Your browser is old and dusty. Try Google Chrome!

Details for ssl3044

ORF ssl3044
Accession NP_441697.1
Symbol
Category Soluble electron carriers
Definition probable ferredoxin
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -206 -220 -0.197071 0.223
NP_441061.1_2 Reverse -346 -360 -1.18038 0.252
NP_440795.1_7 Forward -237 -230 14.6904 0.0123
NP_440795.1_7 Reverse -230 -237 14.6904 0.0123
NP_442100.1_1 Forward -148 -129 15.517 0.103
NP_441418.1_6 Forward -238 -219 -17.7001 0.0823
NP_443032.1_3 Reverse -324 -343 16.3224 0.28
NP_441453.1_4 Forward -238 -230 16.539 0.00633
NP_441453.1_4 Reverse -95 -103 14.8674 0.00947
NP_441453.1_4 Reverse -229 -237 7.8859 0.0536
NP_441453.1_4 Forward -104 -96 6.80426 0.121
NP_441623.1_1 Forward -85 -67 1.59244 0.211
NP_441623.1_1 Forward -84 -66 -0.275845 0.228
NP_440226.1_1 Reverse -229 -248 16.9124 0.0205
NP_440226.1_1 Forward -238 -219 12.0942 0.0476
NP_440813.1_1 Reverse -223 -237 22.2217 0.0176
NP_440150.1_6 Reverse -333 -352 3.73603 0.245
NP_440150.1_6 Reverse -92 -111 1.47442 0.288
NP_440996.1_5 Reverse -297 -306 16.8124 0.146
NP_442287.1_1 Reverse -212 -222 14.7292 0.256
NP_442173.1_1 Reverse -230 -238 15.4574 0.00633
NP_442173.1_1 Forward -103 -95 13.8841 0.0225
NP_442173.1_1 Reverse -96 -104 12.0158 0.0316
NP_442173.1_1 Forward -237 -229 8.27922 0.101
NP_442752.1_4 Forward -238 -231 13.8055 0.0199
NP_442752.1_4 Forward -104 -97 13.8055 0.0199
NP_443027.1_4 Forward -240 -230 13.2547 0.0521
NP_441812.1_3 Reverse -228 -242 6.78443 0.291
NP_442975.1_10 Reverse -225 -239 3.93223 0.249
NP_440784.1_7 Forward -237 -230 15.9687 0.0123
NP_440784.1_7 Reverse -230 -237 15.9687 0.0123
NP_440784.1_7 Forward -103 -96 6.23397 0.241
NP_440784.1_7 Reverse -96 -103 6.13563 0.241
NP_442118.1_5 Reverse -153 -167 22.8117 0.118
NP_440061.1_9 Forward -106 -92 7.07881 0.219
NP_440110.1_8 Forward -222 -203 6.58763 0.131
NP_441054.1_2 Forward -237 -218 14.5524 0.164
NP_442062.1_8 Forward -238 -228 11.1898 0.0493
NP_442062.1_8 Forward -104 -94 7.94484 0.0848
NP_442062.1_8 Reverse -95 -105 7.15819 0.107
NP_442062.1_8 Reverse -339 -349 2.92996 0.292
NP_441859.1_3 Forward -105 -86 3.04693 0.25
NP_441859.1_7 Forward -175 -156 5.60432 0.245
NP_440304.1_4 Forward -240 -230 10.8948 0.051
NP_440304.1_4 Forward -12 -2 5.09324 0.229
NP_442242.1_4 Forward -237 -230 14.3954 0.0124
NP_442242.1_4 Reverse -230 -237 14.3954 0.0124
NP_441781.1_7 Forward -288 -269 -2.65548 0.289
NP_440011.1_1 Reverse -7 -26 16.6174 0.153
NP_440916.1_1 Forward -75 -61 10.9143 0.206
NP_439923.1_10 Forward -160 -141 14.6508 0.18
