Your browser is old and dusty. Try Google Chrome!

Details for ssl3177

ORF ssl3177
Accession NP_440815.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -357 -343 0.392915 0.211
NP_441061.1_2 Forward -225 -211 -0.000409212 0.219
NP_441061.1_2 Forward -22 -8 -0.393733 0.228
NP_440815.1_1 Forward -116 -99 19.41 0.2
NP_440815.1_2 Forward -323 -309 15.0436 0.234
NP_440815.1_4 Forward -204 -186 19.2896 0.11
NP_442291.1_5 Forward -391 -375 -4.07137 0.263
NP_440897.1_6 Forward -390 -371 4.71854 0.133
NP_441453.1_4 Forward -390 -382 7.19758 0.0757
NP_441453.1_4 Reverse -381 -389 6.70593 0.121
NP_441623.1_1 Forward -168 -150 3.95239 0.186
NP_441623.1_1 Forward -183 -165 -2.3408 0.241
NP_442151.1_6 Forward -358 -344 12.9793 0.0628
NP_441818.1_9 Reverse -301 -320 -9.44032 0.291
NP_441818.1_9 Reverse -242 -261 -10.3253 0.292
NP_440226.1_1 Reverse -381 -400 5.30933 0.161
NP_441630.1_3 Forward -234 -215 -0.39387 0.287
NP_440120.1_4 Forward -378 -364 15.0442 0.273
NP_442744.1_8 Forward -397 -378 -5.9004 0.297
NP_442655.1_1 Forward -245 -226 5.70265 0.157
NP_442173.1_1 Forward -389 -381 5.82095 0.2
NP_442173.1_1 Reverse -382 -390 5.72262 0.203
NP_442752.1_4 Reverse -381 -388 13.8055 0.0199
NP_442752.1_4 Reverse -231 -238 5.44732 0.202
NP_443027.1_4 Reverse -379 -389 9.41981 0.163
NP_439997.1_6 Reverse -309 -328 13.3725 0.177
NP_442975.1_10 Reverse -255 -269 3.8339 0.252
NP_440784.1_7 Forward -389 -382 6.23397 0.241
NP_440784.1_7 Reverse -382 -389 6.13563 0.241
NP_441934.1_5 Reverse -341 -360 15.7324 0.188
NP_440061.1_9 Forward -222 -208 11.5037 0.109
NP_440061.1_9 Forward -392 -378 5.1122 0.294
NP_440110.1_8 Reverse -263 -282 7.37428 0.112
NP_439979.1_2 Reverse -273 -292 8.25926 0.258
NP_442062.1_8 Reverse -381 -391 7.84651 0.0871
NP_442062.1_8 Forward -397 -387 5.5849 0.163
NP_442062.1_8 Forward -176 -166 2.83163 0.293
NP_441900.1_1 Forward -240 -221 11.9196 0.222
NP_442242.1_4 Reverse -382 -389 12.4288 0.0393
NP_442602.1_3 Reverse -208 -227 -2.26216 0.256
NP_441161.1_3 Forward -396 -378 11.7205 0.186
NP_441208.1_9 Forward -393 -379 13.3726 0.109
NP_441208.1_9 Reverse -228 -242 10.816 0.174
NP_441208.1_9 Reverse -315 -329 9.63603 0.207
NP_442276.1_2 Reverse -199 -218 4.52268 0.299
NP_441083.1_5 Reverse -381 -391 10.6981 0.0184
NP_441083.1_5 Forward -390 -380 2.04498 0.195
NP_441738.1_2 Forward -388 -381 15.28 0.0102
NP_441738.1_2 Forward -238 -231 9.77352 0.143
NP_441558.1_5 Forward -222 -203 9.24257 0.126
NP_441558.1_5 Reverse -379 -398 7.57094 0.176
NP_440209.1_1 Reverse -381 -389 14.8674 0.012
NP_440209.1_1 Forward -390 -382 8.57422 0.0425
NP_442889.1_8 Forward -263 -249 5.01387 0.243
NP_441713.1_1 Forward -396 -377 -17.0118 0.292
NP_441770.1_4 Reverse -212 -231 -11.9969 0.29
NP_440178.1_7 Reverse -166 -185 -22.6167 0.268
NP_442570.1_3 Reverse -304 -323 -5.9004 0.25
NP_441716.1_1 Reverse -381 -395 4.81781 0.248
NP_442111.1_4 Forward -391 -377 1.86788 0.293
NP_442111.1_4 Forward -221 -207 1.67122 0.296
NP_440906.1_5 Forward -389 -382 12.0355 0.0724
NP_440906.1_5 Reverse -382 -389 12.0355 0.0724
NP_440747.1_10 Forward -393 -381 5.25052 0.0154
NP_440747.1_10 Reverse -378 -390 -2.4193 0.0434
NP_440747.1_10 Forward -243 -231 -12.1541 0.227
NP_441486.1_1 Forward -393 -379 -3.44199 0.178
NP_441486.1_1 Reverse -378 -392 -3.73699 0.181
NP_442634.1_4 Forward -63 -49 -5.01529 0.228
NP_441014.1_2 Reverse -300 -319 11.8975 0.258
NP_441014.1_10 Forward -172 -153 1.57197 0.227
NP_442848.1_5 Forward -260 -242 -0.0791831 0.276
