Your browser is old and dusty. Try Google Chrome!

Details for ssl3291

ORF ssl3291
Accession NP_441051.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -346 -332 19.6658 0.0139
NP_441061.1_2 Reverse -339 -353 -0.0987402 0.221
NP_440795.1_7 Forward -346 -339 14.6904 0.0123
NP_440795.1_7 Reverse -339 -346 14.6904 0.0123
NP_441418.1_6 Forward -347 -328 -11.9969 0.0586
NP_441418.1_6 Forward -305 -286 -30.4831 0.28
NP_442291.1_5 Reverse -337 -353 -1.12144 0.192
NP_442291.1_7 Reverse -328 -342 9.63603 0.26
NP_441453.1_4 Reverse -338 -346 16.539 0.00633
NP_441453.1_4 Forward -347 -339 16.539 0.00633
NP_441623.1_1 Forward -30 -12 -3.12744 0.256
NP_442151.1_6 Reverse -338 -352 8.75105 0.164
NP_442151.1_6 Forward -347 -333 8.25939 0.178
NP_440226.1_1 Reverse -170 -189 3.53937 0.221
NP_441630.1_3 Forward -355 -336 -0.4922 0.288
NP_441342.1_2 Forward -351 -337 13.1759 0.174
NP_440150.1_2 Forward -345 -326 14.2566 0.157
NP_441519.1_7 Reverse -335 -354 22.2223 0.0367
NP_443002.1_5 Reverse -37 -55 13.9813 0.202
NP_442173.1_1 Forward -346 -338 15.4574 0.00633
NP_442173.1_1 Reverse -339 -347 15.4574 0.00633
NP_442173.1_1 Reverse -171 -179 4.93597 0.241
NP_442752.1_4 Forward -347 -340 13.8055 0.0199
NP_442752.1_4 Reverse -338 -345 13.8055 0.0199
NP_443027.1_4 Reverse -336 -346 13.943 0.0452
NP_442975.1_10 Reverse -334 -348 20.9434 0.00133
NP_440784.1_7 Forward -346 -339 15.9687 0.0123
NP_440784.1_7 Reverse -339 -346 15.9687 0.0123
NP_442909.1_7 Forward -346 -332 12.192 0.131
NP_442909.1_7 Reverse -339 -353 9.93039 0.14
NP_440061.1_9 Forward -349 -335 13.6669 0.0775
NP_440061.1_9 Forward -342 -328 8.75042 0.164
NP_440061.1_9 Reverse -279 -293 7.96378 0.185
NP_441476.1_5 Reverse -333 -352 -1.57384 0.205
NP_440878.1_9 Reverse -328 -347 -1.08219 0.224
NP_442062.1_8 Forward -347 -337 19.4496 0.000558
NP_442062.1_8 Reverse -338 -348 17.3846 0.00193
NP_441900.1_2 Reverse -274 -292 1.29671 0.25
NP_441859.1_3 Forward -348 -329 3.44025 0.241
NP_440304.1_4 Reverse -336 -346 9.91146 0.051
NP_440304.1_4 Reverse -168 -178 5.78156 0.19
NP_440304.1_4 Reverse -69 -79 5.5849 0.201
NP_440304.1_4 Forward -349 -339 1.84832 0.299
NP_442242.1_4 Forward -346 -339 14.3954 0.0124
NP_442242.1_4 Reverse -339 -346 14.3954 0.0124
NP_440044.1_8 Reverse -339 -358 7.37428 0.0842
NP_440044.1_8 Reverse -75 -94 0.491109 0.197
NP_441781.1_7 Forward -347 -328 7.27595 0.177
NP_439918.1_3 Forward -103 -84 5.01433 0.264
NP_441200.1_4 Forward -315 -296 5.60432 0.294
NP_441619.1_8 Forward -353 -339 15.3386 0.0847
NP_441208.1_9 Forward -350 -336 7.47274 0.221
NP_441208.1_9 Reverse -272 -286 5.89945 0.259
NP_441594.1_6 Reverse -329 -348 5.50599 0.209
NP_441594.1_6 Reverse -332 -351 4.81767 0.211
NP_442196.1_10 Forward -56 -37 10.7175 0.245
NP_442742.1_9 Reverse -276 -295 -13.1769 0.269
NP_442110.1_7 Forward -347 -333 9.63603 0.0715
NP_440014.1_6 Reverse -329 -348 7.07928 0.28
NP_440856.1_2 Forward -86 -67 14.0608 0.114
NP_440856.1_4 Forward -186 -167 -2.75381 0.22
NP_441083.1_5 Reverse -338 -348 20.3345 0.00053
NP_441083.1_5 Forward -347 -337 11.3864 0.0159
NP_442827.1_8 Reverse -330 -349 7.37347 0.0965
NP_441738.1_2 Forward -345 -338 15.28 0.0102
NP_441738.1_2 Reverse -340 -347 15.28 0.0102
NP_441738.1_2 Forward -177 -170 11.8385 0.0469
NP_441558.1_5 Forward -181 -162 7.47261 0.18
NP_441558.1_5 Forward -349 -330 7.37428 0.182
NP_440209.1_1 Reverse -338 -346 18.1123 0.00295
NP_440209.1_1 Forward -347 -339 18.1123 0.00295
NP_442889.1_8 Reverse -335 -349 13.372 0.0588
NP_440178.1_7 Forward -348 -329 -19.7651 0.18
NP_441792.1_2 Reverse -170 -183 15.5556 0.288
NP_441716.1_1 Forward -347 -333 4.12949 0.258
NP_442111.1_4 Forward -348 -334 19.2725 0.00439
NP_441163.1_1 Reverse -330 -347 12.1328 0.183
NP_441163.1_1 Forward -348 -331 5.24966 0.277
NP_440343.1_9 Forward -57 -38 8.45592 0.255
NP_440906.1_5 Forward -346 -339 15.8704 0.0124
NP_440906.1_5 Reverse -339 -346 15.8704 0.0124
NP_440747.1_10 Forward -350 -338 14.887 0.00223
NP_440747.1_10 Reverse -335 -347 -2.02597 0.0196
NP_440747.1_10 Forward -182 -170 -12.0557 0.199
NP_441130.1_10 Forward -349 -335 9.14437 0.128
NP_441486.1_1 Reverse -335 -349 14.1593 0.00654
NP_441486.1_1 Forward -350 -336 4.52282 0.0432
NP_441880.2_10 Forward -346 -328 11.9172 0.142
NP_442634.1_4 Reverse -168 -182 -4.03198 0.179
NP_440057.1_1 Forward -340 -321 7.7676 0.28
NP_440057.1_4 Forward -340 -321 17.115 0.124
NP_441014.1_8 Reverse -282 -301 0.982764 0.214
NP_441014.1_8 Reverse -91 -110 -6.68705 0.276
NP_441014.1_8 Forward -269 -250 -7.27704 0.276
NP_442848.1_1 Reverse -332 -346 6.3911 0.0791
