Your browser is old and dusty. Try Google Chrome!

Details for ssl3335

ORF ssl3335
Accession NP_440741.1
Symbol secE
Category Protein and peptide secretion
Definition preprotein translocase SecE subunit
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -264 -278 4.52282 0.147
NP_441061.1_2 Forward -271 -257 4.22782 0.153
NP_440557.1_1 Reverse -264 -283 2.45773 0.234
NP_440795.1_7 Forward -271 -264 14.6904 0.0123
NP_440795.1_7 Reverse -264 -271 14.6904 0.0123
NP_441418.1_6 Reverse -263 -282 -1.47551 0.0136
NP_441418.1_6 Forward -272 -253 -20.2567 0.108
NP_441418.1_6 Reverse -91 -110 -28.4182 0.205
NP_442291.1_5 Reverse -262 -278 9.30165 0.0521
NP_442291.1_5 Forward -273 -257 5.17175 0.0801
NP_440897.1_6 Forward -272 -253 6.78348 0.0893
NP_441453.1_4 Reverse -263 -271 16.539 0.00633
NP_441453.1_4 Forward -272 -264 16.539 0.00633
NP_441453.1_4 Reverse -54 -62 5.42762 0.135
NP_442151.1_1 Reverse -191 -210 4.03102 0.287
NP_442151.1_6 Reverse -263 -277 19.7641 0.0045
NP_442151.1_6 Forward -272 -258 17.5025 0.00997
NP_442151.1_6 Forward -291 -277 9.83269 0.139
NP_441818.1_1 Reverse -264 -275 18.8393 0.00301
NP_441818.1_1 Forward -271 -260 18.446 0.0046
NP_440226.1_1 Reverse -263 -282 11.0125 0.0571
NP_441465.1_8 Reverse -252 -270 11.4255 0.188
NP_441465.1_8 Reverse -242 -260 9.55725 0.196
NP_442173.1_1 Forward -271 -263 15.4574 0.00633
NP_442173.1_1 Reverse -264 -272 15.4574 0.00633
NP_442752.1_4 Forward -272 -265 13.8055 0.0199
NP_442752.1_4 Reverse -263 -270 13.8055 0.0199
NP_442752.1_4 Forward -358 -351 5.25066 0.256
NP_443027.1_4 Forward -274 -264 14.0414 0.0452
NP_443027.1_4 Reverse -261 -271 14.0414 0.0452
NP_443027.1_4 Forward -293 -283 6.37155 0.283
NP_442975.1_10 Forward -276 -262 13.4703 0.0459
NP_442975.1_10 Reverse -259 -273 12.782 0.0459
NP_442975.1_10 Forward -295 -281 7.96378 0.112
NP_440784.1_7 Forward -271 -264 15.9687 0.0123
NP_440784.1_7 Reverse -264 -271 15.9687 0.0123
NP_442909.1_7 Forward -271 -257 16.1252 0.0918
NP_442909.1_7 Forward -290 -276 7.76712 0.203
NP_442909.1_7 Reverse -264 -278 6.29216 0.252
NP_440061.1_9 Forward -274 -260 12.5853 0.0952
NP_441476.1_6 Forward -211 -192 11.2084 0.286
NP_440878.1_9 Forward -282 -263 -2.55715 0.268
NP_442062.1_8 Forward -272 -262 17.3846 0.00193
NP_442062.1_8 Reverse -263 -273 17.3846 0.00193
NP_442062.1_8 Forward -266 -256 3.81494 0.252
NP_441900.1_2 Forward -292 -274 -4.40646 0.288
NP_441859.1_3 Forward -279 -260 3.9319 0.23
NP_440304.1_4 Forward -274 -264 10.8948 0.051
NP_440304.1_4 Reverse -261 -271 10.8948 0.051
NP_442242.1_4 Forward -271 -264 14.3954 0.0124
NP_442242.1_4 Reverse -264 -271 14.3954 0.0124
NP_442242.1_4 Reverse -283 -290 10.9539 0.12
NP_440044.1_8 Reverse -264 -283 9.73422 0.0647
NP_441781.1_7 Forward -136 -117 6.19431 0.186
NP_442762.1_10 Reverse -182 -201 -11.1119 0.272
NP_439918.1_2 Reverse -264 -283 -4.32711 0.274
NP_439918.1_3 Forward -361 -342 4.52268 0.264
NP_441210.1_3 Reverse -248 -267 17.699 0.134
NP_440893.1_3 Reverse -246 -265 0.785326 0.273
NP_442742.1_9 Reverse -369 -388 -4.42544 0.221
NP_442110.1_7 Reverse -263 -277 18.9775 0.0138
NP_442110.1_7 Forward -272 -258 9.83269 0.0708
NP_441083.1_5 Forward -272 -262 20.3345 0.00053
NP_441083.1_5 Reverse -263 -273 20.3345 0.00053
NP_442827.1_8 Reverse -255 -274 13.6666 0.0402
NP_442827.1_8 Forward -280 -261 3.34192 0.148
NP_441738.1_2 Forward -270 -263 15.28 0.0102
NP_441738.1_2 Reverse -265 -272 15.28 0.0102
NP_441558.1_5 Reverse -261 -280 12.2908 0.069
NP_441558.1_5 Forward -274 -255 4.03102 0.293
NP_440209.1_1 Reverse -263 -271 18.1123 0.00295
NP_440209.1_1 Forward -272 -264 18.1123 0.00295
NP_442889.1_1 Reverse -191 -210 -14.4552 0.273
NP_442889.1_8 Forward -275 -261 11.5037 0.0733
NP_440178.1_7 Forward -273 -254 -4.52377 0.0569
NP_440178.1_7 Reverse -262 -281 -15.7335 0.163
NP_440178.1_7 Forward -136 -117 -21.3384 0.218
NP_441792.1_5 Forward -105 -89 12.6449 0.19
NP_441716.1_1 Forward -272 -258 24.9757 0.000981
NP_441716.1_1 Reverse -263 -277 6.09611 0.207
NP_442111.1_4 Forward -273 -259 9.83269 0.0575
NP_442111.1_4 Reverse -262 -276 3.14618 0.253
NP_442111.1_4 Reverse -309 -323 1.86788 0.293
NP_441495.1_1 Reverse -255 -274 11.1109 0.194
NP_441495.1_1 Forward -280 -261 10.6192 0.194
NP_440906.1_5 Forward -271 -264 15.8704 0.0124
NP_440906.1_5 Reverse -264 -271 15.8704 0.0124
NP_440747.1_10 Forward -275 -263 7.51213 0.00286
NP_440747.1_10 Reverse -260 -272 7.51213 0.00286
NP_441130.1_10 Forward -274 -260 8.35772 0.138
NP_441130.1_10 Reverse -261 -275 7.76774 0.149
NP_441486.1_1 Forward -275 -261 20.9441 0.00262
NP_441486.1_1 Reverse -260 -274 20.8458 0.00269
NP_441486.1_1 Forward -294 -280 0.589577 0.132
NP_441486.1_1 Reverse -51 -65 -5.60527 0.248
NP_441265.1_1 Reverse -121 -140 -1.08219 0.0492
NP_440403.1_4 Reverse -254 -273 -7.57203 0.247
NP_440403.1_10 Reverse -103 -122 7.7676 0.205
NP_440842.1_6 Reverse -338 -357 12.29 0.25
NP_441014.1_5 Forward -211 -193 15.2604 0.2