NP_441208.1_9 Reverse -67 -81 7.57108 0.221
NP_441594.1_3 Forward -219 -200 3.83436 0.176
NP_441594.1_6 Forward -357 -338 0.687771 0.282
NP_442276.1_2 Forward -366 -347 8.45592 0.285
NP_440132.1_1 Forward -222 -204 10.0489 0.223
NP_441925.1_4 Reverse -203 -222 -16.8158 0.285
NP_440330.1_4 Reverse -230 -249 18.9817 0.181
NP_440856.1_4 Reverse -88 -107 -4.6221 0.265
NP_441083.1_3 Reverse -242 -252 12.6642 0.248
NP_441083.1_5 Reverse -229 -239 10.0098 0.0214
NP_441083.1_5 Forward -104 -94 6.96153 0.0717
NP_441083.1_5 Forward -238 -228 1.65166 0.2
NP_441083.1_5 Reverse -95 -105 0.865012 0.218
NP_442827.1_8 Reverse -221 -240 -2.16459 0.27
NP_442115.2_7 Forward -287 -270 7.512 0.218
NP_441434.1_7 Forward -236 -222 2.85119 0.268
NP_441738.1_2 Reverse -231 -238 15.28 0.0102
NP_441738.1_2 Reverse -97 -104 15.28 0.0102
NP_441955.1_8 Forward -110 -93 6.72535 0.281
NP_440209.1_1 Forward -238 -230 18.1123 0.00295
NP_440209.1_1 Reverse -229 -237 15.1624 0.00583
NP_440209.1_1 Forward -104 -96 8.57422 0.0425
NP_440178.1_7 Forward -289 -270 -20.7484 0.199
NP_441716.1_1 Reverse -180 -194 4.91614 0.246
NP_442111.1_4 Reverse -94 -108 8.25939 0.0773
NP_442111.1_4 Reverse -228 -242 4.03116 0.223
NP_441215.1_1 Reverse -53 -72 11.5042 0.1
NP_441387.1_8 Reverse -288 -307 16.281 0.18
NP_440906.1_5 Forward -237 -230 15.8704 0.0124
NP_440906.1_5 Reverse -230 -237 15.8704 0.0124
NP_440906.1_5 Forward -381 -374 8.79057 0.149
NP_440906.1_5 Forward -103 -96 6.23397 0.234
NP_440906.1_5 Reverse -96 -103 6.13563 0.241
NP_442596.1_1 Forward -237 -223 18.4851 0.179
NP_440747.1_10 Forward -241 -229 -2.4193 0.0434
NP_440747.1_10 Reverse -92 -104 -2.4193 0.0434
NP_440747.1_10 Reverse -226 -238 -2.61596 0.0556
NP_440747.1_10 Forward -107 -95 -12.2524 0.254
NP_441130.1_10 Reverse -227 -241 9.43936 0.125
NP_441130.1_10 Reverse -93 -107 4.71948 0.27
NP_441486.1_1 Forward -107 -93 -3.54032 0.179
NP_441486.1_9 Forward -184 -165 11.2092 0.266
NP_442634.1_4 Reverse -277 -291 -5.21195 0.241
NP_442760.1_5 Forward -196 -184 17.2463 0.208
NP_440470.1_5 Reverse -119 -138 8.83258 0.243
NP_440403.1_4 Reverse -220 -239 -6.78538 0.236
NP_440057.1_6 Reverse -379 -398 13.763 0.262
NP_443018.1_3 Forward -237 -230 14.8871 0.0123
NP_443018.1_3 Reverse -230 -237 14.8871 0.0123
NP_443018.1_3 Reverse -96 -103 11.7405 0.0655
NP_443018.1_3 Forward -338 -331 10.2655 0.107
NP_443018.1_3 Forward -103 -96 5.44732 0.193
NP_441634.1_8 Forward -240 -226 -2.85201 0.295
NP_441634.1_8 Reverse -169 -183 -3.63866 0.295
NP_440376.1_1 Forward -238 -229 9.73449 0.0365