NP_442848.1_1 Forward -353 -339 -0.885388 0.263
NP_442848.1_4 Reverse -251 -265 8.25939 0.282
NP_442848.1_9 Forward -353 -334 0.884433 0.265
NP_441012.1_4 Forward -345 -332 8.57408 0.272
NP_443018.1_3 Forward -346 -339 14.8871 0.0123
NP_443018.1_3 Reverse -339 -346 14.8871 0.0123
NP_441316.1_7 Reverse -336 -351 1.15987 0.176
NP_441634.1_8 Forward -349 -335 15.6342 0.0248
NP_441182.1_3 Forward -69 -51 11.9172 0.295
NP_440376.1_1 Forward -347 -338 19.4693 0.000692
NP_440376.1_1 Reverse -338 -347 19.4693 0.000692
NP_441588.1_4 Reverse -340 -350 15.9097 0.0369
NP_442687.1_7 Reverse -337 -347 15.8113 0.0125
NP_442687.1_7 Forward -348 -338 8.92815 0.0994
NP_442485.1_3 Reverse -279 -298 -3.73712 0.277
NP_440642.1_10 Reverse -220 -234 4.12889 0.26
NP_440042.1_2 Reverse -328 -347 1.37609 0.213
NP_441422.1_7 Forward -349 -332 3.57876 0.11
NP_441763.1_10 Reverse -327 -346 15.5349 0.108
NP_440887.1_4 Reverse -136 -155 15.065 0.242
NP_442658.1_1 Reverse -336 -346 18.7607 0.00222
NP_442658.1_1 Forward -349 -339 6.76441 0.214
NP_440141.1_4 Forward -100 -81 -5.31042 0.296
NP_442205.1_9 Reverse -332 -348 8.515 0.103
NP_442544.1_2 Reverse -37 -51 -1.77037 0.287
NP_441414.1_9 Reverse -338 -357 14.4541 0.0127
NP_440800.1_7 Forward -184 -170 12.3893 0.241
NP_442937.1_5 Forward -352 -333 13.4708 0.0906
NP_442937.1_5 Reverse -333 -352 11.7008 0.132
NP_441958.1_5 Forward -348 -338 12.2714 0.00183
NP_441958.1_5 Reverse -337 -347 12.2714 0.00183
NP_441958.1_5 Reverse -169 -179 -0.41329 0.205
NP_441127.1_1 Reverse -332 -346 13.0776 0.204
NP_441127.1_1 Reverse -71 -85 12.0943 0.215
NP_441127.1_1 Reverse -335 -349 7.9644 0.3
NP_442486.1_6 Reverse -373 -392 -6.78538 0.296
NP_440203.1_5 Reverse -20 -30 12.7626 0.138
NP_440203.1_5 Forward -77 -67 11.2876 0.2
NP_439905.1_1 Forward -346 -333 11.524 0.204
NP_443001.1_7 Forward -359 -340 5.30933 0.279
NP_440984.1_7 Forward -352 -338 11.0127 0.122
NP_439990.1_5 Forward -352 -339 7.6891 0.186
NP_442911.1_2 Forward -357 -338 5.211 0.0344
NP_442911.1_2 Reverse -328 -347 4.81767 0.0367
NP_440153.1_5 Forward -346 -332 12.6843 0.0645
NP_440153.1_8 Reverse -281 -294 -2.63565 0.246
NP_441099.1_5 Reverse -328 -347 -7.17871 0.171
NP_442002.1_9 Reverse -169 -176 13.0188 0.185
NP_442002.1_9 Reverse -295 -302 11.3472 0.185
NP_442002.1_9 Reverse -337 -344 10.7572 0.185
NP_440809.1_9 Reverse -82 -100 -8.73231 0.271
NP_441294.1_7 Reverse -334 -348 17.1217 0.0101
NP_441646.1_1 Reverse -331 -350 8.94757 0.14
NP_441646.1_1 Forward -354 -335 4.81767 0.189
NP_441646.1_1 Reverse -274 -293 -0.4922 0.266
NP_442438.1_10 Reverse -333 -347 20.6491 0.0124
NP_440377.1_1 Forward -179 -162 14.8491 0.185
NP_441000.1_6 Forward -348 -334 -4.13031 0.227
NP_442771.1_1 Forward -349 -331 1.78911 0.0745
NP_441674.1_6 Reverse -282 -301 2.0644 0.291
NP_440147.1_4 Forward -349 -336 19.4888 0.00276
NP_440147.1_4 Reverse -168 -181 5.32916 0.129
NP_440147.1_4 Reverse -336 -349 3.46087 0.187
NP_441175.1_7 Forward -179 -160 12.2908 0.119
NP_441550.1_8 Forward -349 -339 14.6309 0.0132
NP_441550.1_8 Reverse -336 -346 10.501 0.066
NP_441916.1_7 Forward -347 -337 18.4663 0.00144
NP_441916.1_7 Reverse -338 -348 10.3048 0.0261
NP_441916.1_10 Forward -186 -167 1.27776 0.268
NP_440206.1_4 Reverse -286 -305 3.14526 0.282
NP_440206.1_9 Reverse -289 -308 9.3409 0.272
NP_441041.1_7 Reverse -335 -347 10.2357 0.1
NP_441041.1_7 Forward -182 -170 5.86276 0.236
NP_442396.1_5 Forward -351 -338 21.1604 0.00421
NP_442396.1_5 Forward -130 -117 9.55739 0.129
NP_442004.1_6 Forward -347 -333 10.521 0.14
NP_441725.1_4 Forward -184 -170 8.94708 0.182
NP_441725.1_5 Forward -346 -336 9.02648 0.0553
NP_441725.1_5 Forward -79 -69 7.05986 0.106
NP_441725.1_5 Reverse -339 -349 2.04498 0.115
NP_439966.1_7 Reverse -336 -346 17.4824 0.00636
NP_439966.1_7 Forward -349 -339 7.25606 0.15
NP_439966.1_7 Forward -279 -269 7.0594 0.157
NP_439966.1_9 Reverse -336 -345 10.7178 0.0863
NP_442941.1_3 Reverse -339 -349 11.0914 0.0116
NP_442941.1_3 Forward -346 -336 2.53664 0.14
NP_440289.1_2 Reverse -335 -348 10.2457 0.0272
NP_442281.1_1 Forward -352 -338 8.94708 0.0747
NP_442281.1_1 Reverse -333 -347 7.86545 0.0907
NP_442281.1_1 Forward -184 -170 5.50552 0.155
NP_441334.1_7 Forward -349 -330 -21.3384 0.296
NP_442012.1_1 Forward -353 -334 11.0125 0.0769
NP_442288.1_3 Reverse -168 -185 10.6586 0.203
NP_441556.1_10 Reverse -333 -347 15.0887 0.154
NP_441556.1_10 Forward -75 -61 10.0271 0.28
NP_440498.1_1 Reverse -329 -347 0.314141 0.218
NP_441644.1_6 Reverse -338 -348 17.3841 0.00127
NP_441644.1_6 Forward -347 -337 10.1076 0.0628