NP_441014.1_5 Forward -277 -259 11.3272 0.258
NP_441014.1_10 Forward -273 -254 10.0284 0.123
NP_441014.1_10 Reverse -262 -281 1.76863 0.224
NP_441014.1_10 Reverse -246 -265 -0.492971 0.252
NP_442848.1_1 Reverse -257 -271 17.7975 0.0143
NP_442848.1_1 Forward -278 -264 16.5192 0.0143
NP_443018.1_3 Forward -271 -264 14.8871 0.0123
NP_443018.1_3 Reverse -264 -271 14.8871 0.0123
NP_443018.1_3 Forward -265 -258 11.3472 0.0846
NP_443018.1_3 Reverse -254 -261 8.20058 0.153
NP_443018.1_3 Reverse -258 -265 4.16902 0.278
NP_441634.1_8 Forward -274 -260 2.85119 0.16
NP_441634.1_8 Reverse -261 -275 2.16287 0.17
NP_440376.1_1 Forward -272 -263 19.4693 0.000692
NP_440376.1_1 Reverse -263 -272 19.4693 0.000692
NP_440376.1_1 Reverse -197 -206 3.44131 0.203
NP_440376.1_1 Forward -256 -247 -0.000272808 0.285
NP_441588.1_4 Reverse -265 -275 8.63316 0.14
NP_442687.1_7 Forward -273 -263 8.92815 0.0994
NP_442687.1_7 Reverse -262 -272 8.92815 0.0994
NP_440642.1_10 Reverse -4 -18 8.3571 0.206
NP_441013.1_2 Reverse -252 -270 12.8022 0.119
NP_441422.1_7 Forward -107 -90 -4.97604 0.247
NP_440741.1_1 Forward -137 -118 34.4143 0.00000229
NP_440741.1_2 Forward -161 -142 37.8569 0.00000187
NP_440741.1_3 Forward -184 -165 36.3819 0.00000919
NP_440741.1_4 Forward -358 -339 28.8104 0.000248
NP_440741.1_5 Forward -331 -312 25.0756 0.00486
NP_440741.1_7 Forward -393 -374 20.6097 0.0387
NP_440533.1_9 Forward -266 -247 3.24438 0.253
NP_441950.1_7 Reverse -88 -107 -6.78538 0.273
NP_440360.1_5 Forward -132 -113 -2.36049 0.297
NP_442658.1_1 Reverse -261 -271 6.76441 0.214
NP_442658.1_1 Forward -274 -264 6.76441 0.214
NP_442658.1_1 Reverse -255 -265 5.68278 0.258
NP_442782.1_2 Forward -237 -223 2.2612 0.275
NP_441414.1_9 Forward -272 -253 -1.08219 0.0977
NP_441958.1_5 Forward -273 -263 12.2714 0.00183
NP_441958.1_5 Reverse -262 -272 12.2714 0.00183
NP_442836.1_5 Reverse -257 -276 8.06259 0.147
NP_442836.1_10 Forward -25 -15 14.1397 0.212
NP_440203.1_5 Forward -269 -259 14.8275 0.0886
NP_440203.1_5 Reverse -250 -260 9.81266 0.245
NP_443001.1_7 Reverse -264 -283 6.4893 0.27
NP_441097.1_2 Forward -264 -247 10.6586 0.2
NP_439990.1_5 Reverse -258 -271 12.3107 0.114
NP_439990.1_5 Forward -308 -295 10.344 0.128
NP_439990.1_5 Forward -277 -264 9.95071 0.128
NP_442911.1_2 Forward -282 -263 -3.73712 0.117
NP_442911.1_2 Reverse -253 -272 -3.93378 0.122
NP_441580.1_6 Forward -283 -264 7.96426 0.0988
NP_440153.1_5 Forward -271 -257 9.34103 0.127
NP_440153.1_5 Reverse -264 -278 9.04604 0.127
NP_442064.1_4 Reverse -253 -272 4.52188 0.287
NP_443055.1_3 Reverse -254 -273 16.7566 0.0731
NP_443055.1_6 Reverse -106 -124 0.313405 0.246
NP_441099.1_5 Forward -282 -263 -10.7186 0.261
NP_441099.1_5 Reverse -253 -272 -11.2103 0.273
NP_441294.1_7 Forward -276 -262 14.242 0.0448
NP_441294.1_7 Reverse -259 -273 14.146 0.0466
NP_441294.1_7 Reverse -50 -64 9.4426 0.244
NP_440106.1_2 Reverse -254 -272 10.8356 0.297
NP_440106.1_2 Forward -265 -247 9.55725 0.298
NP_441646.1_1 Reverse -307 -326 4.62101 0.191
NP_442438.1_10 Forward -277 -263 14.4542 0.0311
NP_442438.1_10 Reverse -258 -272 8.06273 0.0832
NP_441000.1_6 Forward -167 -153 -4.62196 0.248
NP_440147.1_4 Forward -274 -261 2.08423 0.21
NP_440147.1_4 Reverse -261 -274 2.08423 0.21
NP_441550.1_8 Reverse -261 -271 12.3692 0.0336
NP_441550.1_8 Forward -274 -264 12.3692 0.0336
NP_441550.1_8 Forward -65 -55 5.38779 0.252
NP_441916.1_7 Forward -272 -262 10.3048 0.0261
NP_441916.1_7 Reverse -263 -273 10.3048 0.0261
NP_441041.1_4 Forward -272 -253 3.93269 0.0612
NP_441041.1_4 Reverse -263 -282 -4.91709 0.145
NP_441041.1_4 Reverse -282 -301 -11.1119 0.241
NP_441041.1_4 Reverse -270 -289 -11.8986 0.254
NP_441041.1_4 Forward -278 -259 -12.2919 0.262
NP_441041.1_4 Reverse -85 -104 -12.9802 0.278
NP_440569.1_6 Reverse -88 -107 7.57094 0.228
NP_442004.1_6 Forward -272 -258 11.5043 0.115
NP_442004.1_6 Reverse -257 -271 7.76774 0.156
NP_442004.1_6 Reverse -263 -277 1.86788 0.276
NP_441725.1_5 Forward -271 -261 11.2881 0.0247
NP_441725.1_5 Reverse -264 -274 11.2881 0.0247
NP_439966.1_7 Reverse -261 -271 15.8108 0.0124
NP_439966.1_7 Forward -274 -264 15.8108 0.0124
NP_439966.1_7 Reverse -347 -357 11.9759 0.0528
NP_439966.1_9 Forward -360 -351 7.27622 0.253
NP_442941.1_3 Forward -271 -261 19.9412 0.00262
NP_442941.1_3 Reverse -264 -274 19.9412 0.00262
NP_440289.1_2 Forward -275 -262 13.294 0.0132
NP_440289.1_2 Reverse -260 -273 3.85419 0.0735
NP_441678.1_9 Reverse -192 -211 -2.36049 0.26
NP_439908.1_10 Reverse -112 -131 17.109 0.259
NP_442281.1_1 Forward -277 -263 16.8135 0.00698
NP_442281.1_1 Reverse -49 -63 8.65209 0.0783
NP_442281.1_1 Forward -283 -269 3.53891 0.228
NP_440437.1_1 Forward -278 -259 7.86593 0.0622
NP_440498.1_1 Forward -300 -282 3.65739 0.142
NP_443030.1_4 Forward -263 -244 -4.42544 0.251
NP_441644.1_6 Forward -272 -262 17.3841 0.00127
NP_441644.1_6 Reverse -263 -273 17.3841 0.00127
NP_443049.1_6 Forward -136 -126 12.0313 0.24
NP_440652.1_10 Forward -355 -336 3.14605 0.283