NP_442848.1_5 Forward -257 -239 -3.02911 0.29
NP_442848.1_9 Forward -351 -332 1.37609 0.262
NP_443018.1_3 Forward -219 -212 9.38056 0.128
NP_443018.1_3 Forward -389 -382 5.34899 0.212
NP_443018.1_3 Reverse -382 -389 5.34899 0.212
NP_440376.1_1 Forward -390 -381 9.73449 0.0365
NP_440376.1_1 Reverse -381 -390 9.73449 0.0365
NP_440376.1_1 Forward -176 -167 4.32629 0.163
NP_441588.1_4 Reverse -383 -393 8.33817 0.151
NP_443065.1_6 Forward -292 -273 2.16274 0.221
NP_442687.1_7 Reverse -380 -390 7.45319 0.132
NP_442687.1_7 Reverse -166 -176 7.05986 0.142
NP_442583.1_1 Reverse -238 -257 16.4207 0.146
NP_440642.1_10 Reverse -322 -336 1.96562 0.284
NP_441029.1_3 Forward -320 -301 3.34271 0.277
NP_442544.1_6 Reverse -374 -393 -6.88371 0.298
NP_441414.1_9 Forward -390 -371 -10.0303 0.275
NP_442937.1_5 Forward -181 -162 8.25926 0.229
NP_441958.1_5 Reverse -380 -390 11.6814 0.00361
NP_441958.1_5 Forward -391 -381 2.53664 0.0409
NP_441127.1_1 Reverse -349 -363 11.3077 0.23
NP_440203.1_5 Forward -355 -345 13.5492 0.114
NP_440203.1_5 Forward -237 -227 11.2876 0.2
NP_440203.1_5 Forward -223 -213 10.6976 0.215
NP_440203.1_5 Forward -25 -15 9.91099 0.245
NP_439905.1_1 Forward -389 -376 11.229 0.204
NP_440984.1_7 Reverse -376 -390 11.8976 0.122
NP_439990.1_5 Forward -22 -9 8.08242 0.181
NP_440153.1_5 Forward -294 -280 0.786239 0.289
NP_442064.1_4 Forward -21 -2 8.65176 0.23
NP_442853.1_5 Forward -184 -165 5.80018 0.287
NP_441099.1_3 Reverse -308 -327 6.19431 0.196
NP_441099.1_5 Forward -27 -8 1.27776 0.0673
NP_441099.1_5 Reverse -157 -176 -10.7186 0.261
NP_441099.1_5 Reverse -201 -220 -11.9969 0.294
NP_441294.1_7 Forward -394 -380 14.626 0.0391
NP_442431.1_10 Reverse -233 -251 3.26407 0.22
NP_442431.1_10 Reverse -245 -263 1.69077 0.249
NP_441000.1_6 Reverse -285 -299 -1.27871 0.212
NP_440147.1_4 Forward -392 -379 8.67241 0.0475
NP_440147.1_4 Reverse -386 -399 5.32916 0.129
NP_440147.1_4 Reverse -379 -392 0.904263 0.244
NP_441550.1_8 Reverse -379 -389 6.46942 0.206
NP_441550.1_8 Reverse -209 -219 5.68278 0.236
NP_441550.1_8 Forward -392 -382 5.48612 0.247
NP_441916.1_7 Forward -390 -380 9.41981 0.0357
NP_441916.1_10 Forward -335 -316 9.43923 0.157
NP_441916.1_10 Reverse -159 -178 1.0811 0.27
NP_441041.1_4 Reverse -343 -362 -11.6036 0.25
NP_441041.1_4 Reverse -301 -320 -13.5702 0.291
NP_441041.1_4 Reverse -337 -356 -13.9635 0.299
NP_441041.1_7 Forward -229 -217 12.1793 0.0682
NP_441041.1_7 Forward -393 -381 8.00067 0.151
NP_441041.1_7 Forward -243 -231 5.57123 0.25
NP_440703.1_9 Forward -316 -303 4.83694 0.293
NP_439966.1_7 Reverse -379 -389 4.50281 0.269
NP_442941.1_3 Forward -389 -379 9.51814 0.0306
NP_442941.1_3 Reverse -382 -392 1.25834 0.15
NP_440983.1_2 Reverse -367 -386 3.14605 0.297
NP_440260.1_8 Forward -361 -343 -5.09406 0.273
NP_440260.1_8 Forward -399 -381 -6.96235 0.295
NP_442256.1_2 Forward -392 -374 -8.53565 0.227
NP_440437.1_1 Reverse -46 -65 3.44104 0.121
NP_442500.1_8 Reverse -39 -53 11.4317 0.261
NP_441556.1_10 Forward -22 -8 11.0005 0.249
NP_442982.1_5 Reverse -221 -240 -2.16383 0.286
NP_443030.1_6 Forward -261 -242 15.9291 0.172
NP_442068.1_4 Forward -265 -246 14.3549 0.137
NP_441644.1_6 Reverse -381 -391 13.0576 0.0244
NP_441644.1_6 Forward -390 -380 10.206 0.0628
NP_441644.1_6 Reverse -343 -353 8.53436 0.0982
NP_442215.1_2 Forward -399 -383 1.23851 0.138
NP_442215.1_2 Forward -360 -344 -5.05468 0.244
NP_442215.1_6 Reverse -267 -285 22.5361 0.0609
NP_442029.1_10 Forward -172 -153 5.30933 0.287
NP_440929.1_8 Forward -390 -381 9.73449 0.0257