NP_440376.1_1 Reverse -229 -238 9.63616 0.0385
NP_440376.1_1 Forward -104 -95 5.89959 0.116
NP_440376.1_1 Forward -288 -279 4.81794 0.149
NP_440376.1_1 Reverse -339 -348 4.52295 0.156
NP_440376.1_1 Reverse -84 -93 1.86802 0.238
NP_440376.1_1 Reverse -95 -104 -0.0986038 0.285
NP_441588.1_4 Reverse -97 -107 7.05986 0.178
NP_442687.1_7 Reverse -228 -238 13.0581 0.0591
NP_442687.1_7 Forward -105 -95 12.5664 0.0712
NP_442687.1_7 Forward -349 -339 6.37155 0.171
NP_442687.1_7 Forward -289 -279 5.68323 0.189
NP_442191.1_4 Reverse -96 -110 15.1623 0.0673
NP_442191.1_4 Reverse -56 -70 12.6414 0.198
NP_442589.1_3 Reverse -274 -293 18.4065 0.132
NP_440066.1_5 Reverse -213 -232 9.63507 0.251
NP_442485.1_3 Forward -350 -331 1.86774 0.216
NP_442485.1_3 Reverse -169 -188 1.17943 0.232
NP_441846.1_10 Forward -239 -220 -14.0619 0.216
NP_440533.1_9 Reverse -229 -248 2.3594 0.28
NP_442658.1_1 Reverse -227 -237 14.9258 0.0188
NP_442658.1_1 Forward -240 -230 14.2375 0.0237
NP_442658.1_1 Forward -106 -96 7.35439 0.214
NP_442658.1_1 Reverse -93 -103 5.48612 0.265
NP_442198.1_3 Reverse -86 -105 6.68596 0.251
NP_441414.1_9 Forward -238 -219 6.4893 0.0396
NP_440184.1_1 Forward -144 -125 2.01483 0.258
NP_440184.1_7 Forward -312 -293 13.5099 0.28
NP_441487.1_9 Reverse -228 -247 15.2408 0.0454
NP_441487.1_9 Forward -105 -86 0.982764 0.212
NP_441958.1_5 Forward -239 -229 12.0747 0.00222
NP_441958.1_5 Forward -105 -95 8.73149 0.0255
NP_441958.1_5 Reverse -228 -238 2.43831 0.0422
NP_441958.1_5 Reverse -94 -104 0.963343 0.12
NP_441127.1_1 Forward -255 -241 9.43936 0.275
NP_440203.1_5 Forward -342 -332 8.63269 0.29
NP_439905.1_1 Forward -237 -224 8.67241 0.232
NP_439905.1_1 Forward -149 -136 8.67241 0.232
NP_439905.1_1 Forward -338 -325 6.1158 0.299
NP_440984.1_7 Forward -243 -229 7.9644 0.16
NP_442690.1_1 Reverse -129 -148 7.37428 0.0645
NP_442911.1_1 Reverse -128 -141 17.5368 0.159
NP_441580.1_6 Reverse -218 -237 -5.21209 0.235
NP_440153.1_5 Reverse -230 -244 1.76955 0.245
NP_441591.1_10 Forward -240 -221 6.88262 0.275
NP_442536.1_8 Reverse -333 -352 13.9625 0.213
NP_443055.1_6 Forward -246 -228 8.57317 0.142
NP_443055.1_6 Forward -93 -75 -2.34152 0.294
NP_440993.1_7 Reverse -36 -50 18.1551 0.199
NP_442210.1_9 Reverse -335 -353 13.6872 0.209
NP_441099.1_5 Reverse -219 -238 -1.37718 0.107
NP_441099.1_5 Reverse -227 -246 -10.817 0.262
NP_442002.1_9 Forward -247 -240 12.4288 0.185
NP_442002.1_9 Forward -349 -342 12.2322 0.185
NP_442002.1_9 Forward -105 -98 10.7572 0.185
NP_440809.1_9 Reverse -86 -104 -8.14232 0.227
NP_441294.1_7 Forward -97 -83 9.34661 0.249