NP_442215.1_2 Reverse -261 -277 15.2015 0.0184
NP_442215.1_2 Reverse -244 -260 6.74504 0.0702
NP_442215.1_2 Forward -274 -258 -3.57971 0.218
NP_442215.1_2 Forward -287 -271 -7.41462 0.294
NP_442029.1_1 Forward -274 -255 -20.1584 0.297
NP_440253.1_2 Reverse -263 -281 8.08229 0.0625
NP_440929.1_8 Forward -272 -263 19.2726 0.000701
NP_440929.1_8 Reverse -263 -272 19.2726 0.000701
NP_440929.1_8 Reverse -54 -63 2.55633 0.254
NP_442933.1_10 Forward -272 -263 17.601 0.00325
NP_442933.1_10 Reverse -263 -272 17.601 0.00325
NP_441751.2_8 Reverse -264 -278 -3.147 0.134
NP_441751.2_8 Forward -271 -257 -3.24533 0.137
NP_442554.1_8 Forward -271 -261 15.9097 0.00747
NP_442554.1_8 Reverse -264 -274 15.9097 0.00747
NP_441762.1_7 Forward -273 -261 -6.84419 0.284
NP_441762.1_7 Reverse -262 -274 -6.84419 0.284
NP_442142.1_4 Forward -275 -262 14.1783 0.0311
NP_442142.1_4 Reverse -260 -273 6.31189 0.169
NP_442142.1_4 Forward -269 -256 5.72191 0.186
NP_442292.1_1 Forward -271 -262 18.486 0.00229
NP_442292.1_1 Reverse -264 -273 18.486 0.00229
NP_442292.1_1 Forward -290 -281 -0.786921 0.287
NP_442016.1_10 Forward -194 -175 10.2259 0.259
NP_441264.1_3 Reverse -121 -140 -3.14714 0.293
NP_441264.1_5 Reverse -158 -177 19.5673 0.000518
NP_439989.1_6 Forward -265 -246 4.22769 0.296
NP_441711.1_4 Forward -281 -262 5.11266 0.182
NP_443009.1_5 Reverse -262 -273 8.90795 0.0965
NP_443009.1_5 Forward -273 -262 8.90795 0.0965
NP_440947.1_7 Reverse -110 -129 14.5524 0.102
NP_441715.1_4 Forward -271 -261 14.828 0.0268
NP_441715.1_4 Reverse -264 -274 14.828 0.0268
NP_441715.1_4 Reverse -283 -293 5.87989 0.172
NP_440357.1_6 Forward -282 -263 6.09597 0.279
NP_440015.1_9 Forward -272 -254 2.37909 0.207
NP_441448.1_3 Forward -158 -139 6.09597 0.132
NP_441468.1_1 Forward -271 -264 15.8704 0.0124
NP_441468.1_1 Reverse -264 -271 15.8704 0.0124
NP_441468.1_1 Reverse -258 -265 3.97235 0.277
NP_441015.1_10 Reverse -258 -277 -4.22878 0.201
NP_441015.1_10 Reverse -264 -283 -10.9153 0.289
NP_441673.1_1 Forward -272 -263 20.8459 0.000698
NP_441673.1_1 Reverse -263 -272 20.8459 0.000698
NP_441826.1_2 Forward -278 -264 23.2057 0.00229
NP_441826.1_2 Reverse -257 -271 11.8976 0.0334
NP_441826.1_2 Forward -272 -258 2.5562 0.125
NP_441826.1_2 Reverse -263 -277 -0.492064 0.213
NP_441826.1_2 Reverse -247 -261 -3.93365 0.29
NP_441826.1_5 Reverse -264 -283 6.4893 0.222
NP_442745.1_1 Reverse -284 -303 10.5209 0.283
NP_442868.1_6 Forward -274 -264 9.91146 0.038
NP_442868.1_6 Reverse -261 -271 9.91146 0.038
NP_442719.1_2 Forward -54 -36 -11.5846 0.292
NP_441056.1_1 Reverse -263 -282 0.294447 0.156
NP_441612.1_2 Reverse -263 -273 8.54929 0.21
NP_441612.1_2 Forward -272 -262 8.54929 0.21
NP_443058.1_1 Reverse -239 -258 11.2084 0.291
NP_442361.1_3 Forward -278 -265 15.9489 0.0811
NP_442427.1_8 Forward -281 -262 10.2259 0.166
NP_442808.1_1 Reverse -262 -272 8.63269 0.0481
NP_442808.1_1 Forward -273 -263 8.63269 0.0481
NP_442808.1_1 Reverse -227 -237 1.25791 0.289
NP_442775.1_6 Reverse -258 -277 10.0292 0.283
NP_442050.1_5 Reverse -261 -271 16.4991 0.00812
NP_442050.1_5 Forward -274 -264 16.4991 0.00812
NP_442050.1_5 Reverse -347 -357 11.9759 0.0742
NP_441114.1_3 Reverse -248 -257 7.27622 0.247
NP_440558.1_2 Reverse -334 -353 -3.24547 0.234
NP_440558.1_2 Reverse -254 -273 -7.27704 0.291
NP_440558.1_2 Forward -109 -90 -7.4737 0.294
NP_440558.1_2 Reverse -243 -262 -7.57203 0.296
NP_440111.2_2 Reverse -252 -271 1.0811 0.201
NP_441878.1_6 Forward -273 -263 10.4031 0.0176
NP_441878.1_6 Reverse -262 -272 10.4031 0.0176
NP_441878.1_6 Forward -116 -106 -7.29646 0.217
NP_441036.1_8 Forward -273 -263 8.33817 0.174
NP_441036.1_8 Reverse -262 -272 8.33817 0.174
NP_442650.1_2 Forward -272 -258 4.62115 0.165
NP_442503.1_9 Reverse -269 -288 4.71934 0.29
NP_441557.1_5 Forward -272 -263 19.9609 0.000699
NP_441557.1_5 Reverse -263 -272 19.9609 0.000699
NP_441557.1_8 Forward -366 -356 12.0743 0.236
NP_441557.1_8 Reverse -385 -395 10.8943 0.273
NP_441445.1_1 Reverse -254 -273 8.94757 0.112
NP_441445.1_1 Reverse -97 -116 2.3594 0.235
NP_441445.1_1 Forward -281 -262 1.96607 0.245
NP_440101.1_5 Forward -298 -279 8.45592 0.183
NP_441458.1_10 Forward -281 -262 1.67108 0.285
NP_442830.1_5 Reverse -245 -259 2.35894 0.271
NP_442183.1_1 Reverse -263 -277 9.14437 0.101
NP_442183.1_1 Forward -272 -258 7.07942 0.149
NP_442183.1_1 Reverse -282 -296 5.80112 0.203
NP_442397.1_9 Reverse -263 -282 1.37609 0.283
NP_441574.1_1 Reverse -257 -276 -6.29373 0.276
NP_441549.1_9 Reverse -328 -346 4.9357 0.0925
NP_441549.1_9 Reverse -259 -277 -5.78238 0.198
NP_442347.1_2 Forward -271 -262 12.4878 0.056
NP_442347.1_2 Reverse -264 -273 12.4878 0.056
NP_442347.1_2 Forward -290 -281 8.25953 0.102
NP_442347.1_2 Reverse -127 -136 4.42462 0.284
NP_442347.1_2 Reverse -55 -64 3.7363 0.284
NP_442645.1_2 Forward -274 -255 -20.2567 0.288
NP_442594.1_8 Reverse -88 -107 3.93269 0.274
NP_442508.1_8 Forward -360 -343 11.1502 0.256