NP_440929.1_8 Reverse -381 -390 9.4395 0.0326
NP_442933.1_10 Reverse -381 -390 13.9627 0.0192
NP_442933.1_10 Forward -390 -381 8.1612 0.0885
NP_441751.2_8 Reverse -382 -396 4.71948 0.047
NP_442554.1_8 Reverse -212 -222 8.04317 0.0801
NP_442554.1_8 Forward -389 -379 7.55152 0.0893
NP_442554.1_8 Reverse -382 -392 5.78156 0.138
NP_442554.1_8 Forward -219 -209 4.99491 0.163
NP_442554.1_8 Forward -351 -341 2.92996 0.249
NP_442142.1_4 Forward -393 -380 11.8184 0.0518
NP_442292.1_1 Reverse -382 -391 8.65285 0.0335
NP_442292.1_1 Forward -389 -380 7.76787 0.0615
NP_442292.1_5 Forward -230 -211 -0.885524 0.257
NP_440045.1_1 Reverse -320 -338 22.5369 0.0462
NP_443009.1_5 Forward -391 -380 11.5629 0.0624
NP_442408.2_1 Forward -390 -371 0.392778 0.202
NP_442408.2_1 Reverse -218 -237 -6.1954 0.282
NP_441715.1_4 Forward -389 -379 7.05986 0.118
NP_442305.1_6 Forward -322 -312 16.0075 0.269
NP_440015.1_9 Reverse -381 -399 0.805796 0.248
NP_440730.1_4 Reverse -151 -170 1.17943 0.24
NP_440730.1_4 Reverse -217 -236 -0.983855 0.27
NP_440730.1_4 Reverse -19 -38 -2.95047 0.297
NP_441448.1_7 Reverse -267 -286 8.65258 0.242
NP_441198.1_8 Reverse -6 -16 10.3415 0.28
NP_440464.1_10 Reverse -382 -392 12.7217 0.189
NP_441468.1_1 Forward -389 -382 6.13563 0.209
NP_441468.1_1 Reverse -382 -389 6.0373 0.223
NP_442099.1_1 Reverse -245 -263 14.2771 0.274
NP_441020.2_6 Forward -178 -161 10.2653 0.149
NP_441020.2_7 Forward -320 -301 7.07848 0.269
NP_441673.1_1 Forward -390 -381 11.1111 0.0121
NP_441673.1_1 Reverse -381 -390 11.0128 0.018
NP_441673.1_1 Reverse -167 -176 -8.06341 0.254
NP_441826.1_2 Reverse -343 -357 -2.75368 0.275
NP_441826.1_2 Forward -396 -382 -4.4253 0.296
NP_441330.1_1 Forward -245 -226 -14.7502 0.242
NP_442868.1_6 Reverse -379 -389 0.57002 0.217
NP_442868.1_6 Forward -392 -382 0.0783647 0.248
NP_441251.1_8 Forward -341 -328 11.4253 0.27
NP_441612.1_2 Reverse -183 -193 9.22698 0.21
NP_441612.1_2 Forward -260 -250 6.4194 0.291
NP_442227.1_2 Forward -289 -270 -2.85214 0.283
NP_442808.1_1 Forward -391 -381 7.35439 0.0814
NP_442775.1_6 Forward -22 -3 11.8975 0.277
NP_440145.1_3 Forward -400 -381 3.14605 0.109
NP_442820.1_5 Forward -133 -114 7.27595 0.228
NP_442542.1_9 Reverse -374 -388 21.5334 0.007
NP_442050.1_1 Forward -278 -259 14.1591 0.187
NP_442050.1_1 Reverse -278 -297 9.83255 0.247
NP_440558.1_2 Forward -20 -1 3.6377 0.154
NP_440558.1_2 Reverse -339 -358 2.85105 0.164
NP_440558.1_2 Forward -269 -250 1.17943 0.183
NP_441878.1_6 Reverse -210 -220 0.766681 0.134
NP_441878.1_6 Forward -391 -381 0.668351 0.139
NP_441878.1_6 Reverse -380 -390 0.668351 0.139
NP_441036.1_8 Reverse -380 -390 6.8632 0.213
NP_441036.1_8 Forward -391 -381 6.76487 0.215
NP_442650.1_2 Reverse -150 -164 3.44117 0.202
NP_441557.1_5 Forward -390 -381 10.2261 0.0144
NP_441557.1_5 Reverse -381 -390 10.1278 0.0188
NP_442267.1_4 Reverse -311 -330 5.211 0.198
NP_442066.2_4 Forward -358 -339 -3.83545 0.223
NP_441433.1_8 Reverse -205 -224 -2.75381 0.27
NP_442965.1_2 Reverse -194 -213 -7.57203 0.273
NP_441037.1_4 Reverse -379 -389 6.14821 0.278
NP_441633.1_3 Reverse -386 -399 7.59077 0.0446
NP_440136.1_2 Forward -389 -382 6.23397 0.171
NP_440136.1_2 Reverse -382 -389 6.13563 0.193
NP_442590.1_10 Reverse -301 -320 3.53937 0.29
NP_442468.1_2 Forward -67 -48 11.6025 0.151
NP_442998.1_10 Forward -388 -381 15.5754 0.0102
NP_442998.1_10 Reverse -383 -390 5.74231 0.255
NP_440299.1_1 Forward -394 -381 7.49186 0.112
NP_441799.1_1 Reverse -377 -391 8.65209 0.109