NP_441000.1_6 Reverse -94 -108 6.19444 0.0933
NP_441000.1_6 Reverse -228 -242 5.99778 0.0933
NP_441000.1_6 Forward -105 -91 -5.60527 0.285
NP_440484.1_3 Forward -240 -226 11.701 0.242
NP_440147.1_4 Forward -106 -93 14.0806 0.0279
NP_440147.1_4 Reverse -227 -240 7.59077 0.0657
NP_440147.1_4 Forward -240 -227 7.29578 0.0712
NP_440147.1_4 Reverse -93 -106 5.03416 0.139
NP_441550.1_8 Forward -240 -230 15.8108 0.0132
NP_441550.1_8 Reverse -93 -103 12.3692 0.0336
NP_441550.1_8 Forward -106 -96 7.55106 0.154
NP_441550.1_8 Reverse -227 -237 5.19112 0.26
NP_441916.1_7 Reverse -229 -239 10.6981 0.0261
NP_441916.1_7 Reverse -95 -105 9.51814 0.0338
NP_441916.1_7 Forward -238 -228 9.12481 0.0396
NP_441916.1_7 Forward -104 -94 5.09324 0.146
NP_441041.1_4 Forward -220 -201 -7.57203 0.19
NP_441041.1_4 Reverse -95 -114 -10.817 0.237
NP_441041.1_7 Forward -107 -95 11.0132 0.0864
NP_441041.1_7 Reverse -92 -104 6.34865 0.211
NP_441041.1_7 Forward -241 -229 6.25147 0.216
NP_441041.1_7 Reverse -226 -238 5.86276 0.236
NP_440569.1_8 Reverse -339 -358 6.88262 0.28
NP_440703.1_9 Forward -354 -341 20.3732 0.0529
NP_440703.1_9 Forward -252 -239 7.19687 0.266
NP_441725.1_4 Forward -243 -229 13.2736 0.0693
NP_441725.1_5 Reverse -230 -240 1.94665 0.115
NP_441725.1_5 Forward -237 -227 0.0783647 0.215
NP_441725.1_5 Reverse -340 -350 0.0783647 0.215
NP_441725.1_5 Reverse -238 -248 -0.216628 0.241
NP_439966.1_7 Reverse -227 -237 18.6624 0.00473
NP_439966.1_7 Forward -240 -230 14.3359 0.0203
NP_439966.1_7 Forward -106 -96 8.23937 0.14
NP_439966.1_9 Reverse -227 -236 9.83282 0.215
NP_439966.1_9 Forward -106 -97 0.884706 0.253
NP_442941.1_3 Reverse -230 -240 19.2529 0.00262
NP_442941.1_3 Forward -237 -227 1.35667 0.15
NP_442941.1_3 Reverse -96 -106 0.963343 0.16
NP_440289.1_2 Forward -107 -94 4.44418 0.0668
NP_440289.1_2 Reverse -226 -239 3.95252 0.0733
NP_440289.1_2 Forward -241 -228 -4.79893 0.294
NP_440289.1_2 Forward -257 -244 -4.89726 0.294
NP_440260.1_8 Reverse -336 -354 8.47561 0.154
NP_440260.1_8 Forward -370 -352 -7.45401 0.295
NP_441514.1_4 Reverse -28 -47 12.6972 0.286
NP_442281.1_1 Reverse -90 -104 11.2087 0.0497
NP_442281.1_1 Reverse -166 -180 4.52221 0.192
NP_442281.1_1 Reverse -224 -238 2.35894 0.269
NP_440177.1_9 Forward -246 -227 17.6007 0.165
NP_442256.1_2 Reverse -227 -245 1.10079 0.112
NP_440479.1_6 Forward -353 -339 12.9786 0.299
NP_440437.1_1 Forward -354 -335 -3.93378 0.248
NP_440437.1_1 Reverse -205 -224 -4.52377 0.261
NP_440647.1_9 Reverse -227 -245 11.6222 0.153
NP_442012.1_1 Forward -294 -275 0.196116 0.244