NP_441633.1_3 Reverse -101 -114 -5.38892 0.236
NP_441633.1_3 Forward -274 -261 -6.07724 0.236
NP_441633.1_3 Reverse -261 -274 -6.07724 0.236
NP_440136.1_2 Forward -271 -264 15.9687 0.0123
NP_440136.1_2 Reverse -264 -271 15.9687 0.0123
NP_440136.1_2 Forward -357 -350 3.97235 0.288
NP_442590.1_10 Reverse -263 -282 15.3391 0.113
NP_442590.1_10 Reverse -257 -276 13.4708 0.135
NP_442590.1_10 Forward -278 -259 5.50599 0.258
NP_442998.1_10 Forward -270 -263 15.5754 0.0102
NP_442998.1_10 Reverse -265 -272 15.5754 0.0102
NP_440299.1_1 Reverse -259 -272 19.9798 0.00161
NP_440299.1_1 Forward -276 -263 14.08 0.0259
NP_440299.1_1 Forward -270 -257 5.72191 0.166
NP_441799.1_1 Reverse -278 -292 13.5686 0.0311
NP_441799.1_1 Reverse -259 -273 7.17714 0.149
NP_441799.1_1 Reverse -43 -57 5.30886 0.214
NP_441799.1_1 Forward -276 -262 3.44058 0.298
NP_441007.1_10 Forward -277 -264 0.707601 0.219
NP_442333.2_1 Reverse -244 -263 -0.197208 0.113
NP_442333.2_5 Forward -283 -264 -4.91709 0.214
NP_440256.1_1 Reverse -260 -279 10.4225 0.0184
NP_440256.1_1 Forward -275 -256 9.43923 0.0204
NP_440256.1_1 Reverse -266 -285 -0.295539 0.0918
NP_441559.1_8 Reverse -258 -272 2.75286 0.143
NP_441559.1_8 Reverse -242 -256 -4.81863 0.238
NP_441559.1_8 Forward -261 -247 -7.76856 0.299
NP_440915.1_6 Forward -276 -262 4.52282 0.0953
NP_441179.1_9 Reverse -226 -236 15.8108 0.246
NP_441704.1_8 Reverse -252 -271 25.8596 0.0012
NP_441704.1_8 Forward -283 -264 6.58682 0.258
NP_442866.1_1 Forward -363 -344 3.93269 0.151
NP_440748.1_1 Reverse -115 -134 11.7992 0.285
NP_442993.1_1 Reverse -282 -298 -7.90627 0.148
NP_442386.1_9 Reverse -262 -271 13.8639 0.0289
NP_442386.1_9 Forward -273 -264 13.8639 0.0289
NP_442386.1_9 Reverse -53 -62 10.8157 0.116
NP_442386.1_9 Forward -279 -270 7.07914 0.219
NP_442386.1_9 Forward -359 -350 6.39082 0.219
NP_442386.1_9 Reverse -256 -265 4.91586 0.276
NP_442386.1_9 Forward -267 -258 4.62087 0.294
NP_442054.1_2 Reverse -120 -139 5.89931 0.0514
NP_441340.1_5 Forward -271 -264 15.6737 0.0124
NP_441340.1_5 Reverse -264 -271 15.6737 0.0124
NP_441340.1_5 Forward -265 -258 4.07068 0.239
NP_441340.1_5 Forward -62 -55 3.97235 0.274
NP_441340.1_9 Forward -11 -1 7.29115 0.289
NP_442484.1_2 Forward -283 -264 15.8307 0.0365
NP_440168.1_9 Reverse -246 -265 -3.93378 0.296
NP_440586.1_8 Forward -271 -264 13.2151 0.026
NP_440586.1_8 Reverse -264 -271 13.2151 0.026
NP_440586.1_8 Forward -265 -258 12.8218 0.0395
NP_440586.1_8 Forward -93 -86 9.18354 0.171
NP_440586.1_8 Reverse -254 -261 9.08521 0.178
NP_440586.1_8 Reverse -55 -62 5.8403 0.283
NP_442251.1_6 Forward -271 -264 15.2804 0.0124
NP_442251.1_6 Reverse -264 -271 15.2804 0.0124
NP_442251.1_6 Reverse -283 -290 11.4455 0.0901
NP_440684.1_9 Reverse -276 -290 13.2743 0.168
NP_441262.1_3 Reverse -263 -270 14.7888 0.0223
NP_441262.1_3 Forward -272 -265 14.7888 0.0223
NP_441262.1_3 Forward -63 -56 5.34899 0.181
NP_440027.1_3 Reverse -247 -265 8.96649 0.187
NP_440027.1_3 Reverse -44 -62 7.98318 0.2
NP_440027.1_3 Forward -206 -188 4.34495 0.262
NP_440027.1_3 Forward -272 -254 2.18168 0.292
NP_443051.1_1 Reverse -262 -271 10.4228 0.00754
NP_443051.1_1 Forward -273 -264 10.4228 0.00754
NP_439937.1_8 Forward -396 -377 -3.93378 0.276
NP_439937.1_9 Forward -117 -100 -11.4665 0.256
NP_439937.1_9 Forward -273 -256 -16.1864 0.287
NP_440408.1_3 Forward -278 -259 -3.04881 0.257
NP_440439.1_1 Reverse -260 -273 2.37923 0.135
NP_440372.1_2 Forward -271 -264 16.3621 0.0124
NP_440372.1_2 Reverse -264 -271 16.3621 0.0124
NP_440372.1_2 Forward -62 -55 4.26735 0.221
NP_440372.1_2 Forward -357 -350 4.07068 0.262
NP_440574.1_3 Reverse -258 -277 2.0644 0.173
NP_442285.1_1 Reverse -277 -296 3.04771 0.287
NP_441803.1_2 Forward -277 -258 3.6377 0.191
NP_441803.1_2 Reverse -258 -277 -0.983855 0.293
NP_439977.1_5 Forward -278 -259 0.392778 0.21
NP_439977.1_5 Reverse -257 -276 -1.18052 0.244
NP_441572.1_7 Forward -278 -259 -3.3438 0.209
NP_442384.1_10 Forward -272 -259 18.9972 0.00338
NP_442384.1_10 Reverse -263 -276 10.049 0.047
NP_442035.1_7 Reverse -268 -287 15.5947 0.285
NP_440364.1_6 Reverse -269 -282 13.2934 0.282
NP_441877.1_7 Reverse -252 -271 -0.29631 0.283
NP_441018.1_7 Reverse -259 -278 9.14423 0.233
NP_442262.1_10 Forward -271 -264 14.1988 0.0123
NP_442262.1_10 Reverse -264 -271 14.1988 0.0123
NP_442262.1_10 Forward -265 -258 10.3639 0.153
NP_442262.1_10 Reverse -254 -261 9.38056 0.202
NP_441689.1_5 Forward -274 -264 15.3192 0.0403
NP_441689.1_5 Reverse -261 -271 15.3192 0.0403
NP_441689.1_5 Reverse -347 -357 5.97777 0.197
NP_442244.1_6 Reverse -191 -210 0.884433 0.291
NP_440163.1_10 Forward -275 -265 11.3864 0.169
NP_440344.1_10 Forward -279 -262 2.49712 0.0282
NP_440344.1_10 Reverse -256 -273 1.31714 0.0311
NP_440344.1_10 Reverse -342 -359 -11.5642 0.219
NP_440531.1_6 Reverse -255 -274 5.80098 0.112
NP_440531.1_6 Forward -280 -261 -3.83545 0.272
NP_441965.1_10 Forward -269 -253 11.5633 0.107
NP_441965.1_10 Forward -275 -259 4.28677 0.247