NP_441799.1_1 Forward -394 -380 6.19383 0.179
NP_441799.1_1 Reverse -163 -177 3.93223 0.274
NP_441799.1_4 Forward -259 -240 -4.22878 0.203
NP_441007.1_10 Reverse -376 -389 8.27909 0.115
NP_441435.1_6 Forward -351 -332 3.34271 0.259
NP_442333.2_5 Reverse -332 -351 -15.6352 0.299
NP_440256.1_1 Forward -393 -374 6.58763 0.0296
NP_441559.1_8 Forward -22 -8 -7.08024 0.283
NP_441559.1_8 Reverse -332 -346 -7.47356 0.294
NP_440915.1_6 Forward -394 -380 0.982901 0.148
NP_440997.1_3 Forward -396 -377 10.1275 0.268
NP_440717.1_2 Reverse -174 -193 -10.522 0.245
NP_440215.1_10 Reverse -316 -335 14.0608 0.25
NP_440749.1_1 Forward -220 -201 1.47442 0.257
NP_442866.1_1 Forward -363 -344 -7.27704 0.266
NP_441464.1_10 Reverse -309 -323 12.6843 0.201
NP_440306.1_4 Forward -179 -160 8.65258 0.299
NP_441417.1_8 Reverse -245 -264 12.7825 0.282
NP_442993.1_1 Reverse -211 -227 -1.02311 0.0862
NP_442993.1_1 Reverse -381 -397 -7.0213 0.146
NP_442386.1_9 Reverse -1 -10 7.86578 0.215
NP_442386.1_9 Forward -221 -212 5.21086 0.262
NP_440570.1_5 Reverse -207 -226 -0.4922 0.262
NP_441340.1_5 Reverse -382 -389 6.13563 0.175
NP_441340.1_5 Forward -389 -382 5.93897 0.198
NP_441947.1_10 Forward -360 -342 8.7706 0.182
NP_440168.1_9 Reverse -240 -259 -2.0655 0.28
NP_440327.1_6 Reverse -262 -281 2.75272 0.29
NP_440059.1_3 Forward -21 -2 13.6666 0.17
NP_442240.1_2 Reverse -308 -327 -12.9802 0.163
NP_442240.1_2 Reverse -232 -251 -20.8467 0.297
NP_440586.1_8 Reverse -382 -389 11.4451 0.0645
NP_440586.1_8 Forward -259 -252 10.7568 0.128
NP_442251.1_6 Forward -389 -382 12.0355 0.0627
NP_440192.1_5 Reverse -300 -319 3.14605 0.292
NP_441262.1_3 Reverse -381 -388 14.7888 0.0223
NP_440027.1_3 Reverse -381 -399 2.96833 0.282
NP_443051.1_1 Reverse -380 -389 9.93116 0.0146
NP_443051.1_1 Forward -391 -382 0.688044 0.134
NP_440408.1_7 Forward -390 -371 9.43923 0.259
NP_440439.1_1 Reverse -378 -391 3.65753 0.11
NP_440439.1_1 Reverse -275 -288 -1.16069 0.255
NP_439943.1_3 Reverse -237 -256 12.9791 0.265
NP_440372.1_2 Reverse -382 -389 6.72562 0.0929
NP_440372.1_2 Forward -389 -382 6.62729 0.151
NP_441138.1_5 Reverse -298 -311 12.1892 0.192
NP_440819.1_5 Reverse -164 -172 7.98423 0.228
NP_440316.1_10 Reverse -210 -220 8.1415 0.24
NP_441803.1_2 Forward -351 -332 11.8975 0.0665
NP_440267.1_2 Reverse -47 -61 14.9452 0.0955
NP_440267.1_2 Forward -265 -251 5.01387 0.285
NP_442384.1_10 Forward -390 -377 15.1623 0.0113
NP_442384.1_10 Forward -240 -227 1.00259 0.271
NP_440472.1_1 Forward -169 -150 11.6017 0.265
NP_441018.1_7 Forward -21 -2 8.16093 0.255
NP_442790.1_2 Forward -387 -368 16.8141 0.265
NP_442262.1_10 Forward -219 -212 9.47889 0.187
NP_440531.1_6 Reverse -373 -392 8.16093 0.0885
NP_440531.1_6 Reverse -335 -354 -2.45882 0.252
NP_442123.1_3 Forward -390 -371 13.6675 0.16
NP_442832.1_3 Forward -397 -378 12.7825 0.277
NP_441640.1_8 Forward -219 -200 -6.09707 0.296
NP_442065.1_2 Forward -41 -28 16.2433 0.234
NP_440297.1_9 Reverse -212 -222 -0.118297 0.282
NP_440297.1_9 Forward -219 -209 -0.314959 0.282
NP_440297.1_9 Reverse -252 -262 -0.609952 0.292
NP_440350.1_5 Reverse -310 -329 2.26107 0.158
NP_440350.1_5 Reverse -312 -331 -5.40875 0.289
NP_440350.1_5 Reverse -309 -328 -6.68705 0.297
NP_440894.1_10 Reverse -332 -351 7.17762 0.208
NP_442129.1_6 Reverse -177 -196 12.8799 0.299
NP_440999.1_9 Reverse -377 -391 -3.63866 0.299
NP_440888.1_2 Forward -358 -344 12.487 0.0442
NP_440600.1_4 Reverse -373 -391 -5.68405 0.282
NP_441543.1_2 Forward -259 -250 9.73449 0.0818
