_442262.1_10 Forward -277 -270 14.1988 0.0123
NP_442262.1_10 Reverse -270 -277 14.1988 0.0123
NP_441689.1_5 Reverse -267 -277 8.43603 0.132
NP_440163.1_10 Forward -284 -274 9.81313 0.222
NP_440344.1_10 Forward -285 -268 16.0668 0.00412
NP_440344.1_10 Reverse -262 -279 0.235503 0.0365
NP_440531.1_6 Forward -167 -148 -4.42544 0.28
NP_440189.1_2 Reverse -261 -280 5.50599 0.268
NP_441965.1_10 Forward -281 -265 2.8118 0.282
NP_442529.1_4 Forward -287 -268 7.37428 0.289
NP_440297.1_9 Reverse -270 -280 -0.216628 0.282
NP_440297.1_9 Forward -277 -267 -0.314959 0.282
NP_441896.1_3 Forward -287 -268 1.37609 0.217
NP_440990.1_7 Forward -290 -271 6.78429 0.243
NP_440894.1_7 Forward -226 -207 13.8633 0.163
NP_440894.1_10 Forward -283 -264 14.4541 0.0965
NP_440894.1_10 Reverse -264 -283 2.94938 0.279
NP_441565.1_1 Forward -102 -83 12.8808 0.0656
NP_440999.1_2 Forward -265 -246 17.994 0.102
NP_440999.1_9 Forward -282 -268 21.1407 0.0083
NP_440999.1_9 Reverse -265 -279 3.93283 0.12
NP_440888.1_2 Reverse -269 -283 18.2885 0.00261
NP_440888.1_2 Forward -278 -264 15.9285 0.00837
NP_440888.1_2 Forward -325 -311 5.99717 0.254
NP_442454.1_1 Forward -70 -52 14.2981 0.221
NP_440491.1_1 Forward -281 -262 11.595 0.167
NP_440491.1_1 Reverse -266 -285 6.7221 0.289
NP_442948.1_2 Reverse -268 -287 4.12936 0.273
NP_440663.1_6 Reverse -37 -56 5.70265 0.28
NP_442277.1_4 Forward -287 -268 13.5683 0.0528
NP_442277.1_4 Forward -186 -167 4.62021 0.189
NP_442277.1_4 Reverse -260 -279 1.76863 0.266
NP_442033.1_10 Forward -280 -261 -6.98204 0.186
NP_442033.1_10 Forward -176 -157 -9.73531 0.221
NP_442033.1_10 Forward -352 -333 -13.7669 0.289
NP_441123.1_4 Forward -291 -277 18.6818 0.121
NP_441543.1_2 Reverse -270 -279 18.486 0.00236
NP_441543.1_2 Forward -277 -268 15.9293 0.00518
NP_442845.1_2 Reverse -263 -277 15.7325 0.0694
NP_441918.1_7 Reverse -218 -237 2.3594 0.265
NP_440982.1_1 Reverse -240 -259 8.4551 0.294
NP_441469.1_8 Forward -279 -270 16.126 0.00797
NP_441469.1_8 Reverse -268 -277 6.5879 0.227
NP_441548.1_1 Forward -227 -208 16.9124 0.081
NP_443064.1_6 Forward -278 -268 10.8217 0.13
NP_443064.1_6 Reverse -316 -326 8.6886 0.276
NP_442337.1_8 Forward -129 -110 -0.983855 0.278
NP_442578.1_7 Forward -277 -270 14.5921 0.026
NP_442578.1_7 Reverse -270 -277 14.5921 0.026
NP_441462.1_2 Forward -278 -268 20.2362 0.000805
NP_441462.1_2 Reverse -269 -279 11.5831 0.00406
NP_441621.1_7 Forward -280 -266 23.7957 0.00827
NP_441621.1_7 Reverse -267 -281 6.48943 0.068
NP_441621.1_7 Forward -289 -275 1.27789 0.145
NP_441621.1_7 Reverse -163 -177 -4.4253 0.223
NP_441621.1_7 Reverse -166 -180 -6.29359 0.283