NP_440297.1_9 Forward -271 -261 9.32148 0.0917
NP_440297.1_9 Reverse -264 -274 9.32148 0.0917
NP_440894.1_7 Forward -77 -58 10.0284 0.244
NP_440894.1_10 Reverse -258 -277 8.25926 0.179
NP_440999.1_9 Forward -276 -262 4.32615 0.116
NP_440999.1_9 Reverse -259 -273 2.35953 0.151
NP_440999.1_9 Forward -295 -281 1.57289 0.162
NP_440888.1_2 Reverse -263 -277 20.7467 0.000502
NP_440888.1_2 Forward -272 -258 18.7801 0.00187
NP_440600.1_4 Reverse -255 -273 -0.7675 0.155
NP_440491.1_1 Reverse -260 -279 11.9848 0.158
NP_442948.1_2 Forward -359 -340 6.88262 0.229
NP_442033.1_10 Forward -274 -255 -3.83545 0.171
NP_442033.1_10 Forward -311 -292 -13.0786 0.281
NP_442818.1_3 Reverse -360 -377 -5.27103 0.27
NP_441543.1_2 Forward -271 -262 16.9127 0.00359
NP_441543.1_2 Reverse -264 -273 16.9127 0.00359
NP_441543.1_2 Forward -265 -256 11.3078 0.0567
NP_442845.1_2 Reverse -263 -277 7.9644 0.195
NP_442845.1_2 Forward -272 -258 7.86607 0.195
NP_442845.1_2 Forward -278 -264 6.3911 0.21
NP_442845.1_2 Reverse -257 -271 5.89945 0.22
NP_441469.1_8 Forward -273 -264 6.48957 0.227
NP_441469.1_8 Reverse -262 -271 6.48957 0.227
NP_443064.1_6 Forward -272 -262 12.5669 0.0796
NP_443064.1_6 Reverse -263 -273 12.5669 0.0796
NP_442578.1_7 Forward -271 -264 14.5921 0.026
NP_442578.1_7 Reverse -264 -271 14.5921 0.026
NP_440710.1_1 Forward -210 -192 -8.83064 0.282
NP_441462.1_2 Forward -272 -262 11.5831 0.00406
NP_441462.1_2 Reverse -263 -273 11.5831 0.00406
NP_443062.1_1 Forward -262 -244 9.71601 0.129
NP_443062.1_1 Forward -266 -248 5.81572 0.218
NP_443062.1_6 Forward -280 -261 2.3594 0.256
NP_443062.1_6 Reverse -255 -274 1.27776 0.276
NP_442204.1_1 Reverse -259 -270 7.92515 0.108
NP_442204.1_1 Forward -276 -265 0.353664 0.281
NP_442487.1_5 Reverse -246 -265 5.50519 0.224
NP_442487.1_5 Forward -273 -254 3.34192 0.288
NP_440516.1_8 Forward -272 -263 16.9127 0.00442
NP_440516.1_8 Reverse -263 -272 16.9127 0.00442
NP_440516.1_8 Forward -358 -349 -0.590259 0.283
NP_442428.1_5 Forward -271 -264 15.8704 0.0124
NP_442428.1_5 Reverse -264 -271 15.8704 0.0124
NP_442428.1_5 Reverse -258 -265 4.36568 0.271
NP_440673.1_2 Reverse -253 -272 7.65814 0.296
NP_440673.1_3 Forward -270 -263 12.4288 0.0426
NP_440673.1_3 Reverse -265 -272 12.4288 0.0426
NP_440673.1_7 Forward -283 -264 3.6377 0.198
NP_441052.1_2 Forward -272 -262 19.9412 0.00106
NP_441052.1_2 Reverse -263 -273 19.9412 0.00106
NP_441052.1_2 Forward -115 -105 4.79825 0.145
NP_441052.1_2 Forward -291 -281 -0.216628 0.269
NP_442219.1_8 Reverse -259 -278 13.6752 0.152
NP_442219.1_9 Forward -271 -262 17.7976 0.00718
NP_442219.1_9 Reverse -264 -273 17.7976 0.00718
NP_442219.1_9 Forward -290 -281 4.91628 0.193
NP_440436.1_4 Forward -271 -262 17.2072 0.00233
NP_440436.1_4 Reverse -264 -273 17.2072 0.00233
NP_440436.1_4 Forward -89 -80 6.19416 0.167
NP_440436.1_4 Forward -265 -256 4.42421 0.265
NP_441884.1_9 Forward -275 -256 -12.5869 0.138
NP_441884.1_9 Reverse -260 -279 -22.715 0.284
NP_440577.1_8 Reverse -243 -262 16.1249 0.257
NP_441719.1_4 Forward -271 -264 16.3621 0.0124
NP_441719.1_4 Reverse -264 -271 16.3621 0.0124
NP_442813.1_4 Forward -71 -52 -2.95047 0.287
NP_442873.1_9 Forward -282 -263 11.405 0.198
NP_442206.1_10 Reverse -349 -364 7.84638 0.178
NP_442206.1_10 Forward -358 -343 1.15987 0.236
NP_442206.1_10 Reverse -91 -106 0.176559 0.269
NP_443054.1_2 Reverse -261 -275 3.04785 0.24
NP_441851.1_10 Forward -273 -263 15.8113 0.00552
NP_441851.1_10 Reverse -262 -272 15.8113 0.00552
NP_442208.1_5 Reverse -107 -126 -7.86702 0.275
NP_442001.1_4 Forward -287 -268 7.17681 0.29
NP_442622.1_8 Forward -272 -254 -18.4671 0.222
NP_440611.1_6 Reverse -165 -184 5.01433 0.29
NP_442856.1_7 Forward -300 -281 -2.65548 0.236
NP_442515.1_1 Forward -273 -259 8.84938 0.0698
NP_442515.1_1 Reverse -262 -276 1.76955 0.149
NP_441396.1_5 Reverse -327 -336 8.35786 0.224
NP_440593.1_3 Forward -277 -258 0.196116 0.196
NP_440940.1_7 Forward -122 -104 3.36165 0.274
NP_441349.1_10 Reverse -253 -272 0.58944 0.0878
NP_441409.1_5 Reverse -123 -142 14.0599 0.218
NP_441409.1_6 Reverse -257 -276 6.4893 0.0292
NP_440432.1_2 Forward -278 -259 -2.0655 0.249
NP_440432.1_9 Reverse -264 -279 -2.77337 0.175
NP_442843.1_1 Reverse -359 -378 -9.24366 0.264
NP_440474.1_8 Reverse -283 -297 7.47213 0.204
NP_441124.1_5 Reverse -35 -45 12.7217 0.215
NP_442450.1_5 Reverse -261 -271 9.32148 0.115
NP_442450.1_5 Forward -274 -264 9.32148 0.115
NP_440588.1_2 Reverse -340 -359 1.27776 0.138
NP_440588.1_2 Reverse -273 -292 -4.03212 0.203
NP_440195.1_4 Forward -284 -265 17.404 0.0465
NP_442006.1_2 Reverse -114 -131 -15.0058 0.214
NP_442243.1_1 Reverse -257 -275 0.411736 0.231
NP_441570.1_1 Forward -272 -254 22.4386 0.00108
NP_441570.1_1 Reverse -263 -281 9.65558 0.0103
NP_441570.1_1 Reverse -358 -376 -10.6006 0.174
NP_440078.1_10 Forward -272 -253 2.45773 0.269
NP_441078.1_4 Forward -272 -263 19.6659 0.0007
NP_441078.1_4 Reverse -263 -272 19.6659 0.0007
NP_442729.1_8 Forward -276 -263 8.47575 0.125