NP_441543.1_2 Reverse -382 -391 7.47288 0.117
NP_441543.1_2 Forward -389 -380 6.19458 0.153
NP_442845.1_2 Forward -396 -382 3.8345 0.275
NP_441304.1_10 Forward -229 -220 14.7494 0.164
NP_443064.1_6 Forward -390 -380 9.75513 0.199
NP_442578.1_7 Reverse -382 -389 5.93897 0.183
NP_440710.1_1 Reverse -373 -391 -9.32229 0.297
NP_440071.1_4 Forward -283 -264 17.109 0.234
NP_441462.1_2 Forward -390 -380 10.5014 0.00824
NP_441462.1_2 Reverse -381 -391 2.14332 0.0801
NP_442204.1_1 Reverse -377 -388 9.49844 0.0759
NP_440544.1_5 Forward -190 -183 14.5681 0.264
NP_441351.1_8 Reverse -209 -228 3.44104 0.232
NP_440516.1_2 Forward -396 -378 -0.7675 0.264
NP_440516.1_8 Reverse -381 -390 15.6344 0.00582
NP_440516.1_8 Forward -390 -381 7.47288 0.0581
NP_442428.1_5 Forward -389 -382 6.13563 0.209
NP_442428.1_5 Reverse -382 -389 6.0373 0.212
NP_442120.1_10 Forward -182 -163 -6.88371 0.217
NP_442120.1_10 Reverse -2 -21 -13.0786 0.28
NP_442120.1_10 Reverse -211 -230 -15.9302 0.296
NP_440673.1_3 Forward -388 -381 12.4288 0.0426
NP_440673.1_3 Forward -356 -349 6.72562 0.277
NP_440718.1_2 Forward -327 -308 12.9791 0.221
NP_441052.1_2 Reverse -381 -391 10.3048 0.0289
NP_441052.1_2 Forward -358 -348 5.5849 0.111
NP_441052.1_2 Forward -260 -250 1.94665 0.221
NP_441052.1_2 Forward -390 -380 0.668351 0.256
NP_442219.1_9 Reverse -382 -391 7.96454 0.0696
NP_440436.1_4 Reverse -382 -391 13.9623 0.0193
NP_440436.1_4 Forward -389 -380 5.9975 0.174
NP_441884.1_9 Forward -393 -374 -14.1602 0.138
NP_440314.1_3 Reverse -50 -66 13.9232 0.243
NP_441719.1_4 Reverse -382 -389 6.72562 0.093
NP_441719.1_4 Forward -389 -382 6.62729 0.151
NP_441004.1_1 Reverse -343 -362 -9.24366 0.206
NP_441004.1_2 Reverse -157 -176 -0.885524 0.259
NP_442366.1_3 Reverse -380 -398 -3.6191 0.253
NP_441437.1_1 Forward -389 -370 9.53756 0.264
NP_440296.1_10 Forward -393 -374 -12.7836 0.269
NP_441115.1_4 Reverse -380 -398 12.0147 0.119
NP_442206.1_1 Reverse -256 -275 -14.1602 0.267
NP_440328.1_4 Reverse -225 -244 8.94757 0.106
NP_443054.1_2 Reverse -215 -229 7.07942 0.169
NP_443054.1_2 Forward -229 -215 5.70279 0.225
NP_443054.1_2 Reverse -165 -179 3.73617 0.24
NP_441851.1_10 Forward -391 -381 6.07655 0.187
NP_441851.1_10 Forward -139 -129 6.07655 0.187
NP_442001.1_2 Reverse -1 -20 16.7149 0.22
NP_442011.1_1 Reverse -256 -275 -0.4922 0.268
NP_442856.1_7 Reverse -372 -391 1.76941 0.167
NP_442515.1_1 Forward -391 -377 1.57289 0.155
NP_442515.1_1 Forward -260 -246 -2.65535 0.277
NP_440165.1_5 Reverse -380 -399 -7.4737 0.265
NP_441349.1_10 Forward -400 -381 5.80098 0.0408
NP_442314.1_1 Reverse -271 -289 2.47742 0.231
NP_440432.1_9 Forward -389 -374 3.51981 0.0897
NP_441994.1_2 Reverse -321 -338 20.4857 0.279
NP_439960.1_10 Forward -283 -265 2.0841 0.187
NP_440431.1_3 Reverse -6 -25 -6.68705 0.195
NP_442450.1_5 Forward -63 -53 11.7798 0.115
NP_442006.1_2 Forward -283 -266 -16.2841 0.247
NP_442006.1_2 Reverse -273 -290 -16.8741 0.265
NP_441570.1_1 Forward -390 -372 -7.749 0.0949
NP_441570.1_1 Reverse -381 -399 -17.6804 0.287
NP_440078.1_10 Forward -358 -339 9.14423 0.196
NP_441078.1_4 Forward -390 -381 9.93116 0.0203
NP_441078.1_4 Reverse -381 -390 9.83282 0.0226
NP_440793.1_1 Reverse -322 -336 18.2885 0.173
NP_441091.1_5 Reverse -333 -352 2.3594 0.29
NP_440526.1_3 Reverse -382 -393 8.71129 0.116
NP_441432.1_8 Reverse -348 -357 11.9961 0.0519
NP_441432.1_8 Reverse -380 -389 7.17789 0.102
NP_441432.1_8 Forward -391 -382 7.07956 0.105
NP_441333.1_1 Reverse -322 -332 16.0703 0.164
NP_442320.1_2 Reverse -310 -329 14.3558 0.26