NP_441644.1_6 Reverse -91 -101 4.20782 0.245
NP_440867.1_10 Forward -271 -252 0.786102 0.299
NP_442215.1_2 Reverse -336 -352 1.82849 0.127
NP_442215.1_2 Forward -82 -66 -0.236458 0.164
NP_442029.1_1 Reverse -320 -339 -15.2418 0.272
NP_442029.1_6 Reverse -242 -261 4.42435 0.268
NP_442247.1_8 Forward -349 -335 8.75105 0.266
NP_440253.1_2 Reverse -338 -356 -2.43913 0.268
NP_440929.1_8 Forward -347 -338 19.2726 0.000701
NP_440929.1_8 Reverse -338 -347 19.2726 0.000701
NP_442933.1_10 Forward -347 -338 17.601 0.00325
NP_442933.1_10 Reverse -338 -347 17.601 0.00325
NP_441751.2_8 Forward -346 -332 -2.75368 0.133
NP_441751.2_8 Reverse -339 -353 -3.147 0.134
NP_442554.1_8 Forward -346 -336 16.008 0.0065
NP_442554.1_8 Reverse -339 -349 15.3197 0.00882
NP_442554.1_8 Forward -178 -168 2.43831 0.272
NP_441762.1_7 Forward -348 -336 12.4287 0.0142
NP_441762.1_7 Reverse -337 -349 9.57708 0.0142
NP_441762.1_7 Reverse -70 -82 -6.15587 0.276
NP_442142.1_4 Reverse -335 -348 6.0169 0.175
NP_442142.1_4 Forward -350 -337 5.52525 0.188
NP_442292.1_1 Reverse -339 -348 18.486 0.00229
NP_442292.1_1 Forward -346 -337 9.63616 0.0183
NP_442292.1_5 Reverse -303 -322 2.85105 0.257
NP_440032.1_7 Forward -239 -220 10.6192 0.289
NP_442476.1_6 Reverse -339 -353 8.16106 0.105
NP_442476.1_6 Forward -346 -332 6.09611 0.13
NP_443009.1_5 Forward -348 -337 18.3477 0.00265
NP_442406.1_9 Reverse -253 -272 -0.000545616 0.291
NP_442408.2_1 Forward -347 -328 -7.4737 0.3
NP_441715.1_4 Reverse -171 -181 10.4031 0.097
NP_441715.1_4 Forward -346 -336 9.32148 0.097
NP_441715.1_4 Reverse -339 -349 7.94484 0.107
NP_440881.1_7 Forward -57 -38 15.4374 0.191
NP_440279.1_2 Forward -358 -339 6.58763 0.25
NP_440183.1_9 Reverse -324 -343 -14.3569 0.264
NP_440379.1_5 Forward -344 -325 -8.85033 0.256
NP_440464.1_10 Reverse -339 -349 13.0082 0.169
NP_441468.1_1 Forward -346 -339 15.8704 0.0124
NP_441468.1_1 Reverse -339 -346 15.8704 0.0124
NP_441020.2_6 Reverse -336 -353 12.3302 0.0975
NP_441015.1_10 Reverse -333 -352 -4.03212 0.197
NP_441673.1_1 Forward -347 -338 20.8459 0.000698
NP_441673.1_1 Reverse -338 -347 20.8459 0.000698
NP_441426.1_3 Reverse -322 -341 7.4718 0.284
NP_441826.1_2 Reverse -332 -346 12.1926 0.0298
NP_441826.1_2 Forward -86 -72 -3.04867 0.282
NP_441330.1_1 Forward -184 -165 -6.78538 0.172
NP_442868.1_6 Forward -349 -339 9.81313 0.038
NP_442868.1_6 Reverse -336 -346 8.53483 0.0555
NP_442719.1_2 Reverse -276 -294 -10.5029 0.276
NP_441251.1_7 Reverse -176 -189 12.999 0.266
NP_441612.1_2 Reverse -338 -348 8.54929 0.21
NP_442808.1_1 Reverse -337 -347 18.4657 0.00201
NP_442808.1_1 Forward -348 -338 8.63269 0.0481
NP_442718.1_2 Reverse -71 -90 -6.09707 0.295
NP_442542.1_2 Reverse -336 -349 11.9173 0.114
NP_442542.1_9 Reverse -331 -345 9.24208 0.138
NP_442050.1_5 Forward -181 -171 10.0093 0.177
NP_442050.1_5 Reverse -336 -346 8.23937 0.234
NP_442050.1_5 Forward -349 -339 7.64939 0.243
NP_440558.1_2 Forward -83 -64 -6.1954 0.272
NP_441878.1_6 Forward -348 -338 10.4031 0.0176
NP_441878.1_6 Reverse -337 -347 10.4031 0.0176
NP_441878.1_6 Reverse -331 -341 -6.90313 0.198
NP_441878.1_6 Reverse -70 -80 -7.39479 0.222
NP_441878.1_6 Reverse -169 -179 -7.68978 0.255
NP_441036.1_8 Reverse -337 -347 17.7779 0.000554
NP_441036.1_8 Forward -348 -338 8.33817 0.174
NP_442650.1_2 Forward -347 -333 5.1128 0.153
NP_441557.1_5 Forward -347 -338 19.9609 0.000699
NP_441557.1_5 Reverse -338 -347 19.9609 0.000699
NP_441557.1_5 Reverse -170 -179 -0.983583 0.272
NP_441590.1_4 Forward -277 -258 8.16011 0.249
NP_442066.2_9 Forward -351 -338 11.1307 0.154
NP_442777.1_1 Forward -278 -259 3.9319 0.3
NP_441308.1_8 Reverse -336 -346 9.22315 0.226
NP_441458.1_10 Forward -356 -337 13.9625 0.0856
NP_442469.1_2 Forward -264 -246 12.7038 0.298
NP_442183.1_1 Forward -347 -333 16.3225 0.0151
NP_442183.1_1 Reverse -338 -352 11.5043 0.0702
NP_441116.1_6 Reverse -12 -31 11.1109 0.26
NP_441574.1_1 Forward -92 -73 1.67108 0.172
NP_441574.1_1 Forward -347 -328 -3.14714 0.236
NP_441549.1_9 Forward -351 -333 -7.06068 0.206
NP_442347.1_2 Reverse -339 -348 12.4878 0.056
NP_442347.1_2 Forward -346 -337 11.1111 0.056
NP_442645.1_2 Forward -355 -336 -12.7836 0.144
NP_442645.1_2 Reverse -330 -349 -22.9117 0.299
NP_441037.1_4 Reverse -336 -346 16.2838 0.0168
NP_441037.1_4 Forward -396 -386 10.3389 0.205
NP_441037.1_4 Forward -349 -339 7.9999 0.237
NP_442594.1_7 Forward -358 -339 14.0599 0.112
NP_442317.1_6 Forward -352 -333 4.12936 0.247
NP_441633.1_3 Forward -349 -336 18.3088 0.00715
NP_441633.1_3 Reverse -43 -56 1.78924 0.109
NP_441633.1_3 Reverse -336 -349 -3.71729 0.177