NP_442729.1_8 Reverse -259 -272 8.47575 0.125
NP_442348.1_2 Forward -256 -247 10.6195 0.259
NP_440526.1_3 Reverse -264 -275 10.1862 0.0646
NP_440526.1_3 Forward -271 -260 0.844851 0.267
NP_441432.1_8 Reverse -262 -271 16.8143 0.00595
NP_441432.1_8 Forward -273 -264 16.8143 0.00595
NP_441432.1_8 Reverse -281 -290 4.0313 0.24
NP_442320.1_8 Forward -278 -264 12.291 0.0175
NP_442320.1_8 Reverse -257 -271 -3.44199 0.122
NP_442320.1_8 Forward -284 -270 -6.58858 0.296
NP_442344.1_7 Reverse -283 -302 -7.27704 0.18
NP_441732.1_2 Forward -276 -260 2.91013 0.0145
NP_441732.1_2 Reverse -259 -275 1.82849 0.026
NP_442003.1_4 Forward -271 -252 9.93088 0.296
NP_440760.1_1 Forward -272 -253 -14.0619 0.122
NP_442797.1_7 Reverse -256 -274 5.42735 0.216
NP_442797.1_7 Forward -279 -261 2.96908 0.236
NP_442274.1_6 Forward -147 -128 16.1257 0.167
NP_440199.1_10 Forward -275 -265 16.7946 0.0381
NP_440199.1_10 Reverse -260 -270 15.5163 0.0861
NP_440199.1_10 Forward -269 -259 7.25653 0.231
NP_441945.1_6 Forward -66 -47 12.9791 0.173
NP_442353.1_4 Forward -278 -259 3.34192 0.219
NP_440913.1_1 Reverse -261 -279 10.6389 0.175
NP_442968.1_8 Reverse -182 -201 13.1758 0.211
NP_440713.1_4 Reverse -253 -272 24.1889 0.00353
NP_440713.1_4 Forward -266 -247 7.7676 0.174
NP_440713.1_4 Reverse -187 -206 5.40766 0.21
NP_442489.1_2 Reverse -258 -277 2.55606 0.261
NP_442489.1_7 Forward -272 -263 20.1576 0.000695
NP_442489.1_7 Reverse -263 -272 20.1576 0.000695
NP_442079.1_7 Forward -271 -252 3.14605 0.212
NP_440559.1_1 Forward -271 -262 17.4043 0.00658
NP_440559.1_1 Reverse -264 -273 17.4043 0.00658
NP_441659.2_8 Forward -272 -262 18.1713 0.00133
NP_441659.2_8 Reverse -263 -273 18.1713 0.00133
NP_441659.2_8 Reverse -54 -64 0.0783647 0.277
NP_442913.1_10 Forward -281 -262 -5.40875 0.264
NP_442913.1_10 Reverse -254 -273 -5.50708 0.268
NP_441968.1_1 Forward -12 -4 15.162 0.257
NP_439956.1_7 Forward -363 -344 8.45592 0.257
NP_441800.1_10 Forward -256 -237 1.57275 0.255
NP_442346.1_5 Forward -273 -263 16.6963 0.00248
NP_442346.1_5 Reverse -262 -272 16.6963 0.00248
NP_440545.1_3 Forward -276 -259 -2.51776 0.187
NP_440545.1_3 Reverse -259 -276 -2.61609 0.189
NP_441786.1_10 Reverse -254 -273 6.98095 0.268
NP_440555.1_4 Forward -328 -309 7.7676 0.214
NP_440743.1_6 Reverse -379 -397 20.5703 0.0137
NP_440486.1_5 Forward -393 -374 7.7676 0.255
NP_440459.1_2 Forward -264 -247 13.8052 0.124
NP_440459.1_2 Forward -281 -264 9.87194 0.215
NP_440459.1_2 Reverse -261 -278 9.38028 0.229
NP_440459.1_2 Forward -287 -270 8.59364 0.254
NP_440010.1_4 Reverse -253 -272 4.03023 0.22
NP_442551.1_4 Forward -118 -103 -1.88839 0.25
NP_440847.1_8 Reverse -108 -127 12.5858 0.277
NP_442603.1_7 Forward -272 -258 21.5334 0.00436
NP_442603.1_7 Reverse -263 -277 13.6669 0.0819
NP_439970.1_4 Reverse -267 -286 -4.81876 0.293
NP_441047.1_2 Forward -271 -252 3.14605 0.231
NP_440170.1_2 Reverse -251 -270 4.62101 0.296
NP_441833.1_4 Forward -271 -264 15.9687 0.0124
NP_441833.1_4 Reverse -264 -271 15.9687 0.0124
NP_442498.1_5 Reverse -310 -329 10.9142 0.284
NP_442498.1_5 Forward -335 -316 8.75091 0.284
NP_442699.1_8 Forward -384 -365 -12.5869 0.255
NP_442162.1_9 Forward -271 -264 16.2637 0.0124
NP_442162.1_9 Reverse -264 -271 16.2637 0.0124
NP_442162.1_9 Reverse -55 -62 3.4807 0.246
NP_442162.1_9 Forward -62 -55 3.38237 0.276
NP_440788.1_5 Forward -132 -113 16.0274 0.0299
NP_440671.1_4 Forward -278 -264 16.4209 0.0288
NP_440671.1_4 Reverse -257 -271 8.94771 0.188
NP_440671.1_6 Reverse -245 -264 12.7816 0.226
NP_440224.1_1 Forward -283 -264 1.17943 0.132
NP_442140.1_3 Reverse -350 -360 6.07655 0.184
NP_442140.1_3 Forward -271 -261 4.40493 0.243
NP_442140.1_3 Reverse -264 -274 4.40493 0.243
NP_441671.1_10 Reverse -74 -93 0.982764 0.277
NP_441813.1_5 Reverse -261 -271 15.9097 0.01
NP_441813.1_5 Forward -274 -264 15.9097 0.01
NP_441813.1_5 Reverse -347 -357 2.92996 0.181
NP_441813.1_5 Reverse -255 -265 -0.708283 0.272
NP_440590.1_4 Forward -271 -258 14.6706 0.0106
NP_440590.1_4 Reverse -264 -277 12.409 0.0141
NP_440567.1_1 Reverse -264 -278 5.30946 0.104
NP_440567.1_1 Reverse -258 -272 2.75286 0.164
NP_442497.1_10 Forward -271 -262 10.4228 0.0087
NP_442497.1_10 Reverse -264 -273 10.4228 0.0087
NP_440821.1_4 Reverse -261 -271 18.2696 0.00448
NP_440821.1_4 Forward -274 -264 18.2696 0.00448
NP_441239.1_9 Reverse -261 -273 4.36554 0.253
NP_441239.1_9 Forward -274 -262 4.36554 0.253
NP_441951.1_4 Reverse -263 -282 5.11266 0.273
NP_441892.1_1 Reverse -254 -271 10.4619 0.0642
NP_441892.1_1 Forward -281 -264 4.3654 0.111
NP_441892.1_1 Forward -275 -258 0.137172 0.173
NP_442193.1_8 Reverse -260 -279 14.7483 0.211
NP_440740.1_7 Forward -145 -127 28.4368 0.00155
NP_442270.1_6 Reverse -357 -375 15.5554 0.279
NP_442270.1_9 Reverse -271 -290 -4.6221 0.201
NP_442270.1_9 Forward -283 -264 -6.1954 0.207
NP_441017.1_6 Forward -276 -262 18.0918 0.0376
NP_441017.1_6 Reverse -259 -273 16.4202 0.0651