NP_441644.1_6 Reverse -229 -239 16.4008 0.00405
NP_441644.1_6 Reverse -95 -105 7.45273 0.124
NP_441644.1_6 Forward -238 -228 6.37109 0.161
NP_443049.1_6 Forward -239 -229 11.7385 0.24
NP_442501.1_2 Reverse -218 -237 -0.983855 0.222
NP_442215.1_2 Reverse -337 -353 11.0716 0.0433
NP_442215.1_2 Forward -363 -347 4.68009 0.0831
NP_442247.1_8 Forward -240 -226 12.291 0.247
NP_440253.1_2 Reverse -229 -247 5.82068 0.0889
NP_440253.1_2 Forward -238 -220 -2.83245 0.278
NP_440929.1_8 Forward -238 -229 9.93116 0.0249
NP_440929.1_8 Reverse -229 -238 9.83282 0.0254
NP_440929.1_8 Reverse -95 -104 7.17789 0.0713
NP_442933.1_10 Forward -238 -229 9.04618 0.063
NP_442933.1_10 Reverse -229 -238 8.94785 0.0643
NP_442933.1_10 Reverse -95 -104 8.06287 0.0885
NP_442933.1_10 Forward -104 -95 7.96454 0.0937
NP_441751.2_8 Reverse -230 -244 -2.95034 0.134
NP_442554.1_8 Reverse -230 -240 17.2863 0.00543
NP_442554.1_8 Forward -237 -227 4.60159 0.18
NP_442554.1_8 Reverse -96 -106 4.3066 0.189
NP_442554.1_8 Forward -103 -93 3.12662 0.239
NP_442554.1_8 Reverse -346 -356 1.84832 0.292
NP_442075.1_1 Forward -112 -93 5.30933 0.284
NP_441762.1_7 Forward -239 -227 5.15219 0.0443
NP_441762.1_7 Reverse -94 -106 3.48056 0.0676
NP_441762.1_7 Reverse -228 -240 -5.17256 0.191
NP_442142.1_4 Reverse -226 -239 9.16348 0.101
NP_442142.1_4 Forward -241 -228 2.96866 0.269
NP_442292.1_1 Reverse -230 -239 17.5026 0.00435
NP_442292.1_1 Forward -237 -228 0.786375 0.23
NP_442292.1_1 Reverse -96 -105 -0.196935 0.239
NP_442292.1_5 Reverse -335 -354 -0.983855 0.257
NP_442476.1_6 Forward -237 -223 9.14437 0.092
NP_442381.1_8 Reverse -226 -245 4.81767 0.0708
NP_442381.1_8 Forward -107 -88 -13.1769 0.267
NP_443009.1_5 Forward -239 -228 10.9729 0.0699
NP_443009.1_5 Reverse -94 -105 6.94134 0.144
NP_443009.1_5 Forward -289 -278 3.40144 0.296
NP_442301.1_2 Reverse -204 -223 5.50519 0.264
NP_441715.1_4 Reverse -230 -240 16.7946 0.0106
NP_441715.1_4 Forward -237 -227 9.7148 0.097
NP_441715.1_4 Reverse -96 -106 9.02648 0.105
NP_440158.1_1 Forward -143 -124 15.326 0.0997
NP_440158.1_8 Reverse -337 -356 17.5024 0.0986
NP_440183.1_9 Reverse -173 -192 -21.24 0.299
NP_441468.1_1 Forward -237 -230 15.8704 0.0124
NP_441468.1_1 Reverse -230 -237 15.8704 0.0124
NP_441468.1_1 Forward -103 -96 6.13563 0.209
NP_441468.1_1 Reverse -96 -103 6.0373 0.223
NP_441020.2_6 Reverse -277 -294 9.28195 0.176
NP_441020.2_6 Forward -222 -205 6.82368 0.251
NP_441020.2_6 Reverse -81 -98 6.62702 0.26
NP_441020.2_6 Forward -240 -223 6.52869 0.262
NP_441020.2_6 Reverse -227 -244 5.74204 0.291