NP_440136.1_2 Forward -346 -339 15.9687 0.0123
NP_440136.1_2 Reverse -339 -346 15.9687 0.0123
NP_442590.1_10 Forward -347 -328 8.55425 0.206
NP_442998.1_10 Forward -345 -338 15.5754 0.0102
NP_442998.1_10 Reverse -340 -347 15.5754 0.0102
NP_440899.1_8 Reverse -174 -193 -0.983855 0.199
NP_440299.1_1 Reverse -334 -347 17.3249 0.0065
NP_440299.1_1 Forward -351 -338 12.9984 0.0319
NP_441799.1_1 Forward -351 -337 18.3868 0.0085
NP_441799.1_1 Reverse -334 -348 6.19383 0.179
NP_441007.1_10 Forward -352 -339 8.27909 0.115
NP_441007.1_10 Reverse -333 -346 4.14919 0.182
NP_440256.1_1 Forward -29 -10 -6.1954 0.205
NP_440256.1_1 Forward -350 -331 -9.24366 0.275
NP_442007.1_8 Forward -348 -330 9.26148 0.281
NP_441559.1_8 Reverse -333 -347 2.5562 0.143
NP_441559.1_8 Forward -84 -70 -4.81863 0.238
NP_441559.1_8 Forward -31 -17 -6.19526 0.275
NP_440915.1_6 Reverse -334 -348 7.47274 0.0689
NP_440915.1_6 Reverse -381 -395 -2.36035 0.268
NP_441296.1_9 Reverse -247 -260 11.1301 0.233
NP_442866.1_1 Forward -85 -66 -6.58872 0.255
NP_440702.1_2 Reverse -302 -321 -7.27704 0.269
NP_442453.1_10 Reverse -324 -342 20.472 0.137
NP_441939.1_3 Forward -346 -327 11.3075 0.114
NP_441494.1_6 Reverse -333 -346 11.0324 0.225
NP_439985.1_2 Forward -339 -320 9.0459 0.193
NP_441417.1_2 Reverse -268 -287 5.80098 0.149
NP_442993.1_1 Forward -347 -331 0.943514 0.0609
NP_440677.1_6 Reverse -329 -348 7.7676 0.291
NP_442386.1_5 Forward -195 -176 8.06178 0.183
NP_442386.1_9 Reverse -337 -346 15.7322 0.0144
NP_442386.1_9 Forward -348 -339 13.8639 0.0289
NP_442386.1_10 Reverse -268 -281 8.9674 0.217
NP_441340.1_5 Forward -346 -339 15.6737 0.0124
NP_441340.1_5 Reverse -339 -346 15.6737 0.0124
NP_441340.1_9 Forward -195 -185 8.25522 0.256
NP_440161.1_3 Reverse -336 -355 10.9142 0.221
NP_440586.1_1 Reverse -328 -347 0.58944 0.237
NP_440586.1_1 Forward -398 -379 -0.983855 0.237
NP_440586.1_1 Forward -351 -332 -6.29373 0.299
NP_440586.1_8 Forward -346 -339 13.2151 0.026
NP_440586.1_8 Reverse -339 -346 13.2151 0.026
NP_442251.1_6 Forward -346 -339 15.2804 0.0124
NP_442251.1_6 Reverse -339 -346 15.2804 0.0124
NP_440192.1_5 Reverse -302 -321 2.85105 0.295
NP_440684.1_9 Forward -353 -339 12.6843 0.168
NP_440684.1_9 Reverse -332 -346 7.66941 0.256
NP_441262.1_3 Reverse -338 -345 14.7888 0.0223
NP_441262.1_3 Forward -347 -340 14.7888 0.0223
NP_440027.1_3 Forward -347 -329 8.17984 0.195
NP_440027.1_3 Reverse -322 -340 5.32826 0.245
NP_440027.1_3 Forward -261 -243 2.87 0.284
NP_443051.1_1 Reverse -337 -346 10.4228 0.00754
NP_443051.1_1 Forward -348 -339 10.4228 0.00754
NP_439996.1_6 Forward -300 -281 16.7565 0.132
NP_439984.1_3 Forward -354 -340 13.8636 0.216
NP_439937.1_9 Forward -348 -331 -8.22161 0.176
NP_440439.1_1 Reverse -335 -348 11.9173 0.0288
NP_440372.1_2 Forward -346 -339 16.3621 0.0124
NP_440372.1_2 Reverse -339 -346 16.3621 0.0124
NP_440316.1_10 Reverse -70 -80 6.96153 0.251
NP_440316.1_10 Reverse -331 -341 6.76487 0.253
NP_440316.1_10 Reverse -260 -270 5.38824 0.299
NP_441803.1_2 Forward -352 -333 11.3075 0.0744
NP_441803.1_2 Forward -343 -324 3.6377 0.191
NP_441803.1_2 Forward -346 -327 1.0811 0.241
NP_441572.1_7 Forward -272 -253 -1.7705 0.19
NP_440267.1_2 Reverse -89 -103 8.45543 0.162
NP_440267.1_2 Forward -184 -170 5.01387 0.285
NP_442384.1_10 Reverse -338 -351 15.8506 0.00946
NP_442384.1_10 Forward -347 -334 11.229 0.0372
NP_442384.1_10 Reverse -17 -30 0.805932 0.278
NP_442114.1_4 Forward -347 -336 12.1534 0.107
NP_441877.1_7 Forward -352 -333 5.01354 0.218
NP_441018.1_7 Forward -351 -332 11.7992 0.177
NP_442790.1_4 Reverse -329 -348 -5.50708 0.144
NP_442790.1_4 Forward -356 -337 -10.0303 0.2
NP_442262.1_10 Forward -346 -339 14.1988 0.0123
NP_442262.1_10 Reverse -339 -346 14.1988 0.0123
NP_441689.1_4 Forward -234 -215 12.7478 0.239
NP_441689.1_5 Forward -349 -339 5.78111 0.197
NP_441689.1_5 Forward -181 -171 5.19112 0.282
NP_440344.1_10 Reverse -331 -348 2.39878 0.0282
NP_440344.1_10 Forward -354 -337 -11.1709 0.205
NP_440531.1_8 Reverse -320 -339 9.24257 0.216
NP_441965.1_3 Reverse -328 -347 -0.688862 0.269
NP_441965.1_3 Reverse -271 -290 -1.57384 0.286
NP_441965.1_10 Reverse -335 -351 14.7098 0.0763
NP_440297.1_8 Reverse -330 -348 12.0155 0.241
NP_440297.1_9 Forward -79 -69 6.96153 0.161
NP_440297.1_9 Reverse -339 -349 -0.118297 0.282
NP_440297.1_9 Forward -346 -336 -0.216628 0.282
NP_442187.1_3 Reverse -303 -313 14.9263 0.129
NP_441592.1_4 Forward -347 -328 -0.983855 0.247
NP_440990.1_7 Forward -359 -340 19.5673 0.0409
NP_440999.1_9 Reverse -334 -348 21.7307 0.0083
NP_440999.1_9 Forward -84 -70 1.76955 0.158