NP_443062.1_1 Reverse -269 -287 5.81572 0.218
NP_443062.1_1 Forward -278 -260 4.84065 0.247
NP_441410.1_4 Forward -127 -108 7.17681 0.297
NP_442204.1_1 Reverse -265 -276 11.9567 0.0565
NP_442204.1_2 Reverse -272 -291 8.06259 0.26
NP_442204.1_5 Forward -288 -269 8.06259 0.124
NP_441560.1_8 Reverse -264 -283 19.6933 0.0119
NP_440516.1_8 Forward -278 -269 16.9127 0.00442
NP_440516.1_8 Reverse -269 -278 16.9127 0.00442
NP_440516.1_8 Forward -51 -42 -0.590259 0.283
NP_441785.1_1 Reverse -269 -283 16.0349 0.113
NP_441033.1_2 Forward -288 -269 -7.17871 0.293
NP_442428.1_4 Forward -131 -112 3.83436 0.238
NP_442428.1_5 Forward -277 -270 15.8704 0.0124
NP_442428.1_5 Reverse -270 -277 15.8704 0.0124
NP_440818.1_6 Forward -289 -270 9.53756 0.228
NP_442859.1_2 Forward -277 -258 5.99764 0.201
NP_440618.1_1 Reverse -162 -181 -10.522 0.297
NP_442120.1_10 Forward -284 -265 -5.11376 0.199
NP_440673.1_2 Forward -288 -269 17.9011 0.0464
NP_440673.1_3 Forward -276 -269 12.4288 0.0426
NP_440673.1_3 Reverse -271 -278 12.4288 0.0426
NP_440673.1_3 Reverse -11 -18 8.59391 0.213
NP_440673.1_7 Forward -289 -270 5.01433 0.185
NP_440673.1_7 Reverse -271 -290 0.196116 0.272
NP_440865.1_9 Reverse -263 -282 8.94757 0.0586
NP_441052.1_2 Reverse -269 -279 10.5014 0.0285
NP_441052.1_2 Forward -278 -268 10.4031 0.0285
NP_442219.1_9 Reverse -270 -279 8.35786 0.0681
NP_442219.1_9 Forward -277 -268 8.25953 0.0681
NP_442219.1_9 Reverse -182 -191 2.85133 0.218
NP_440436.1_4 Reverse -270 -279 18.1905 0.00233
NP_440436.1_4 Forward -277 -268 9.24241 0.0871
NP_441884.1_8 Forward -207 -188 -9.24366 0.268
NP_441884.1_8 Forward -279 -260 -10.7186 0.268
NP_441884.1_9 Reverse -266 -285 -4.03212 0.0594
NP_441884.1_9 Reverse -273 -292 -10.817 0.0869
NP_441884.1_9 Forward -281 -262 -12.8819 0.138
NP_442086.1_6 Reverse -257 -276 12.2908 0.255
NP_441719.1_4 Forward -277 -270 16.3621 0.0124
NP_441719.1_4 Reverse -270 -277 16.3621 0.0124
NP_441733.1_10 Reverse -266 -279 15.6539 0.0564
NP_441733.1_10 Forward -281 -268 10.5407 0.106
NP_441733.1_10 Forward -375 -362 4.93583 0.236
NP_441004.1_1 Reverse -263 -282 -8.26035 0.2
NP_441004.1_1 Forward -91 -72 -9.44032 0.207
NP_441004.1_1 Reverse -162 -181 -16.7168 0.287
NP_441004.1_1 Forward -271 -252 -17.0118 0.288
NP_442366.1_3 Forward -279 -261 16.0471 0.0198
NP_442366.1_3 Reverse -268 -286 1.10079 0.158
NP_442366.1_5 Forward -312 -302 11.1893 0.207
NP_440129.1_10 Forward -285 -271 4.32615 0.185
NP_442873.1_9 Forward -288 -269 3.34192 0.295
NP_440296.1_10 Reverse -266 -285 -14.2585 0.269
NP_440296.1_10 Reverse -165 -184 -15.2418 0.29
NP_441115.1_4 Forward -279 -261 11.0314 0.154