NP_441673.1_1 Forward -238 -229 11.1111 0.0121
NP_441673.1_1 Reverse -229 -238 11.0128 0.018
NP_441673.1_1 Forward -104 -95 1.27803 0.155
NP_441673.1_1 Reverse -95 -104 1.27803 0.155
NP_441673.1_1 Forward -348 -339 -8.06341 0.254
NP_441731.1_3 Forward -112 -93 2.16274 0.195
NP_441731.1_9 Forward -184 -167 17.9351 0.201
NP_441876.1_9 Forward -72 -62 11.5826 0.275
NP_441172.1_1 Forward -294 -276 1.98577 0.258
NP_441826.1_2 Forward -354 -340 -3.93365 0.29
NP_441330.1_1 Forward -243 -224 -3.73712 0.0837
NP_442490.1_10 Forward -262 -244 11.6222 0.201
NP_441764.1_4 Reverse -126 -143 14.5652 0.132
NP_441764.1_4 Reverse -32 -49 10.4591 0.255
NP_442868.1_6 Forward -240 -230 10.4031 0.038
NP_442868.1_6 Reverse -227 -237 10.0098 0.038
NP_442868.1_6 Forward -106 -96 0.57002 0.217
NP_442868.1_6 Reverse -93 -103 -0.118297 0.264
NP_442808.1_1 Reverse -228 -238 18.8591 0.00201
NP_442808.1_1 Reverse -116 -126 3.61784 0.234
NP_442630.1_5 Reverse -296 -315 13.5691 0.263
NP_440145.1_3 Forward -248 -229 2.16274 0.12
NP_442542.1_2 Forward -106 -93 12.409 0.114
NP_442050.1_1 Reverse -272 -291 8.16093 0.253
NP_442050.1_5 Forward -240 -230 15.9091 0.0091
NP_442050.1_5 Reverse -93 -103 10.5993 0.141
NP_442050.1_5 Reverse -371 -381 10.501 0.147
NP_442342.1_9 Reverse -235 -251 7.92501 0.196
NP_442789.1_4 Forward -222 -203 -2.65548 0.241
NP_441518.1_3 Forward -248 -229 -12.9802 0.264
NP_442792.1_6 Forward -225 -206 6.58763 0.251
NP_441878.1_6 Forward -239 -229 0.766681 0.134
NP_441878.1_6 Reverse -94 -104 0.668351 0.139
NP_441878.1_6 Reverse -228 -238 0.57002 0.14
NP_441878.1_6 Forward -289 -279 -0.0199663 0.163
NP_441878.1_6 Reverse -278 -288 -7.19813 0.21
NP_441036.1_8 Reverse -228 -238 15.418 0.00944
NP_441036.1_8 Forward -105 -95 12.5664 0.0744
NP_441036.1_8 Forward -239 -229 6.07655 0.242
NP_441557.1_5 Forward -238 -229 10.8161 0.00464
NP_441557.1_5 Reverse -229 -238 10.4228 0.00915
NP_441557.1_5 Forward -104 -95 8.94785 0.0289
NP_441557.1_5 Reverse -95 -104 0.688044 0.128
NP_441445.1_1 Reverse -86 -105 1.57275 0.252
NP_441445.1_9 Forward -26 -8 18.8987 0.092
NP_441590.1_4 Forward -92 -73 3.63691 0.29
NP_442066.2_9 Reverse -225 -238 18.2105 0.0209
NP_442066.2_9 Forward -242 -229 10.639 0.154
NP_441433.1_8 Forward -24 -5 12.4875 0.147
NP_441433.1_8 Reverse -11 -30 -4.13045 0.289
NP_441433.1_8 Reverse -181 -200 -4.22878 0.29
NP_440084.1_8 Reverse -125 -139 12.0436 0.241
NP_440101.1_3 Reverse -334 -353 4.22769 0.222
NP_442183.1_1 Forward -238 -224 13.8643 0.0389
NP_442183.1_3 Reverse -380 -399 16.4199 0.241
NP_442166.1_7 Reverse -96 -110 13.5693 0.175