NP_441732.1_2 Reverse -377 -393 -16.7561 0.195
NP_440313.1_5 Forward -235 -217 13.293 0.214
NP_441945.1_10 Reverse -342 -361 11.7992 0.235
NP_441945.1_10 Forward -352 -333 7.37428 0.284
NP_442407.1_9 Reverse -251 -270 15.5349 0.288
NP_442751.1_1 Reverse -257 -276 15.2663 0.248
NP_441023.1_1 Forward -240 -222 12.8022 0.233
NP_440713.1_4 Forward -169 -150 9.53756 0.143
NP_442489.1_7 Forward -390 -381 10.6195 0.00984
NP_442489.1_7 Reverse -381 -390 10.3245 0.0193
NP_442489.1_7 Forward -176 -167 -1.77023 0.247
NP_442489.1_7 Forward -397 -388 -1.96689 0.28
NP_442489.1_7 Reverse -388 -397 -2.16355 0.295
NP_440757.1_7 Reverse -200 -218 -2.3408 0.276
NP_440559.1_1 Reverse -382 -391 7.96454 0.0739
NP_440559.1_1 Forward -389 -380 5.40793 0.14
NP_441659.2_8 Reverse -381 -391 14.828 0.00801
NP_441659.2_8 Forward -390 -380 11.3864 0.0184
NP_441092.1_5 Reverse -186 -205 15.0747 0.245
NP_442913.1_10 Reverse -372 -391 6.88262 0.0577
NP_440335.1_9 Forward -316 -298 9.26226 0.298
NP_442346.1_5 Reverse -380 -390 14.9263 0.00941
NP_442346.1_5 Forward -391 -381 6.96153 0.187
NP_442346.1_5 Reverse -210 -220 5.5849 0.238
NP_440545.1_3 Forward -394 -377 2.69378 0.0961
NP_440459.1_2 Forward -360 -343 11.5436 0.173
NP_441653.1_3 Reverse -308 -322 15.1426 0.254
NP_441943.1_8 Forward -237 -218 -12.6852 0.261
NP_442551.1_4 Reverse -280 -295 -3.36336 0.287
NP_442551.1_4 Forward -268 -253 -3.56002 0.292
NP_442754.1_5 Reverse -332 -351 23.4997 0.0218
NP_441833.1_4 Forward -389 -382 14.1004 0.0258
NP_441833.1_4 Reverse -382 -389 6.13563 0.198
NP_441895.1_2 Forward -321 -302 -8.16202 0.166
NP_442162.1_9 Forward -389 -382 6.62729 0.142
NP_442162.1_9 Reverse -382 -389 6.52896 0.178
NP_442140.1_3 Reverse -382 -392 10.7964 0.0902
NP_442140.1_3 Forward -219 -209 7.94484 0.124
NP_440875.1_9 Forward -388 -378 13.5309 0.0677
NP_442547.1_7 Forward -361 -342 11.877 0.243
NP_441813.1_5 Reverse -379 -389 8.33817 0.047
NP_442089.1_6 Reverse -307 -326 7.96426 0.185
NP_440590.1_4 Reverse -382 -395 2.2809 0.0939
NP_440590.1_4 Forward -389 -376 0.412608 0.157
NP_442497.1_10 Forward -389 -380 7.86621 0.0695
NP_442497.1_10 Reverse -382 -391 0.589713 0.153
NP_440821.1_4 Forward -392 -382 -0.314959 0.251
NP_441239.1_9 Forward -222 -210 6.72548 0.178
NP_441239.1_9 Reverse -379 -391 3.18557 0.292
NP_441017.1_6 Forward -224 -210 11.307 0.273
NP_440354.1_7 Reverse -375 -393 7.00065 0.278
NP_440546.1_4 Reverse -381 -391 8.00989 0.209
NP_440462.1_6 Reverse -379 -389 9.12481 0.0498
NP_442465.1_8 Forward -262 -243 22.418 0.0186
NP_440868.1_4 Reverse -377 -389 9.97041 0.0405
NP_440401.1_9 Forward -323 -316 14.5917 0.287
NP_441269.1_6 Reverse -241 -259 12.9005 0.221
NP_441474.1_1 Forward -308 -289 -0.984623 0.256
NP_442402.1_2 Forward -177 -163 11.897 0.272
NP_442402.1_4 Forward -198 -179 -4.72118 0.229
NP_442402.1_10 Reverse -131 -141 10.6976 0.282
NP_441084.1_6 Reverse -379 -393 13.9981 0.114
NP_441084.1_6 Forward -312 -298 13.6102 0.125
NP_441084.1_6 Reverse -340 -354 10.7015 0.231
NP_440653.1_10 Forward -357 -338 10.6192 0.15
NP_441843.2_9 Forward -388 -370 11.5619 0.205
NP_440843.1_8 Reverse -211 -230 13.0775 0.297
NP_441811.1_1 Reverse -258 -277 5.60432 0.28
NP_441811.1_8 Reverse -245 -259 14.8476 0.162
NP_442273.1_10 Reverse -40 -58 7.98396 0.243
NP_442679.1_1 Reverse -32 -51 -1.47551 0.233
NP_442679.1_1 Forward -341 -322 -5.60541 0.293
NP_442829.1_2 Forward -326 -310 10.0738 0.287
NP_442837.1_3 Forward -389 -382 6.13563 0.25
NP_442837.1_3 Reverse -382 -389 5.93897 0.265