NP_442694.1_4 Reverse -385 -394 12.9794 0.225
NP_442694.1_9 Forward -214 -195 18.3873 0.125
NP_442206.1_4 Forward -277 -258 6.88262 0.259
NP_442206.1_10 Reverse -269 -284 2.33984 0.202
NP_440328.1_4 Forward -284 -265 -0.295539 0.272
NP_443054.1_2 Reverse -267 -281 12.586 0.0722
NP_442430.1_4 Forward -280 -261 16.8141 0.137
NP_441851.1_10 Forward -279 -269 16.008 0.00552
NP_441851.1_10 Reverse -268 -278 8.53483 0.114
NP_442208.1_5 Forward -280 -261 -10.227 0.298
NP_441157.1_1 Reverse -94 -108 6.98048 0.187
NP_442622.1_1 Reverse -268 -287 -11.4069 0.257
NP_442856.1_7 Forward -287 -268 -5.31042 0.276
NP_441396.1_5 Forward -248 -239 8.35786 0.224
NP_440593.1_3 Forward -283 -264 1.47442 0.19
NP_440165.1_5 Reverse -268 -287 3.44104 0.103
NP_440940.1_7 Forward -288 -270 21.4545 0.0167
NP_441349.1_10 Reverse -259 -278 -9.73531 0.297
NP_440389.1_5 Reverse -16 -35 11.2584 0.287
NP_440432.1_9 Reverse -270 -285 9.71466 0.0419
NP_439960.1_10 Reverse -262 -280 -4.50408 0.293
NP_440474.1_8 Reverse -270 -284 9.43874 0.16
NP_440431.1_3 Reverse -196 -215 -8.16202 0.226
NP_440588.1_2 Reverse -260 -279 8.55425 0.0455
NP_440195.1_4 Forward -352 -333 4.12936 0.297
NP_442006.1_2 Reverse -269 -286 -15.3008 0.221
NP_442006.1_2 Forward -287 -270 -16.8741 0.265
NP_443047.1_6 Reverse -256 -275 19.0757 0.103
NP_441570.1_1 Reverse -269 -287 -0.964162 0.0525
NP_441570.1_1 Reverse -150 -168 -9.81395 0.15
NP_441078.1_4 Forward -278 -269 19.6659 0.0007
NP_441078.1_4 Reverse -269 -278 19.6659 0.0007
NP_441078.1_4 Reverse -23 -32 5.80125 0.104
NP_441078.1_4 Forward -32 -23 5.70292 0.111
NP_441078.1_4 Reverse -150 -159 5.3096 0.113
NP_441078.1_4 Forward -159 -150 -0.983583 0.213
NP_442729.1_8 Forward -282 -269 8.47575 0.125
NP_442729.1_8 Reverse -146 -159 8.08242 0.125
NP_442348.1_2 Reverse -384 -393 7.37455 0.28
NP_440707.1_6 Reverse -309 -328 13.2733 0.185
NP_440707.1_6 Forward -167 -148 12.585 0.213
NP_442443.1_1 Reverse -378 -397 4.12936 0.161
NP_442443.1_1 Reverse -249 -268 -0.4922 0.224
NP_440526.1_3 Reverse -270 -281 11.7595 0.0646
NP_440526.1_3 Forward -277 -266 9.3996 0.0876
NP_440526.1_3 Forward -176 -165 0.353199 0.287
NP_441432.1_8 Reverse -268 -277 16.8143 0.00595
NP_441432.1_8 Forward -279 -270 8.25953 0.0755
NP_441432.1_8 Forward -52 -43 3.04799 0.268
NP_443024.1_2 Reverse -75 -88 17.6199 0.156
NP_442320.1_8 Forward -284 -270 14.4542 0.0132
NP_442320.1_8 Reverse -263 -277 -0.885388 0.0817
NP_441732.1_2 Reverse -265 -281 3.30346 0.0141
NP_441732.1_2 Forward -282 -266 -14.9861 0.145
NP_442540.1_5 Reverse -264 -283 14.0599 0.233
NP_440760.1_1 Forward -278 -259 -4.91709 0.0475