NP_440888.1_2 Forward -347 -333 18.8785 0.00178
NP_440888.1_2 Reverse -338 -352 7.07881 0.208
NP_440600.1_4 Forward -355 -337 -0.374176 0.151
NP_440179.1_6 Forward -178 -159 4.916 0.246
NP_442225.1_10 Reverse -243 -262 8.25844 0.27
NP_441543.1_2 Forward -346 -337 18.486 0.00236
NP_441543.1_2 Reverse -339 -348 16.9127 0.00359
NP_442845.1_2 Reverse -332 -346 8.45605 0.195
NP_442845.1_2 Forward -353 -339 5.99778 0.219
NP_441304.1_10 Forward -227 -218 13.5694 0.239
NP_441319.1_5 Forward -346 -327 9.73422 0.27
NP_441469.1_8 Reverse -337 -346 16.126 0.00797
NP_441469.1_8 Forward -348 -339 6.48957 0.227
NP_441469.1_8 Reverse -70 -79 6.39124 0.227
NP_443064.1_6 Reverse -338 -348 12.5669 0.0796
NP_442578.1_7 Forward -346 -339 14.5921 0.026
NP_442578.1_7 Reverse -339 -346 14.5921 0.026
NP_441462.1_2 Forward -347 -337 11.5831 0.00406
NP_441462.1_2 Reverse -338 -348 11.5831 0.00406
NP_441462.1_2 Reverse -170 -180 -0.41329 0.225
NP_441462.1_4 Forward -279 -260 -1.7705 0.181
NP_441621.1_7 Reverse -336 -350 -3.147 0.188
NP_441621.1_7 Forward -349 -335 -3.44199 0.188
NP_443062.1_6 Forward -355 -336 10.1275 0.118
NP_441601.1_4 Reverse -321 -340 10.1275 0.155
NP_442204.1_1 Forward -297 -286 1.33697 0.274
NP_442204.1_1 Reverse -334 -345 0.648657 0.281
NP_442204.1_5 Reverse -328 -347 20.2556 0.0241
NP_440516.1_6 Forward -79 -65 8.3571 0.247
NP_440516.1_8 Forward -347 -338 16.9127 0.00442
NP_440516.1_8 Reverse -338 -347 16.9127 0.00442
NP_442428.1_5 Forward -346 -339 15.8704 0.0124
NP_442428.1_5 Reverse -339 -346 15.8704 0.0124
NP_442120.1_10 Reverse -314 -333 -9.93197 0.247
NP_442120.1_10 Forward -230 -211 -15.9302 0.296
NP_442120.1_10 Reverse -332 -351 -16.2252 0.297
NP_440673.1_2 Forward -49 -30 12.2431 0.153
NP_440673.1_3 Forward -345 -338 12.4288 0.0426
NP_440673.1_3 Reverse -340 -347 12.4288 0.0426
NP_440673.1_3 Forward -78 -71 6.72562 0.277
NP_440673.1_7 Reverse -327 -346 15.0441 0.0925
NP_440673.1_7 Forward -268 -249 2.3594 0.228
NP_441052.1_2 Reverse -338 -348 19.9412 0.00106
NP_441052.1_2 Forward -347 -337 10.5014 0.0285
NP_442219.1_9 Reverse -339 -348 17.7976 0.00718
NP_442219.1_9 Forward -346 -337 8.35786 0.0681
NP_440436.1_4 Forward -346 -337 18.1905 0.00233
NP_440436.1_4 Reverse -339 -348 17.2072 0.00233
NP_441884.1_8 Reverse -295 -314 -8.16202 0.261
NP_441884.1_9 Reverse -335 -354 -15.8318 0.138
NP_440314.1_9 Reverse -339 -358 -9.73531 0.276
NP_441719.1_4 Forward -346 -339 16.3621 0.0124
NP_441719.1_4 Reverse -339 -346 16.3621 0.0124
NP_441733.1_10 Forward -350 -337 7.09911 0.156
NP_441004.1_1 Forward -353 -334 -16.0285 0.281
NP_441004.1_1 Reverse -249 -268 -18.0934 0.297
NP_442366.1_3 Reverse -337 -355 -0.7675 0.199
NP_442366.1_3 Forward -348 -330 -1.16082 0.207
NP_442366.1_5 Forward -350 -340 15.4175 0.0374
NP_442139.1_7 Forward -352 -333 11.2092 0.195
NP_442206.1_7 Forward -349 -330 8.35759 0.295
NP_442206.1_10 Reverse -338 -353 3.32315 0.186
NP_443054.1_2 Forward -349 -335 2.94952 0.24
NP_442430.1_10 Reverse -328 -347 10.2251 0.265
NP_441851.1_10 Reverse -337 -347 16.008 0.00552
NP_441851.1_10 Forward -348 -338 15.8113 0.00552
NP_441851.1_10 Reverse -169 -179 7.55152 0.137
NP_442856.1_7 Reverse -329 -348 17.994 0.0463
NP_441668.1_4 Forward -357 -338 18.879 0.0435
NP_442515.1_1 Forward -348 -334 4.71948 0.107
NP_442515.1_1 Reverse -337 -351 4.62115 0.107
NP_440593.1_3 Forward -352 -333 2.75272 0.17
NP_440593.1_3 Forward -346 -327 -1.27885 0.211
NP_440593.1_3 Reverse -333 -352 -4.81876 0.253
NP_441982.1_6 Forward -288 -279 13.0583 0.274
NP_442709.1_3 Reverse -163 -182 7.07928 0.137
NP_441349.1_10 Forward -357 -338 10.4225 0.0234
NP_441349.1_10 Reverse -328 -347 -9.93197 0.3
NP_441051.1_2 Forward -202 -183 23.1072 0.0128
NP_441394.1_1 Forward -65 -51 18.0925 0.271
NP_442843.1_1 Reverse -289 -308 -11.5053 0.291
NP_439960.1_4 Forward -300 -281 17.8948 0.125
NP_440474.1_8 Forward -346 -332 11.012 0.119
NP_442450.1_5 Forward -349 -339 7.55152 0.13
NP_440588.1_2 Reverse -329 -348 10.8159 0.0364
NP_440588.1_2 Forward -356 -337 6.68596 0.0535
NP_440588.1_2 Forward -350 -331 2.3594 0.121
NP_440588.1_2 Reverse -85 -104 0.0977854 0.149
NP_442006.1_2 Forward -299 -282 -3.00942 0.132
NP_442243.1_1 Forward -269 -251 2.77167 0.204
NP_442243.1_1 Reverse -58 -76 -2.9315 0.298
NP_441570.1_1 Forward -347 -329 -16.5005 0.247
NP_440078.1_10 Forward -347 -328 2.65439 0.269
NP_441078.1_4 Forward -347 -338 19.6659 0.0007
NP_441078.1_4 Reverse -338 -347 19.6659 0.0007
NP_442729.1_8 Forward -351 -338 10.639 0.125
NP_442729.1_8 Reverse -334 -347 8.47575 0.125
NP_442443.1_1 Forward -301 -282 -4.32711 0.271