NP_441655.1_10 Forward -250 -232 2.47742 0.285
NP_441549.1_9 Forward -292 -274 -6.27403 0.198
NP_442170.1_5 Reverse -373 -392 -3.04881 0.267
NP_442347.1_2 Reverse -96 -105 8.94785 0.0718
NP_442347.1_2 Reverse -230 -239 3.34298 0.284
NP_441037.1_4 Forward -240 -230 7.22024 0.237
NP_442594.1_10 Forward -369 -350 7.57013 0.291
NP_442317.1_6 Reverse -224 -243 5.01433 0.24
NP_441633.1_3 Forward -95 -82 0.510939 0.122
NP_441633.1_3 Reverse -227 -240 -1.849 0.165
NP_441633.1_3 Forward -106 -93 -4.40561 0.195
NP_441633.1_3 Forward -240 -227 -6.07724 0.236
NP_440136.1_2 Forward -237 -230 15.9687 0.0123
NP_440136.1_2 Reverse -230 -237 15.9687 0.0123
NP_440136.1_2 Forward -103 -96 6.23397 0.171
NP_440136.1_2 Reverse -96 -103 6.13563 0.193
NP_440136.1_2 Forward -381 -374 4.26735 0.218
NP_442590.1_9 Reverse -329 -348 7.66927 0.25
NP_442590.1_10 Reverse -333 -352 12.8808 0.145
NP_442590.1_10 Reverse -174 -193 7.96426 0.216
NP_442998.1_10 Reverse -231 -238 15.5754 0.0102
NP_442998.1_10 Reverse -97 -104 15.5754 0.0102
NP_442998.1_10 Forward -236 -229 5.84064 0.235
NP_440899.1_3 Forward -264 -245 14.8474 0.219
NP_441799.1_1 Forward -242 -228 13.2736 0.0337
NP_441799.1_1 Reverse -91 -105 11.9953 0.0487
NP_441799.1_1 Reverse -225 -239 10.1271 0.0797
NP_441007.1_10 Reverse -274 -287 1.69091 0.203
NP_441007.1_10 Forward -243 -230 0.805932 0.216
NP_441007.1_10 Reverse -224 -237 -0.275709 0.273
NP_440256.1_1 Forward -241 -222 2.85105 0.0589
NP_440256.1_1 Reverse -92 -111 -2.36049 0.116
NP_440087.1_1 Forward -247 -228 2.94938 0.167
NP_443042.1_5 Reverse -123 -142 11.7776 0.264
NP_441559.1_3 Reverse -179 -198 18.1898 0.242
NP_441559.1_8 Forward -109 -95 -6.58858 0.279
NP_441559.1_8 Reverse -335 -349 -6.68692 0.279
NP_440915.1_6 Forward -108 -94 11.5043 0.0256
NP_440915.1_6 Reverse -225 -239 2.16287 0.124
NP_440915.1_6 Forward -242 -228 -0.787057 0.209
NP_442158.1_4 Reverse -73 -83 11.7798 0.264
NP_442158.1_4 Reverse -343 -353 10.6981 0.283
NP_442555.1_9 Forward -25 -6 14.2574 0.269
NP_442866.1_1 Reverse -334 -353 12.5858 0.0753
NP_441464.1_10 Forward -224 -210 8.25939 0.286
NP_440695.1_5 Forward -220 -201 -1.27885 0.284
NP_441199.1_10 Reverse -128 -146 12.7979 0.236
NP_442386.1_9 Reverse -228 -237 17.6988 0.0144
NP_442386.1_9 Forward -239 -230 6.39082 0.219
NP_442386.1_9 Forward -105 -96 5.9975 0.23
NP_441340.1_5 Forward -237 -230 15.6737 0.0124
NP_441340.1_5 Reverse -230 -237 15.6737 0.0124
NP_441340.1_5 Forward -103 -96 13.5105 0.0314
NP_441340.1_5 Reverse -96 -103 5.84064 0.208
NP_440168.1_9 Reverse -218 -237 -3.44213 0.296