NP_442146.1_5 Forward -339 -320 14.2574 0.188
NP_440913.1_1 Reverse -267 -285 9.85225 0.176
NP_441072.1_2 Reverse -258 -277 7.96426 0.246
NP_440713.1_4 Reverse -259 -278 8.35759 0.17
NP_442489.1_7 Forward -278 -269 20.1576 0.000695
NP_442489.1_7 Reverse -269 -278 20.1576 0.000695
NP_442489.1_7 Forward -159 -150 -1.96689 0.28
NP_440559.1_1 Reverse -270 -279 8.75118 0.0586
NP_440559.1_1 Forward -277 -268 8.65285 0.0586
NP_441659.2_8 Forward -278 -268 20.9245 0.000805
NP_441659.2_8 Reverse -269 -279 11.9764 0.0147
NP_442913.1_10 Reverse -159 -178 0.491109 0.153
NP_442913.1_10 Forward -287 -268 -2.45882 0.186
NP_439956.1_7 Forward -129 -110 2.65439 0.273
NP_442776.1_1 Forward -170 -151 5.30933 0.252
NP_442776.1_6 Reverse -195 -214 10.4225 0.207
NP_440779.1_5 Reverse -269 -286 3.97208 0.0577
NP_442346.1_5 Reverse -268 -278 16.303 0.00248
NP_442346.1_5 Forward -279 -269 9.02648 0.118
NP_442346.1_10 Reverse -267 -286 -1.37718 0.291
NP_440545.1_3 Reverse -265 -282 17.6401 0.0108
NP_440545.1_3 Forward -282 -265 10.6586 0.031
NP_440545.1_3 Reverse -164 -181 3.77542 0.079
NP_441856.1_6 Forward -267 -253 15.3392 0.265
NP_440459.1_2 Reverse -254 -271 14.0018 0.119
NP_440010.1_3 Forward -290 -271 -4.52377 0.25
NP_440010.1_4 Reverse -259 -278 -2.95123 0.293
NP_442603.1_9 Reverse -238 -256 6.11567 0.293
NP_441888.1_7 Forward -283 -269 12.0943 0.0743
NP_440449.1_6 Reverse -261 -279 9.03394 0.188
NP_440449.1_6 Forward -286 -268 6.99141 0.236
NP_441948.1_4 Reverse -157 -175 -6.4707 0.299
NP_441833.1_4 Forward -277 -270 15.9687 0.0124
NP_441833.1_4 Reverse -270 -277 15.9687 0.0124
NP_442162.1_9 Forward -277 -270 16.2637 0.0124
NP_442162.1_9 Reverse -270 -277 16.2637 0.0124
NP_440671.1_4 Reverse -263 -277 11.701 0.127
NP_440772.1_6 Reverse -249 -268 8.65258 0.292
NP_440772.1_8 Reverse -357 -376 7.37428 0.284
NP_442073.1_6 Reverse -260 -279 -2.36049 0.286
NP_442199.1_5 Reverse -261 -280 -0.590531 0.177
NP_442140.1_3 Reverse -270 -280 17.4829 0.0159
NP_442140.1_3 Forward -277 -267 7.94484 0.124
NP_442140.1_3 Forward -339 -329 6.76487 0.159
NP_440875.1_9 Reverse -271 -281 17.619 0.0104
NP_440875.1_9 Forward -276 -266 17.5217 0.0116
NP_442547.1_7 Reverse -253 -272 10.3196 0.279
NP_441813.1_5 Forward -280 -270 10.0098 0.0208
NP_441813.1_5 Reverse -267 -277 8.73149 0.0367
NP_440590.1_4 Reverse -270 -283 14.6706 0.0106
NP_440590.1_4 Forward -277 -264 4.44418 0.0601
NP_440567.1_1 Forward -277 -263 16.3225 0.0166
NP_440567.1_1 Reverse -270 -284 15.5359 0.017
NP_442497.1_10 Forward -277 -268 17.601 0.00813
NP_442497.1_10 Reverse -270 -279 10.4228 0.0087
NP_440821.1_4 Forward -280 -270 18.7612 0.00422