NP_441017.1_6 Forward -282 -268 13.372 0.195
NP_441017.1_6 Reverse -249 -263 11.012 0.285
NP_441874.1_1 Forward -66 -52 11.3077 0.249
NP_440833.1_6 Forward -376 -362 15.9285 0.134
NP_442216.1_2 Reverse -156 -175 9.83255 0.0108
NP_440354.1_7 Reverse -263 -281 9.65558 0.224
NP_440546.1_4 Forward -272 -262 10.046 0.109
NP_440546.1_4 Reverse -263 -273 10.046 0.109
NP_440546.1_4 Forward -358 -348 9.65817 0.126
NP_440462.1_4 Forward -359 -345 12.0943 0.205
NP_440462.1_6 Reverse -261 -271 7.74818 0.0699
NP_440462.1_6 Forward -274 -264 7.74818 0.0699
NP_440462.1_6 Reverse -347 -357 3.12662 0.26
NP_440868.1_4 Reverse -259 -271 8.6921 0.0582
NP_440868.1_4 Forward -362 -350 6.72548 0.0859
NP_440868.1_4 Reverse -253 -265 0.333971 0.217
NP_440868.1_4 Forward -276 -264 -0.846001 0.282
NP_441497.1_2 Forward -366 -347 8.16093 0.233
NP_442787.1_7 Reverse -118 -137 14.7156 0.292
NP_440696.1_3 Forward -272 -254 0.314141 0.233
NP_440696.1_3 Reverse -253 -271 -2.63579 0.278
NP_442039.1_4 Forward -271 -264 15.1821 0.0124
NP_442039.1_4 Reverse -264 -271 15.1821 0.0124
NP_442039.1_7 Forward -253 -243 12.4681 0.231
NP_441811.1_8 Reverse -257 -271 13.8643 0.175
NP_440825.1_7 Reverse -55 -65 11.7385 0.214
NP_442837.1_3 Forward -271 -264 15.7721 0.0124
NP_442837.1_3 Reverse -264 -271 15.7721 0.0124
NP_442053.1_1 Forward -272 -263 18.3876 0.0007
NP_442053.1_1 Reverse -263 -272 18.3876 0.0007
NP_442053.1_1 Reverse -349 -358 3.93297 0.278
NP_440505.1_3 Reverse -261 -271 16.303 0.00696
NP_440505.1_3 Forward -274 -264 16.303 0.00696
NP_440505.1_3 Forward -258 -248 9.22315 0.122
NP_441102.1_1 Reverse -264 -283 12.5858 0.108
NP_441203.1_1 Reverse -264 -283 -20.3551 0.297
NP_440914.1_1 Forward -272 -262 17.5935 0.000537
NP_440914.1_1 Reverse -263 -273 17.5935 0.000537
NP_440914.1_1 Forward -278 -268 9.98138 0.164
NP_440914.1_1 Reverse -54 -64 9.00547 0.186
NP_441011.1_8 Forward -271 -262 8.25953 0.144
NP_441011.1_8 Reverse -264 -273 8.25953 0.144
NP_441011.1_8 Forward -62 -53 5.11294 0.283
NP_442533.1_1 Reverse -260 -279 -15.7335 0.257
NP_442533.1_6 Forward -272 -263 17.2076 0.00137
NP_442533.1_6 Reverse -263 -272 17.2076 0.00137
NP_441482.1_7 Reverse -257 -271 0.786239 0.0554
NP_441482.1_7 Forward -278 -264 0.786239 0.0554
NP_441482.1_7 Reverse -343 -357 -5.50694 0.184
NP_439944.1_9 Forward -271 -261 19.0562 0.00329
NP_439944.1_9 Reverse -264 -274 19.0562 0.00329
NP_440116.1_5 Forward -361 -344 5.74204 0.176
NP_440116.1_5 Reverse -88 -105 2.98877 0.249
NP_440116.1_8 Reverse -264 -283 9.63589 0.0329
NP_440115.1_6 Reverse -260 -270 8.4365 0.13
NP_440115.1_6 Reverse -78 -88 5.87989 0.214
NP_440007.1_9 Forward -276 -262 10.3243 0.163
NP_440007.1_9 Reverse -259 -273 1.57289 0.285
NP_440007.1_9 Reverse -345 -359 0.786239 0.29
NP_441602.1_3 Reverse -264 -283 -3.83545 0.253
NP_441972.1_5 Reverse -264 -283 -0.197208 0.163
NP_441106.1_1 Forward -273 -264 9.63616 0.0311
NP_441106.1_1 Reverse -262 -271 9.63616 0.0311
NP_441106.1_1 Reverse -256 -265 4.52295 0.219
NP_440429.1_2 Reverse -258 -277 13.3725 0.177
NP_439903.1_6 Forward -275 -256 5.60352 0.178
NP_439903.1_7 Forward -145 -126 3.6377 0.281
NP_440797.1_2 Reverse -252 -271 12.9594 0.241
NP_441286.1_1 Forward -273 -261 21.3768 0.00196
NP_441286.1_1 Reverse -262 -274 21.3768 0.00196
NP_441286.1_1 Reverse -105 -117 -5.86088 0.229
NP_442674.1_3 Forward -280 -261 10.3234 0.174
NP_442674.1_3 Reverse -255 -274 3.73524 0.294
NP_442674.1_3 Reverse -268 -287 2.6536 0.3
NP_440670.1_8 Forward -272 -263 18.3876 0.000699
NP_440670.1_8 Reverse -263 -272 18.3876 0.000699
NP_442463.1_3 Reverse -191 -210 10.5209 0.275
NP_441930.1_2 Forward -256 -246 11.2881 0.298
NP_440886.1_7 Forward -273 -263 7.94438 0.0805
NP_440886.1_7 Reverse -262 -272 7.94438 0.0805
NP_442614.1_2 Forward -272 -258 7.27608 0.275
NP_442614.1_2 Reverse -263 -277 5.89945 0.296
NP_442382.1_7 Forward -285 -266 13.7658 0.111
NP_442382.1_7 Forward -107 -88 8.16093 0.229
NP_440767.1_8 Reverse -307 -326 11.0125 0.268
NP_442072.1_9 Reverse -262 -280 -4.20908 0.0413
NP_442264.1_2 Reverse -259 -276 11.5436 0.181
NP_442264.1_2 Forward -276 -259 9.87194 0.193
NP_441021.1_1 Reverse -264 -283 -12.0953 0.279
NP_441021.1_4 Reverse -376 -395 11.5042 0.241
NP_441463.1_3 Forward -301 -282 8.25926 0.0487
NP_441463.1_3 Reverse -259 -278 -6.09707 0.239
NP_441463.1_3 Reverse -253 -272 -10.3253 0.293
NP_441463.1_6 Forward -274 -260 14.6298 0.165
NP_441463.1_6 Reverse -261 -275 7.96207 0.25
NP_441626.1_2 Forward -271 -264 15.7721 0.0124
NP_441626.1_2 Reverse -264 -271 15.7721 0.0124
NP_442211.1_3 Reverse -85 -104 9.80632 0.257
NP_442365.1_7 Reverse -259 -278 -1.96717 0.198
NP_442365.1_7 Forward -276 -257 -2.36049 0.2
NP_440107.1_5 Forward -273 -254 0.392778 0.178
NP_440107.1_5 Reverse -262 -281 0.294447 0.178
NP_440107.1_5 Reverse -378 -397 -0.000545616 0.178
NP_442794.1_1 Forward -276 -264 10.1671 0.0721
NP_442794.1_1 Reverse -259 -271 10.1671 0.0721
NP_441962.1_4 Reverse -258 -277 -11.7019 0.244