NP_440526.1_3 Forward -346 -335 2.41814 0.267
NP_440526.1_3 Reverse -339 -350 1.04151 0.267
NP_441432.1_8 Forward -348 -339 16.8143 0.00595
NP_441432.1_8 Reverse -337 -346 8.25953 0.0755
NP_441432.1_8 Reverse -70 -79 3.53964 0.244
NP_442320.1_8 Reverse -332 -346 8.35772 0.0184
NP_442320.1_8 Forward -353 -339 -4.81863 0.188
NP_441732.1_2 Reverse -334 -350 -6.43131 0.0495
NP_441732.1_2 Forward -351 -335 -6.62797 0.0495
NP_441732.1_2 Forward -333 -317 -6.82463 0.0533
NP_440629.1_5 Forward -181 -162 8.65258 0.269
NP_440760.1_1 Forward -347 -328 -4.6221 0.0452
NP_440760.1_1 Reverse -338 -357 -6.09707 0.0549
NP_440760.1_1 Forward -179 -160 -11.5053 0.0857
NP_442797.1_7 Forward -348 -330 1.00246 0.267
NP_440461.1_3 Reverse -273 -292 15.6341 0.212
NP_442353.1_4 Reverse -332 -351 8.4551 0.156
NP_442751.1_2 Forward -81 -62 4.91521 0.261
NP_442400.1_10 Forward -189 -176 7.79662 0.282
NP_440713.1_4 Reverse -328 -347 6.09597 0.196
NP_442489.1_7 Forward -347 -338 20.1576 0.000695
NP_442489.1_7 Reverse -338 -347 20.1576 0.000695
NP_442489.1_7 Reverse -170 -179 -2.06522 0.288
NP_441706.1_10 Forward -350 -331 11.9958 0.181
NP_440559.1_1 Reverse -339 -348 17.4043 0.00658
NP_440559.1_1 Forward -346 -337 8.75118 0.0586
NP_440559.1_1 Forward -178 -169 4.32629 0.288
NP_441659.2_8 Reverse -338 -348 18.1713 0.00133
NP_441659.2_8 Forward -347 -337 11.9764 0.0147
NP_442913.1_10 Reverse -329 -348 3.04771 0.115
NP_441040.1_2 Forward -349 -330 -14.5535 0.286
NP_440708.1_6 Forward -339 -320 -10.6203 0.282
NP_441800.1_10 Reverse -70 -89 3.04771 0.252
NP_442776.1_6 Reverse -336 -355 10.7175 0.207
NP_442346.1_5 Forward -348 -338 16.6963 0.00248
NP_442346.1_5 Reverse -337 -347 9.02648 0.118
NP_440545.1_3 Forward -351 -334 5.54538 0.0608
NP_441856.1_1 Reverse -320 -339 11.3075 0.162
NP_440025.1_3 Reverse -27 -41 14.7737 0.235
NP_440831.1_3 Reverse -329 -348 10.5615 0.175
NP_440486.1_6 Reverse -253 -272 8.75091 0.235
NP_440459.1_2 Forward -308 -291 8.20031 0.267
NP_441653.1_2 Reverse -285 -304 7.29833 0.223
NP_442603.1_7 Reverse -338 -352 7.17714 0.211
NP_441888.1_7 Reverse -333 -347 4.22782 0.225
NP_441050.1_5 Forward -398 -380 -1.55415 0.265
NP_440449.1_6 Reverse -330 -348 14.8697 0.0924
NP_440449.1_6 Forward -88 -70 5.4352 0.276
NP_441948.1_4 Forward -354 -336 -1.06249 0.14
NP_441833.1_4 Forward -346 -339 15.9687 0.0124
NP_441833.1_4 Reverse -339 -346 15.9687 0.0124
NP_441329.1_6 Forward -207 -188 8.25963 0.153
NP_441112.1_6 Forward -234 -215 -2.16383 0.296
NP_442162.1_9 Forward -346 -339 16.2637 0.0124
NP_442162.1_9 Reverse -339 -346 16.2637 0.0124
NP_442045.1_5 Forward -83 -64 3.83436 0.239
NP_442073.1_6 Reverse -329 -348 -3.04881 0.291
NP_442140.1_3 Forward -346 -336 17.4829 0.0159
NP_442140.1_3 Reverse -339 -349 12.2714 0.0632
NP_442021.1_3 Reverse -248 -267 -6.58872 0.257
NP_441609.1_1 Reverse -163 -182 7.27595 0.17
NP_441671.1_1 Forward -301 -282 10.4225 0.176
NP_440875.1_9 Forward -345 -335 15.2829 0.0295
NP_441813.1_5 Reverse -336 -346 10.0098 0.0208
NP_441813.1_5 Forward -349 -339 8.63316 0.0367
NP_440594.1_6 Reverse -332 -351 9.63507 0.203
NP_441227.1_6 Reverse -320 -339 14.5524 0.293
NP_440590.1_1 Forward -253 -234 11.5033 0.22
NP_440590.1_4 Forward -346 -333 22.0454 0.00377
NP_440590.1_4 Reverse -339 -352 0.805932 0.143
NP_440567.1_1 Forward -346 -332 18.9775 0.0136
NP_440567.1_1 Reverse -339 -353 2.35953 0.176
NP_442497.1_10 Forward -346 -337 10.4228 0.0087
NP_442497.1_10 Reverse -339 -348 10.4228 0.0087
NP_442497.1_10 Forward -178 -169 0.393051 0.175
NP_440821.1_4 Reverse -336 -346 18.7612 0.00422
NP_440821.1_4 Forward -349 -339 9.41981 0.0286
NP_441239.1_9 Reverse -336 -348 16.0669 0.0175
NP_441239.1_9 Forward -181 -169 8.9871 0.117
NP_441239.1_9 Forward -349 -337 5.93884 0.202
NP_440400.1_1 Forward -314 -295 -3.24622 0.292
NP_441892.1_1 Reverse -329 -346 -2.02611 0.217
NP_441892.1_1 Reverse -323 -340 -6.05768 0.296
NP_440665.1_1 Forward -302 -283 -13.8652 0.261
NP_442044.1_1 Reverse -333 -352 -5.50708 0.188
NP_442044.1_1 Reverse -380 -399 -14.6519 0.294
NP_442270.1_9 Reverse -327 -346 -0.39387 0.142
NP_442482.1_5 Reverse -183 -202 11.7992 0.253
NP_441567.1_4 Reverse -163 -182 8.55425 0.248
NP_440354.1_7 Reverse -332 -350 6.41066 0.283
NP_441617.1_6 Reverse -163 -182 -6.49039 0.283
NP_442052.1_8 Reverse -330 -340 13.1564 0.253
NP_440546.1_4 Forward -347 -337 11.8882 0.0679
NP_440546.1_4 Reverse -338 -348 10.046 0.109
NP_440546.1_6 Reverse -328 -347 7.86593 0.266
NP_442041.1_2 Reverse -319 -337 9.85225 0.283
NP_442041.1_5 Reverse -236 -255 0.687771 0.257
NP_441230.1_5 Reverse -333 -352 -0.000545616 0.277