NP_440821.1_4 Reverse -267 -277 10.7964 0.0146
NP_441239.1_9 Reverse -267 -279 17.4436 0.0146
NP_441239.1_9 Forward -280 -268 16.0669 0.0175
NP_441239.1_9 Forward -185 -173 4.75886 0.243
NP_441239.1_9 Forward -275 -263 3.18557 0.292
NP_441951.1_9 Reverse -203 -222 1.67108 0.254
NP_441727.1_3 Forward -285 -266 8.06259 0.213
NP_441892.1_1 Reverse -260 -277 12.2319 0.0499
NP_441892.1_1 Forward -287 -270 3.87375 0.119
NP_440604.1_6 Forward -278 -259 -5.9004 0.287
NP_442044.1_1 Reverse -264 -283 -3.24547 0.176
NP_442193.1_8 Forward -281 -262 10.52 0.286
NP_442270.1_9 Forward -289 -270 -10.0303 0.249
NP_441017.1_8 Reverse -194 -209 9.12468 0.231
NP_440354.1_5 Forward -281 -262 4.81767 0.207
NP_441617.1_6 Forward -39 -20 -5.70374 0.274
NP_442138.1_10 Reverse -269 -288 2.0644 0.12
NP_441782.1_10 Reverse -261 -275 14.3948 0.296
NP_440546.1_4 Forward -278 -268 13.5365 0.0459
NP_440546.1_4 Reverse -269 -279 11.8882 0.0679
NP_440546.1_4 Forward -340 -330 10.046 0.109
NP_439974.1_4 Forward -289 -270 11.7008 0.228
NP_441230.1_5 Forward -283 -264 5.50599 0.182
NP_440675.1_3 Forward -340 -321 6.68596 0.261
NP_440462.1_6 Reverse -267 -277 19.4496 0.00371
NP_440462.1_6 Forward -280 -270 17.9746 0.00578
NP_442611.1_1 Reverse -264 -283 11.9958 0.07
NP_440868.1_4 Reverse -265 -277 7.4138 0.0691
NP_440868.1_4 Forward -282 -270 2.98891 0.142
NP_442499.1_3 Forward -279 -261 5.42735 0.282
NP_442402.1_4 Reverse -135 -154 -8.45774 0.282
NP_441084.1_6 Reverse -267 -281 11.2833 0.208
NP_441084.1_6 Reverse -329 -343 9.24716 0.29
NP_442039.1_4 Forward -277 -270 15.1821 0.0124
NP_442039.1_4 Reverse -270 -277 15.1821 0.0124
NP_441811.1_8 Reverse -162 -176 6.58777 0.267
NP_440825.1_7 Forward -331 -321 11.3482 0.247
NP_442696.1_6 Reverse -109 -128 -11.1119 0.235
NP_442837.1_3 Forward -277 -270 15.7721 0.0124
NP_442837.1_3 Reverse -270 -277 15.7721 0.0124
NP_442053.1_1 Forward -278 -269 18.3876 0.0007
NP_442053.1_1 Reverse -269 -278 18.3876 0.0007
NP_440505.1_3 Reverse -267 -277 15.418 0.0114
NP_440505.1_3 Forward -280 -270 14.1397 0.0235
NP_440505.1_3 Reverse -148 -158 7.35486 0.157
NP_441203.1_1 Forward -277 -258 -3.63879 0.0702
NP_442532.1_7 Forward -278 -264 6.98109 0.171
NP_442532.1_7 Reverse -269 -283 6.88276 0.171
NP_441408.2_7 Forward -280 -261 -4.13045 0.279
NP_440914.1_1 Forward -278 -268 16.3248 0.00196
NP_440914.1_1 Reverse -269 -279 8.6151 0.186
NP_441011.1_8 Reverse -270 -279 16.9127 0.00602
NP_441011.1_8 Forward -277 -268 16.6177 0.00602
NP_442533.1_1 Reverse -164 -183 -14.0619 0.239
NP_442533.1_1 Reverse -161 -180 -15.9302 0.26
NP_442533.1_1 Forward -140 -121 -17.3068 0.285