NP_441962.1_4 Forward -308 -289 -14.5535 0.29
NP_441962.1_9 Forward -151 -132 5.40766 0.271
NP_440387.1_1 Forward -272 -256 4.0901 0.0471
NP_440387.1_1 Reverse -103 -119 0.353528 0.127
NP_440387.1_1 Reverse -263 -279 -3.97304 0.171
NP_441431.1_2 Reverse -51 -65 8.45543 0.216
NP_441993.1_1 Reverse -263 -282 3.506 0.233
NP_441993.1_1 Forward -272 -253 1.26449 0.282
NP_442323.1_7 Reverse -258 -277 4.71854 0.215
NP_442323.1_7 Forward -277 -258 4.62021 0.215
NP_441510.2_7 Forward -278 -264 11.2087 0.28
NP_440287.1_6 Forward -281 -262 3.83436 0.208
NP_441552.1_3 Reverse -256 -275 12.29 0.292
NP_440766.1_4 Forward -276 -262 8.25939 0.0871
NP_440766.1_4 Reverse -259 -273 7.9644 0.0871
NP_440766.1_4 Forward -270 -256 1.96621 0.205
NP_440766.1_4 Reverse -265 -279 1.67122 0.22
NP_441979.1_5 Forward -278 -259 -11.8003 0.228
NP_439910.1_2 Forward -280 -263 -13.8258 0.163
NP_439910.1_2 Forward -299 -282 -21.9873 0.202
NP_440457.1_1 Reverse -259 -271 8.88877 0.101
NP_440457.1_1 Forward -276 -264 7.02048 0.105
NP_441332.1_6 Reverse -132 -142 12.1308 0.236
NP_442509.1_9 Forward -272 -262 8.14104 0.192
NP_442509.1_9 Reverse -263 -273 8.14104 0.192
NP_442509.1_9 Reverse -349 -359 7.55106 0.214
NP_440554.1_4 Forward -271 -261 7.05986 0.106
NP_440554.1_4 Reverse -264 -274 7.05986 0.106
NP_440554.1_4 Forward -265 -255 5.87989 0.129
NP_440554.1_4 Reverse -283 -293 2.92996 0.248
NP_440554.1_4 Reverse -254 -264 2.92996 0.248
NP_442862.1_3 Forward -55 -38 4.46374 0.29
NP_442737.1_5 Reverse -262 -281 15.4968 0.166
NP_441885.1_5 Forward -272 -262 20.9245 0.000538
NP_441885.1_5 Reverse -263 -273 20.9245 0.000538
NP_441885.1_5 Forward -206 -196 -1.59326 0.273
NP_442341.1_7 Reverse -262 -276 18.0925 0.0111
NP_442341.1_7 Forward -273 -259 17.6992 0.0111
NP_442341.1_9 Forward -360 -346 12.782 0.0982
NP_442341.1_9 Reverse -261 -275 7.07881 0.204
NP_442341.1_9 Forward -274 -260 5.80051 0.255
NP_441173.1_9 Reverse -161 -169 12.9004 0.206
NP_442395.2_4 Forward -359 -340 3.44025 0.202
NP_443000.1_7 Forward -274 -264 17.0896 0.00865
NP_443000.1_7 Reverse -261 -271 17.0896 0.00865
NP_440507.2_3 Reverse -254 -273 8.4551 0.253
NP_442513.1_5 Forward -280 -261 10.2251 0.266
NP_440275.1_3 Forward -274 -264 8.1415 0.0602
NP_440275.1_3 Reverse -261 -271 8.1415 0.0602
NP_440091.1_1 Forward -276 -264 8.88877 0.0567
NP_440091.1_1 Reverse -259 -271 6.43049 0.095
NP_441902.1_3 Forward -20 -10 12.9817 0.23
NP_440679.1_4 Forward -217 -198 9.93088 0.261
NP_443010.1_10 Forward -275 -258 2.77079 0.27
NP_442451.1_2 Forward -280 -261 -2.16383 0.179
NP_442451.1_2 Reverse -255 -274 -8.55534 0.251
NP_440149.1_8 Reverse -263 -282 17.8957 0.0125
NP_440149.1_8 Forward -272 -253 13.6675 0.0273
NP_441105.1_3 Forward -277 -258 -1.37718 0.148
NP_441105.1_3 Forward -283 -264 -9.63698 0.292
NP_440216.1_1 Reverse -263 -277 0.0979218 0.0284
NP_440216.1_1 Forward -272 -258 -9.34185 0.145
NP_440172.1_1 Forward -272 -262 15.0247 0.00945
NP_440172.1_1 Reverse -263 -273 15.0247 0.00945
NP_442015.1_10 Reverse -259 -272 19.2922 0.00444
NP_442015.1_10 Forward -276 -263 10.344 0.0391
NP_441226.1_7 Forward -271 -264 14.4934 0.0123
NP_441226.1_7 Reverse -264 -271 14.4934 0.0123
NP_441226.1_7 Reverse -350 -357 8.59356 0.197
NP_441226.1_7 Reverse -55 -62 8.59356 0.197
NP_441111.1_7 Forward -271 -263 18.7023 0.00294
NP_441111.1_7 Reverse -264 -272 18.7023 0.00294
NP_441766.1_2 Forward -272 -263 17.5026 0.00297
NP_441766.1_2 Reverse -263 -272 17.5026 0.00297
NP_441766.1_2 Forward -291 -282 2.55633 0.257
NP_442417.1_5 Forward -315 -301 6.19444 0.231
NP_442417.1_5 Reverse -349 -363 5.01447 0.278
NP_440416.1_9 Forward -70 -51 -9.44032 0.131
NP_440416.1_9 Forward -273 -254 -9.93197 0.135
NP_440416.1_9 Reverse -246 -265 -10.6203 0.143
NP_440416.1_9 Forward -279 -260 -16.4218 0.215
NP_443052.1_8 Forward -301 -282 -1.37718 0.0793
NP_443052.1_8 Forward -228 -209 -6.58872 0.143
NP_440591.1_9 Forward -273 -255 17.3254 0.0619
NP_442046.1_8 Reverse -264 -283 10.3242 0.293
NP_440261.1_5 Forward -271 -258 -4.50394 0.151
NP_440261.1_5 Forward -114 -101 -6.47056 0.201
NP_440261.1_5 Reverse -264 -277 -10.5021 0.201
NP_440988.1_10 Forward -274 -260 10.4172 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGCGCCGCGGTAAGGTTCGTCGGGCCAAACTTTACTATCTCCGGGATCGGGTTGGTAAAGCTACCCGCATCAAGCAGCGGTTTGACCGGGCTCTGTAGTCAGCGAAACTGTGATCTCCAACACCAATGGCGATCGCCATCGATGGGAATTGGCAGCAAATTAGGGTATGATGGTGCCAGAGTGCAGACTCCAGGGCTAACCTCAGCCCAGACTATGCGTCCTTAGTTCAGTTGGTAGAACGCAGGTCTCCAAAACCTGATGTCGGGGGTTCAAGTCCTCCAGGGCGCGTTGACCACCAATTACCTCGCCAACGATTGTTACGCAATTATTCGACTTTGCGTTCGGTGATGTTCCAGATTTTCTCATTAGTTATAACGATTTGGGAGGCAAGAAAAACCT

CDS

GTGGTTAAGAAGGAAGCGGTCAGAACCGACAGTACCGAAGACAATTCCGTGGACAATGTCCAGGCCCGGAGCAACTTCATTGCAGCCACCAAAGATGAGTTGGCAAAAGTGGTTTGGCCCTCCCGTCAACAGCTAATCAGCGAATCCGTAGCCGTGATTTTGATGGTTATCTTGGTTTCGACGGTTATCTACTTCGTTGATCAAATCTTTGGCTGGATTACCAAACAACCTTTCCTTTTCGGTTAA

Protein

MVKKEAVRTDSTEDNSVDNVQARSNFIAATKDELAKVVWPSRQQLISESVAVILMVILVSTVIYFVDQIFGWITKQPFLFG