NP_441230.1_5 Reverse -236 -255 -0.0988766 0.277
NP_440462.1_6 Reverse -336 -346 17.9746 0.00578
NP_440462.1_6 Forward -349 -339 1.35667 0.294
NP_440868.1_4 Reverse -334 -346 12.527 0.0235
NP_440868.1_4 Forward -351 -339 8.10212 0.0602
NP_442499.1_3 Forward -348 -330 4.34571 0.289
NP_442499.1_3 Reverse -379 -397 4.05072 0.289
NP_442402.1_10 Reverse -278 -288 14.5325 0.18
NP_442039.1_4 Forward -346 -339 15.1821 0.0124
NP_442039.1_4 Reverse -339 -346 15.1821 0.0124
NP_441811.1_8 Forward -60 -46 12.9793 0.197
NP_441811.1_8 Reverse -332 -346 11.406 0.218
NP_441811.1_8 Reverse -164 -178 5.80112 0.289
NP_442679.1_1 Forward -194 -175 2.85105 0.158
NP_440825.1_7 Forward -53 -43 15.0567 0.152
NP_440825.1_7 Reverse -339 -349 12.9096 0.152
NP_442837.1_3 Forward -346 -339 15.7721 0.0124
NP_442837.1_3 Reverse -339 -346 15.7721 0.0124
NP_439994.1_3 Reverse -16 -35 8.43855 0.291
NP_442053.1_1 Forward -347 -338 18.3876 0.0007
NP_442053.1_1 Reverse -338 -347 18.3876 0.0007
NP_440505.1_3 Reverse -336 -346 14.1397 0.0235
NP_440505.1_3 Forward -349 -339 9.22315 0.122
NP_440505.1_7 Forward -297 -278 3.93269 0.207
NP_440520.1_1 Reverse -251 -270 6.4893 0.112
NP_442532.1_7 Forward -347 -333 17.1092 0.0587
NP_442532.1_7 Reverse -71 -85 4.52282 0.171
NP_441408.2_7 Reverse -336 -355 -4.52377 0.281
NP_440914.1_1 Reverse -338 -348 17.5935 0.000537
NP_440914.1_1 Forward -347 -337 8.6151 0.186
NP_441011.1_8 Forward -346 -337 16.9127 0.00602
NP_441011.1_8 Reverse -339 -348 8.25953 0.144
NP_442533.1_1 Reverse -301 -320 -15.8318 0.257
NP_442533.1_6 Forward -347 -338 17.2076 0.00137
NP_442533.1_6 Reverse -338 -347 17.2076 0.00137
NP_442232.1_3 Reverse -330 -349 -13.3736 0.282
NP_442322.1_4 Forward -281 -264 -10.0899 0.298
NP_441482.1_7 Forward -353 -339 -3.147 0.11
NP_441482.1_7 Reverse -332 -346 -8.26021 0.193
NP_441482.1_7 Forward -32 -18 -11.4068 0.262
NP_441482.1_7 Reverse -164 -178 -11.5051 0.268
NP_439944.1_9 Reverse -339 -349 10.5014 0.0887
NP_439944.1_9 Forward -346 -336 10.4031 0.0887
NP_441028.1_6 Forward -75 -65 10.9926 0.193
NP_440116.1_8 Reverse -339 -358 -8.94866 0.264
NP_441527.1_4 Forward -192 -173 -3.86785 0.175
NP_441527.1_4 Forward -203 -184 -11.0297 0.278
NP_440115.1_6 Reverse -335 -345 9.61647 0.115
NP_441680.1_4 Reverse -56 -75 5.40766 0.183
NP_441680.1_4 Forward -271 -252 -3.44213 0.296
NP_441602.1_3 Forward -352 -333 9.53756 0.117
NP_441602.1_3 Forward -79 -60 -0.885524 0.226
NP_441602.1_3 Reverse -333 -352 -3.24547 0.243
NP_441170.1_4 Forward -270 -252 4.24738 0.251
NP_441106.1_1 Reverse -337 -346 18.191 0.0028
NP_441106.1_1 Forward -348 -339 9.63616 0.0311
NP_439903.1_6 Forward -29 -10 0.785326 0.256
NP_439903.1_6 Forward -182 -163 -0.492971 0.282
NP_442306.1_10 Forward -352 -333 -19.7651 0.2
NP_441286.1_1 Forward -348 -336 14.7886 0.00418
NP_441286.1_1 Reverse -337 -349 3.38223 0.0467
NP_440670.1_8 Forward -347 -338 18.3876 0.000699
NP_440670.1_8 Reverse -338 -347 18.3876 0.000699
NP_441930.1_2 Reverse -70 -80 12.8614 0.248
NP_441930.1_3 Forward -191 -172 6.04041 0.263
NP_440886.1_4 Reverse -320 -339 18.7807 0.112
NP_440886.1_7 Reverse -337 -347 17.7774 0.0011
NP_440886.1_7 Forward -348 -338 7.94438 0.0805
NP_440886.1_7 Reverse -283 -293 6.66608 0.115
NP_440083.1_1 Forward -29 -10 0.392778 0.293
NP_442072.1_9 Forward -348 -330 -13.8455 0.123
NP_440907.2_8 Forward -346 -336 17.4824 0.00685
NP_440907.2_8 Reverse -339 -349 7.64939 0.117
NP_441021.1_1 Forward -346 -327 10.2259 0.0371
NP_442459.1_5 Reverse -284 -303 19.9606 0.0931
NP_441463.1_3 Reverse -328 -347 -9.047 0.276
NP_441463.1_6 Forward -258 -244 7.09237 0.265
NP_441463.1_6 Forward -349 -335 6.02939 0.283
NP_441626.1_2 Forward -346 -339 15.7721 0.0124
NP_441626.1_2 Reverse -339 -346 15.7721 0.0124
NP_442365.1_7 Forward -351 -332 -2.85214 0.205
NP_442794.1_1 Forward -351 -339 9.28209 0.0795
NP_442615.1_1 Forward -356 -338 13.4905 0.0114
NP_442615.1_1 Reverse -329 -347 -2.53746 0.145
NP_441962.1_4 Reverse -333 -352 11.7992 0.0495
NP_440387.1_1 Forward -347 -331 25.4279 0.00118
NP_440387.1_1 Reverse -338 -354 11.8583 0.0149
NP_440855.1_5 Forward -349 -330 11.2084 0.238
NP_441431.1_2 Reverse -335 -349 20.0584 0.00685
NP_442020.1_1 Forward -189 -170 -0.591301 0.278
NP_441488.1_7 Forward -353 -334 0.294447 0.298
NP_441836.1_2 Reverse -332 -351 4.12936 0.147
NP_441993.1_1 Forward -347 -328 5.26024 0.205
NP_441993.1_1 Reverse -164 -183 1.26449 0.282
NP_441993.1_1 Reverse -236 -255 0.484826 0.298
NP_442084.1_6 Reverse -3 -21 5.62401 0.249
NP_440358.1_8 Forward -289 -270 -0.885524 0.274