NP_442533.1_6 Forward -278 -269 17.2076 0.00137
NP_442533.1_6 Reverse -269 -278 17.2076 0.00137
NP_441089.1_8 Reverse -112 -131 15.3382 0.266
NP_440263.1_5 Forward -212 -198 7.86607 0.294
NP_442232.1_3 Reverse -261 -280 12.4875 0.052
NP_442232.1_3 Reverse -160 -179 -14.8485 0.288
NP_442229.1_1 Reverse -267 -281 8.94708 0.184
NP_441482.1_7 Reverse -263 -277 8.65272 0.0162
NP_441482.1_7 Forward -284 -270 -10.2268 0.209
NP_441482.1_7 Reverse -109 -123 -11.4068 0.262
NP_439944.1_9 Forward -277 -267 17.7779 0.00341
NP_439944.1_9 Reverse -270 -280 10.4031 0.0887
NP_441028.1_6 Reverse -235 -245 7.74772 0.218
NP_441028.1_6 Reverse -37 -47 5.19112 0.265
NP_440116.1_8 Reverse -270 -289 -9.73531 0.287
NP_440115.1_6 Reverse -266 -276 16.9913 0.0288
NP_440007.1_9 Forward -162 -148 5.01447 0.266
NP_439965.1_1 Reverse -260 -279 -5.9004 0.211
NP_441347.1_5 Reverse -263 -277 8.25877 0.294
NP_441059.1_2 Reverse -328 -347 -0.983855 0.242
NP_441602.1_3 Reverse -264 -283 7.37428 0.12
NP_441602.1_3 Forward -283 -264 6.09597 0.139
NP_441972.1_5 Reverse -270 -289 -4.6221 0.211
NP_441972.1_5 Forward -277 -258 -5.50708 0.222
NP_441972.1_5 Reverse -246 -265 -6.49039 0.231
NP_441972.1_5 Reverse -258 -277 -9.53865 0.288
NP_441106.1_1 Reverse -268 -277 18.486 0.0028
NP_441106.1_1 Forward -279 -270 18.191 0.0028
NP_439903.1_6 Forward -281 -262 5.99684 0.173
NP_439903.1_6 Reverse -266 -285 3.24359 0.211
NP_441286.1_1 Reverse -268 -280 5.34885 0.0259
NP_441286.1_1 Forward -279 -267 5.15219 0.0259
NP_440670.1_8 Forward -278 -269 18.3876 0.000699
NP_440670.1_8 Reverse -269 -278 18.3876 0.000699
NP_441705.1_3 Forward -91 -72 -6.58872 0.291
NP_440886.1_7 Forward -279 -269 17.7774 0.0011
NP_440886.1_7 Reverse -268 -278 8.04271 0.0805
NP_440828.1_4 Forward -294 -275 -6.09781 0.265
NP_441399.1_6 Reverse -144 -163 14.1583 0.185
NP_442072.1_9 Forward -279 -261 -12.9605 0.095
NP_442072.1_9 Reverse -268 -286 -13.2555 0.106
NP_440907.2_8 Forward -277 -267 19.1541 0.00362
NP_440907.2_8 Reverse -270 -280 17.4824 0.00685
NP_440907.2_8 Forward -189 -179 3.8145 0.297
NP_441021.1_1 Forward -277 -258 -4.13045 0.167
NP_441021.1_1 Reverse -270 -289 -11.0136 0.254
NP_441021.1_4 Reverse -369 -388 15.3391 0.241
NP_440193.1_1 Forward -280 -261 19.5317 0.0953
NP_441463.1_3 Forward -288 -269 -9.44032 0.28
NP_441626.1_2 Forward -277 -270 15.7721 0.0124
NP_441626.1_2 Reverse -270 -277 15.7721 0.0124
NP_441988.1_5 Reverse -251 -270 14.0608 0.274
NP_442238.1_3 Reverse -374 -393 4.52268 0.278
NP_440107.1_5 Reverse -262 -281 -6.98204 0.272
NP_442794.1_1 Reverse -265 -277 3.57889 0.286
NP_442615.1_1 Reverse -260 -278 9.55725 0.0249