NP_441760.1_4 Reverse -313 -331 10.5406 0.235
NP_440160.1_2 Reverse -1 -20 2.26107 0.217
NP_442053.1_1 Forward -390 -381 9.34117 0.0666
NP_442053.1_1 Reverse -381 -390 8.55452 0.0784
NP_440505.1_3 Reverse -379 -389 15.9097 0.00857
NP_440505.1_3 Reverse -6 -16 8.63316 0.138
NP_440520.1_1 Reverse -264 -283 -5.31042 0.289
NP_440914.1_1 Forward -390 -380 14.7634 0.00997
NP_440914.1_1 Reverse -2 -12 9.10306 0.186
NP_440914.1_1 Reverse -381 -391 7.83437 0.219
NP_441011.1_8 Forward -389 -380 6.8829 0.18
NP_442533.1_6 Forward -390 -381 7.66954 0.0897
NP_442533.1_6 Reverse -381 -390 7.37455 0.0898
NP_442533.1_6 Forward -220 -211 3.7363 0.204
NP_442533.1_6 Reverse -343 -352 1.57302 0.294
NP_439944.1_9 Reverse -382 -392 8.53483 0.107
NP_441749.1_7 Reverse -160 -179 8.06259 0.292
NP_441028.1_6 Reverse -221 -231 5.48612 0.255
NP_441028.1_6 Reverse -328 -338 5.19112 0.265
NP_441527.1_4 Forward -341 -322 -2.33998 0.156
NP_441527.1_4 Reverse -41 -60 -12.9396 0.296
NP_441527.1_5 Reverse -6 -25 14.1533 0.287
NP_440115.1_6 Reverse -378 -388 13.0581 0.0818
NP_440007.1_9 Reverse -4 -18 4.42448 0.267
NP_440007.1_9 Reverse -207 -221 2.06454 0.281
NP_441680.1_4 Forward -152 -133 -0.983855 0.256
NP_441961.1_4 Forward -228 -209 8.75091 0.259
NP_441170.1_2 Forward -24 -5 2.45773 0.246
NP_441106.1_1 Reverse -380 -389 8.65285 0.0522
NP_441106.1_1 Forward -391 -382 6.29291 0.0927
NP_441869.1_4 Forward -204 -185 12.6841 0.196
NP_442588.1_1 Forward -354 -335 10.9142 0.177
NP_441286.1_1 Reverse -380 -392 0.923956 0.102
NP_441286.1_1 Forward -391 -379 -3.79593 0.146
NP_441286.1_1 Forward -221 -209 -6.45087 0.265
NP_442674.1_2 Reverse -116 -135 6.68596 0.298
NP_440670.1_8 Forward -390 -381 16.5193 0.00214
NP_440670.1_8 Reverse -381 -390 9.4395 0.0559
NP_440886.1_7 Reverse -387 -397 5.28945 0.188
NP_440886.1_7 Reverse -380 -390 4.10949 0.253
NP_440828.1_4 Forward -362 -343 -2.16459 0.214
NP_442614.1_2 Reverse -381 -395 9.43936 0.242
NP_442614.1_2 Reverse -343 -357 8.84938 0.244
NP_442717.1_8 Forward -324 -305 16.6165 0.116
NP_442072.1_9 Forward -62 -44 -21.9087 0.215
NP_442072.1_9 Forward -398 -380 -22.007 0.216
NP_441808.1_8 Reverse -239 -258 6.29264 0.289
NP_441021.1_1 Forward -22 -3 -10.7186 0.246
NP_441463.1_3 Forward -21 -2 9.14423 0.0481
NP_441463.1_3 Forward -368 -349 -3.14714 0.17
NP_441626.1_2 Forward -389 -382 6.0373 0.212
NP_441626.1_2 Reverse -382 -389 6.0373 0.212
NP_442365.1_5 Reverse -275 -294 7.57094 0.25
NP_442615.1_1 Forward -399 -381 4.24738 0.048
NP_441962.1_4 Reverse -344 -363 -9.34199 0.215
NP_441962.1_4 Reverse -162 -181 -13.8652 0.279
NP_440387.1_1 Reverse -381 -397 -2.10475 0.146
NP_441431.1_2 Reverse -378 -392 5.99717 0.281
NP_442020.1_1 Forward -250 -231 0.883656 0.255
NP_441993.1_1 Reverse -167 -186 4.96787 0.21
NP_440114.1_10 Forward -390 -376 13.7659 0.0502
NP_440114.1_10 Reverse -211 -225 5.80112 0.292
NP_440737.1_1 Reverse -167 -186 12.6841 0.142
NP_442323.1_7 Forward -22 -3 14.3549 0.076
NP_442324.1_5 Forward -399 -380 14.0599 0.207
NP_440725.1_4 Reverse -213 -232 1.27776 0.226
NP_440287.1_6 Forward -399 -380 11.8975 0.127
NP_439988.1_7 Forward -388 -374 12.9786 0.292
NP_441237.1_9 Reverse -382 -392 10.7964 0.218
NP_442930.1_1 Forward -29 -19 9.321 0.287
NP_441133.1_1 Reverse -306 -325 12.8808 0.252
NP_440457.1_1 Reverse -275 -287 6.33216 0.123
NP_440457.1_1 Reverse -207 -219 6.33216 0.123
NP_442509.1_9 Reverse -167 -177 9.91099 0.192
NP_442509.1_9 Forward -390 -380 7.94438 0.195
NP_442582.1_8 Reverse -317 -335 14.0805 0.213