NP_440114.1_10 Forward -347 -333 6.88276 0.253
NP_440114.1_10 Reverse -385 -399 6.58777 0.263
NP_440293.1_3 Reverse -268 -287 -0.295539 0.228
NP_440766.1_4 Reverse -334 -348 8.16106 0.0871
NP_440422.1_10 Reverse -172 -191 6.24133 0.245
NP_441237.1_9 Reverse -339 -349 14.828 0.0242
NP_440457.1_1 Reverse -334 -346 7.21714 0.105
NP_440457.1_1 Reverse -67 -79 -0.74767 0.273
NP_440798.1_6 Forward -346 -333 3.5592 0.15
NP_441984.1_1 Reverse -332 -350 9.95058 0.214
NP_441984.1_3 Forward -90 -72 8.47561 0.229
NP_440473.1_9 Reverse -327 -346 -6.29373 0.228
NP_442509.1_9 Forward -347 -337 16.2041 0.00739
NP_442509.1_9 Reverse -338 -348 8.14104 0.192
NP_442936.1_7 Reverse -179 -198 9.14423 0.219
NP_442514.1_5 Reverse -215 -234 -7.3761 0.276
NP_440756.1_1 Reverse -17 -36 15.9823 0.294
NP_440448.1_5 Forward -172 -153 12.5858 0.162
NP_440554.1_4 Forward -346 -336 13.943 0.0218
NP_441845.1_6 Reverse -79 -97 -1.75081 0.296
NP_441885.1_5 Reverse -338 -348 20.9245 0.000538
NP_441885.1_5 Forward -347 -337 11.4848 0.00668
NP_440478.1_10 Reverse -336 -350 8.25939 0.257
NP_442341.1_7 Forward -348 -334 21.6324 0.00413
NP_442341.1_7 Reverse -337 -351 13.6676 0.0334
NP_441756.1_5 Reverse -259 -278 -0.4922 0.245
NP_442395.2_4 Forward -348 -329 8.75009 0.121
NP_440409.1_1 Forward -355 -336 -2.95047 0.252
NP_443000.1_7 Forward -349 -339 10.3048 0.0345
NP_443000.1_7 Forward -28 -18 2.24165 0.226
NP_443000.1_7 Reverse -336 -346 2.04498 0.226
NP_440507.2_3 Reverse -329 -348 14.8466 0.113
NP_441842.1_1 Forward -345 -332 15.6533 0.0619
NP_441842.1_10 Reverse -331 -345 10.521 0.161
NP_440275.1_3 Reverse -336 -346 17.9746 0.0082
NP_440275.1_3 Forward -349 -339 8.04317 0.0602
NP_442932.1_9 Reverse -332 -351 4.71934 0.277
NP_440091.1_1 Reverse -334 -346 10.1671 0.0498
NP_443060.1_1 Forward -333 -314 10.52 0.218
NP_440679.1_10 Forward -338 -319 -21.83 0.3
NP_443010.1_10 Reverse -335 -352 6.82941 0.179
NP_442451.1_2 Reverse -330 -349 -2.75381 0.187
NP_439962.1_4 Forward -340 -321 6.4893 0.155
NP_439962.1_4 Reverse -330 -349 -2.26216 0.226
NP_439962.1_4 Reverse -252 -271 -5.80207 0.28
NP_439962.1_4 Reverse -253 -272 -7.67036 0.29
NP_440149.1_8 Forward -347 -328 -0.295539 0.146
NP_440149.1_8 Reverse -338 -357 -3.04881 0.18
NP_441105.1_3 Reverse -327 -346 -3.3438 0.177
NP_441105.1_3 Forward -304 -285 -4.22878 0.195
NP_441105.1_3 Forward -358 -339 -6.1954 0.23
NP_440216.1_1 Forward -347 -333 -1.27871 0.0303
NP_440216.1_1 Reverse -338 -352 -10.6202 0.145
NP_440172.1_1 Reverse -338 -348 15.0247 0.00945
NP_440172.1_1 Reverse -170 -180 14.9263 0.00989
NP_440172.1_1 Forward -347 -337 8.73149 0.0586
NP_440172.1_1 Forward -26 -16 4.40493 0.189
NP_442015.1_10 Reverse -334 -347 12.9006 0.0365
NP_442015.1_10 Forward -266 -253 4.14919 0.178
NP_442015.1_10 Forward -351 -338 1.39592 0.204
NP_441226.1_7 Forward -346 -339 14.4934 0.0123
NP_441226.1_7 Reverse -339 -346 14.4934 0.0123
NP_441111.1_7 Forward -346 -338 18.7023 0.00294
NP_441111.1_7 Reverse -339 -347 18.7023 0.00294
NP_441766.1_2 Forward -347 -338 17.5026 0.00297
NP_441766.1_2 Reverse -338 -347 17.5026 0.00297
NP_441766.1_2 Reverse -170 -179 4.22796 0.193
NP_441766.1_9 Reverse -262 -281 -3.04881 0.291
NP_440416.1_9 Reverse -246 -265 -2.55715 0.071
NP_440416.1_9 Forward -354 -335 -17.4051 0.239
NP_440416.1_9 Forward -81 -62 -19.7651 0.278
NP_443052.1_8 Reverse -328 -347 -9.047 0.183
NP_443052.1_8 Forward -93 -74 -12.9802 0.27
NP_440591.1_9 Reverse -331 -349 6.70565 0.215
NP_442046.1_8 Reverse -317 -336 11.4058 0.293
NP_440261.1_5 Forward -346 -333 -2.63565 0.0924
NP_440261.1_5 Reverse -339 -352 -10.3055 0.201
NP_440988.1_5 Reverse -42 -61 14.3229 0.233
NP_440988.1_10 Forward -343 -329 6.35102 0.232
NP_440988.1_10 Forward -292 -278 4.89883 0.249
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGTGGGGCCGATGCTTACTGCGTTAAAGGAGCCACCCTAGAGCGTTTAATTTTGGCGATCGCCGCCGCCCAGGATGGAGCCACCTACCTAGACCCCCAAATTGCCCGGGTGGTGGTGGAAAACCTCAAGCCCCCCGTGCCGGAAGGCCAAGCCGACGTGTCTAGCCTTTCGGAAAGGGAAATTGACGTGCTGAAATTAATTGTGGAAGGAAAAAGTAACCAAGAAATCGCCCAAACTTTATATCTAAGCACCAACACAATTAAAACTCATGTACGGGGCATCATGAATAAGCTGTCCGTTGATGACCGGGTTCAAGCTGCCGTCATTGCCCTCCGTTCCGGTTTGGTTTGATTGCAGAAGGGGCTATAATCCAAGGCGTTTACTTTACCCGTCCTAAACC

CDS

ATGGCCAAAGCAATCTGGAATGGGGTCGTCCTCGCCGAGAGTGACCAGTGTGAAATGGTGGAGGGCAACTACTATTTTCCCCCCGACAGCATCCATCCCCAGTATTTCCAGCCCAGTAACACCCACACCGTTTGCGGTTGGAAAGGCACCGCCAGTTACTACACCGTAGTGGTGGATGGCCAGGAGAACCCGGATGCGGCTTGGTATTACCCCGATCCCAAACCCAGGGCGGAAAATATTAAGGGCTACATCGCTTTTTGGCGGGGTGTAAAGGTTGAAGCCTGA

Protein

MAKAIWNGVVLAESDQCEMVEGNYYFPPDSIHPQYFQPSNTHTVCGWKGTASYYTVVVDGQENPDAAWYYPDPKPRAENIKGYIAFWRGVKVEA