NP_442615.1_1 Forward -287 -269 -0.964162 0.123
NP_442615.1_1 Forward -215 -197 -7.55234 0.296
NP_441962.1_4 Reverse -264 -283 18.9773 0.0137
NP_441962.1_4 Forward -283 -264 -10.0303 0.223
NP_440387.1_1 Forward -278 -262 16.1848 0.0047
NP_440387.1_1 Reverse -269 -285 8.41667 0.0282
NP_440387.1_1 Forward -32 -16 -6.33298 0.279
NP_440855.1_5 Forward -280 -261 4.52188 0.285
NP_441431.1_2 Forward -281 -267 15.0436 0.0537
NP_441431.1_2 Reverse -266 -280 13.7653 0.0806
NP_441488.1_7 Reverse -263 -282 17.0107 0.0543
NP_441993.1_1 Reverse -263 -282 14.2263 0.0786
NP_441993.1_1 Forward -278 -259 2.72635 0.254
NP_441174.1_2 Reverse -266 -280 21.4357 0.00137
NP_440114.1_10 Reverse -269 -283 6.58777 0.263
NP_442437.1_8 Reverse -258 -277 3.73603 0.287
NP_442323.1_7 Forward -164 -145 17.8948 0.042
NP_442323.1_7 Forward -195 -176 7.07848 0.19
NP_440492.1_9 Forward -32 -18 9.69621 0.294
NP_441272.1_4 Reverse -147 -166 3.14605 0.233
NP_440293.1_3 Reverse -261 -280 -3.24547 0.244
NP_440766.1_4 Reverse -265 -279 16.4209 0.0256
NP_440766.1_4 Forward -282 -268 8.35772 0.0871
NP_439988.1_3 Reverse -169 -183 7.27608 0.277
NP_441237.1_9 Forward -189 -179 11.3864 0.184
NP_442743.1_4 Reverse -270 -289 -7.27704 0.279
NP_442743.1_5 Reverse -270 -289 3.83436 0.245
NP_440457.1_1 Reverse -265 -277 6.72548 0.113
NP_440457.1_1 Forward -282 -270 5.34885 0.141
NP_440798.1_1 Reverse -64 -82 9.96199 0.294
NP_441801.1_4 Forward -186 -176 2.63497 0.29
NP_442680.1_5 Forward -243 -224 6.03134 0.213
NP_441332.1_6 Forward -175 -165 13.0989 0.19
NP_441436.1_6 Reverse -269 -288 12.1925 0.193
NP_440473.1_9 Forward -289 -270 2.75272 0.0985
NP_442509.1_1 Forward -180 -161 20.059 0.0726
NP_442509.1_4 Reverse -275 -294 14.5524 0.237
NP_442509.1_5 Forward -181 -164 16.656 0.164
NP_442509.1_9 Reverse -269 -279 16.2041 0.00739
NP_442509.1_9 Forward -278 -268 8.04271 0.192
NP_440554.1_4 Forward -277 -267 15.418 0.0199
NP_440554.1_4 Reverse -270 -280 13.943 0.0218
NP_441845.1_6 Forward -290 -272 8.47561 0.126
NP_441885.1_5 Reverse -269 -279 11.4848 0.00668
NP_441885.1_5 Forward -278 -268 11.3864 0.00668
NP_441885.1_5 Reverse -23 -33 0.176696 0.177
NP_441885.1_5 Forward -51 -41 -1.49493 0.264
NP_442341.1_7 Reverse -268 -282 13.5693 0.0338
NP_442341.1_7 Forward -279 -265 10.816 0.0596
NP_441756.1_5 Forward -282 -263 3.04771 0.205
NP_441173.1_9 Reverse -236 -244 9.85212 0.275
NP_442395.2_4 Forward -279 -260 22.9097 0.0128
NP_443000.1_7 Reverse -267 -277 10.7964 0.0345
NP_443000.1_7 Forward -280 -270 2.04498 0.226
NP_440507.2_3 Reverse -260 -279 6.98015 0.293
NP_441842.1_10 Forward -285 -271 16.9125 0.0273