NP_441440.1_8 Reverse -173 -186 16.1456 0.299
NP_440554.1_4 Forward -389 -379 8.4365 0.0749
NP_441885.1_5 Reverse -381 -391 11.3864 0.00668
NP_441885.1_5 Forward -390 -380 1.65166 0.106
NP_440628.1_1 Forward -332 -322 15.8039 0.248
NP_440478.1_9 Reverse -147 -166 7.57094 0.292
NP_441428.1_8 Forward -360 -341 3.24438 0.251
NP_442341.1_9 Reverse -379 -393 11.1104 0.13
NP_441756.1_5 Reverse -272 -291 -2.75381 0.283
NP_441173.1_9 Forward -172 -164 9.75379 0.284
NP_442395.2_4 Reverse -1 -20 10.0284 0.103
NP_442534.1_7 Forward -398 -379 10.2259 0.208
NP_442534.1_8 Reverse -271 -290 16.0274 0.142
NP_443000.1_7 Reverse -379 -389 10.5014 0.0345
NP_443000.1_7 Forward -392 -382 0.57002 0.294
NP_442513.1_6 Forward -347 -328 10.0284 0.296
NP_441842.1_1 Forward -388 -375 15.555 0.0619
NP_441842.1_10 Forward -275 -261 9.34103 0.192
NP_441842.1_10 Reverse -374 -388 8.94771 0.203
NP_440275.1_3 Reverse -379 -389 6.46988 0.105
NP_440275.1_3 Forward -392 -382 5.19158 0.161
NP_442932.1_7 Reverse -309 -328 11.8975 0.251
NP_440091.1_1 Forward -394 -382 8.88877 0.0567
NP_443010.1_10 Reverse -378 -395 5.18664 0.207
NP_441207.1_7 Forward -333 -319 15.3546 0.179
NP_440175.1_7 Reverse -303 -321 15.3162 0.128
NP_440175.1_7 Forward -21 -3 8.67997 0.292
NP_442495.1_4 Forward -236 -226 12.6647 0.218
NP_442591.1_1 Reverse -138 -157 13.9625 0.198
NP_440149.1_8 Forward -226 -207 -4.03212 0.201
NP_440149.1_8 Reverse -167 -186 -6.49039 0.253
NP_442214.1_1 Forward -279 -260 10.8159 0.25
NP_440216.1_1 Forward -390 -376 8.65272 0.00592
NP_440216.1_1 Reverse -231 -245 -4.4253 0.111
NP_440216.1_1 Reverse -381 -395 -10.2268 0.145
NP_440216.1_1 Forward -397 -383 -11.8985 0.228
NP_440216.1_9 Forward -319 -310 5.70292 0.29
NP_440216.1_9 Reverse -213 -222 5.50626 0.292
NP_440172.1_1 Forward -390 -380 8.04317 0.0692
NP_440172.1_1 Reverse -381 -391 5.19158 0.149
NP_440172.1_1 Forward -176 -166 1.84832 0.294
NP_442371.1_1 Reverse -181 -191 16.9908 0.125
NP_442371.1_1 Forward -378 -368 13.5492 0.206
NP_442015.1_10 Forward -21 -8 1.69091 0.204
NP_442015.1_10 Reverse -377 -390 1.19926 0.21
NP_441045.1_6 Reverse -264 -282 15.948 0.284
NP_441757.1_2 Reverse -216 -234 8.08229 0.276
NP_441111.1_7 Forward -389 -381 8.96754 0.0463
NP_441111.1_7 Reverse -382 -390 8.86921 0.0589
NP_442379.1_10 Reverse -45 -62 0.432165 0.223
NP_441766.1_2 Forward -390 -381 7.86621 0.0703
NP_441766.1_2 Reverse -381 -390 7.66954 0.0723
NP_440416.1_9 Reverse -224 -243 -16.3235 0.212
NP_443052.1_9 Forward -258 -239 -0.0988766 0.204
NP_440261.1_5 Forward -389 -376 4.8375 0.0516
NP_440261.1_5 Forward -219 -206 -4.9956 0.183
NP_440988.1_10 Forward -360 -346 5.77014 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCGGTGATTGACGATCGCCTGCAGGGAGAAATGAGAATTACCGTCATTGCCACGGGCTTCAACGGTGAAAAAGAAAAACCCCAAGCAAAAACCAGCAGCAAACCTGTGCTCAGCGGCCCCCCTGCCGGAGTGGAGACAGTGCCATCAACAACAACACCAGAAGATCCCCTAGGGGAAATTCCCATGGCCCCGGAGTTAGACATTCCTGATTTTCTCCAGAAGCGGCGTTTTCCCCGCCGTTAGGTTCCCCAGGATTACTGGTGGGAACCAAATAATTTGACCAAGAAAGTCTCTTAGGCTACACTACTAACCTCTAATTGTTGTCTCAACCTAAAGAGGTTGATCGATTTGCGCTTTTTGTTTGCTAGCCTACTAATTCCCTTGGTATTGCCTTTGCCG

CDS

GTGATGGCCCAATCCGCCACTTTCTATGGCAATCAGTTTGTAGGGCGGAAGATGGCCAACGGCCAAGTCTATAACCACGGTCGCATGGTGGCAGCCCACCCCAGTCTGCCCCTAGGAACCAGAGTTAGGGTAACCAATCGCCGTACGGGGAAATCGGTCGTAGTGACGGTGAGTGACCGTTGTAACTGCTCCATCGACCTCAGCCGTTCTGCTTTCCAACAAATTGCTAACCCCCGCAAAGGCCGGGTTCCCGTAAGCATTACCCGTCTCTAG

Protein

MMAQSATFYGNQFVGRKMANGQVYNHGRMVAAHPSLPLGTRVRVTNRRTGKSVVVTVSDRCNCSIDLSRSAFQQIANPRKGRVPVSITRL