NP_440275.1_3 Reverse -267 -277 18.6629 0.0082
NP_440275.1_3 Forward -280 -270 17.9746 0.0082
NP_440275.1_3 Reverse -166 -176 5.97822 0.129
NP_440091.1_1 Forward -282 -270 12.6253 0.0353
NP_443046.1_6 Reverse -195 -214 23.3039 0.0421
NP_442354.1_8 Forward -215 -196 6.39097 0.266
NP_442451.1_2 Forward -286 -267 -1.96717 0.179
NP_439962.1_4 Reverse -261 -280 0.491109 0.197
NP_439962.1_4 Forward -286 -267 -5.21209 0.278
NP_440149.1_8 Forward -159 -140 -6.09707 0.24
NP_441105.1_3 Reverse -258 -277 19.5673 0.00876
NP_441105.1_3 Forward -289 -270 -4.72043 0.204
NP_440216.1_1 Reverse -269 -283 -1.5737 0.034
NP_440216.1_1 Forward -278 -264 -2.55701 0.0521
NP_440216.1_1 Reverse -150 -164 -11.2101 0.169
NP_440172.1_1 Forward -278 -268 17.5813 0.00421
NP_440172.1_1 Reverse -269 -279 8.73149 0.0586
NP_440172.1_1 Forward -206 -196 1.94665 0.29
NP_442015.1_10 Reverse -265 -278 4.54251 0.167
NP_442015.1_10 Forward -282 -269 3.95252 0.178
NP_442015.1_10 Forward -194 -181 -0.0790467 0.25
NP_441226.1_7 Forward -277 -270 14.4934 0.0123
NP_441226.1_7 Reverse -270 -277 14.4934 0.0123
NP_442446.1_3 Reverse -257 -276 15.4374 0.199
NP_441111.1_7 Forward -277 -269 18.7023 0.00294
NP_441111.1_7 Reverse -270 -278 18.7023 0.00294
NP_442379.1_10 Reverse -262 -279 0.235503 0.223
NP_441766.1_2 Forward -278 -269 17.5026 0.00297
NP_441766.1_2 Reverse -269 -278 17.5026 0.00297
NP_440416.1_9 Forward -273 -254 -1.08219 0.0632
NP_440416.1_9 Reverse -262 -281 -13.1769 0.163
NP_443052.1_8 Forward -288 -269 9.0459 0.023
NP_440072.1_5 Reverse -166 -184 -2.53746 0.271
NP_440591.1_9 Reverse -262 -280 12.9988 0.0931
NP_441430.1_6 Forward -283 -264 15.8307 0.136
NP_440261.1_5 Forward -277 -264 -1.16069 0.0662
NP_440261.1_5 Reverse -270 -283 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGTGCCCCAAATCCCCTGACAGTTCGTTGGGTTCCAGGGTTTTTAAGGCCACAACTTCCACCGATGGTTCGTTTGCTGATTCCTGCAGTTGGGCATCAATGAAAATTACCCGGTCCACAGCGGCGATCGCCTCGGCCAATTCTGGGGTGAGTTGATGGGTGGAAATAACTCCACAATGGGGCCAGTTTTGCTGAGCAATTTCTTCCGCTAGGTAACGCCCCACGCCGTCGTCCCCCCGCAGGGTATTGCCGTAACCGATGATTAAAGTGGACTTGGTGGATTGGCCTGGCATTCAATTTTCGTTAACCAGCTGGGGTAATTTAGGGGAAACCTACTAAAACTCGATTAGGGTATCGGGATAAAATTTGGCTATAGTCTTCAAGCAACCGGATTACTGTC

CDS

GTGATTAGCAACGCCGCCACCAGCACCCCCGATCGCCTAACTAGCACAGTCCGCAAAACCTATCCCAACTTTAAAGTAATTGTCCTCAACGACGATTTCAACACGTTTCAGCATGTGTCCGATTGCTTGCTTAAATACATCCCCGGCATGACCGGCGATCGGGCTTGGGAATTAACTAATCAAGTCCACTTCGACGGCTTAGCCATTGTTTGGGTGGGGCCCCAGGAGCAGGCGGAATTGTACCATCAACAACTACGGCGGGAAGGTTTGACCATGGCTCCCCTAGAAAAGGCTTAA

Protein

MISNAATSTPDRLTSTVRKTYPNFKVIVLNDDFNTFQHVSDCLLKYIPGMTGDRAWELTNQVHFDGLAIVWVGPQEQAELYHQQLRREGLTMAPLEKA