NP_440168.1_9 Reverse -227 -246 -3.83545 0.296
NP_441248.1_9 Reverse -27 -46 16.9115 0.294
NP_439976.1_4 Reverse -216 -235 4.81688 0.278
NP_440161.1_3 Forward -240 -221 12.0942 0.189
NP_440161.1_3 Reverse -227 -246 8.45592 0.272
NP_440586.1_8 Forward -237 -230 13.2151 0.026
NP_440586.1_8 Reverse -230 -237 13.2151 0.026
NP_440586.1_8 Reverse -96 -103 9.47853 0.146
NP_440586.1_8 Forward -338 -331 9.08521 0.178
NP_440586.1_8 Forward -103 -96 5.74197 0.283
NP_442251.1_6 Forward -237 -230 15.2804 0.0124
NP_442251.1_6 Reverse -230 -237 15.2804 0.0124
NP_442959.1_5 Reverse -40 -59 10.5209 0.224
NP_441262.1_3 Forward -238 -231 14.7888 0.0223
NP_441262.1_3 Forward -104 -97 14.7888 0.0223
NP_441262.1_3 Reverse -229 -236 6.52896 0.0809
NP_440027.1_3 Reverse -219 -237 11.1298 0.159
NP_440027.1_3 Forward -354 -336 5.72158 0.237
NP_443051.1_1 Forward -239 -230 19.5676 0.00335
NP_443051.1_1 Forward -105 -96 7.47288 0.0571
NP_443051.1_1 Reverse -228 -237 0.983037 0.125
NP_443051.1_1 Reverse -94 -103 -1.08191 0.281
NP_439937.1_9 Reverse -94 -111 -9.49991 0.192
NP_439937.1_9 Reverse -218 -235 -14.7114 0.287
NP_439937.1_9 Forward -105 -88 -17.0714 0.291
NP_440439.1_1 Forward -107 -94 10.639 0.0362
NP_440439.1_1 Forward -241 -228 2.67422 0.13
NP_440439.1_1 Reverse -226 -239 0.0192843 0.203
NP_442239.1_8 Forward -232 -213 5.70265 0.266
NP_440372.1_2 Forward -237 -230 16.3621 0.0124
NP_440372.1_2 Reverse -230 -237 16.3621 0.0124
NP_440372.1_2 Forward -103 -96 13.8055 0.0214
NP_440372.1_2 Reverse -96 -103 6.52896 0.188
NP_441789.1_7 Reverse -203 -222 -2.26292 0.257
NP_441789.1_7 Reverse -166 -185 -5.1145 0.293
NP_440316.1_10 Forward -239 -229 12.1731 0.214
NP_441803.1_2 Forward -188 -169 -1.37718 0.298
NP_442384.1_10 Reverse -95 -108 8.18076 0.0685
NP_442384.1_10 Forward -238 -225 7.88576 0.0727
NP_442384.1_10 Reverse -279 -292 3.95252 0.172
NP_442384.1_10 Reverse -229 -242 1.29759 0.263
NP_442114.1_4 Reverse -229 -240 8.22014 0.214
NP_442114.1_4 Reverse -95 -106 7.43349 0.277
NP_441877.1_9 Reverse -126 -143 3.77542 0.284
NP_442790.1_4 Reverse -220 -239 2.16274 0.0729
NP_442790.1_4 Forward -247 -228 -11.6036 0.231
NP_442790.1_4 Forward -229 -210 -15.4385 0.294
NP_442262.1_10 Forward -237 -230 14.1988 0.0123
NP_442262.1_10 Reverse -230 -237 14.1988 0.0123
NP_442262.1_10 Reverse -96 -103 13.2155 0.0213
NP_442262.1_10 Forward -338 -331 9.18389 0.211
NP_441689.1_5 Forward -240 -230 8.3377 0.132
NP_440163.1_10 Forward -342 -332 8.73149 0.262
NP_440344.1_10 Forward -111 -94 -8.22096 0.124
NP_440282.1_10 Reverse -170 -189 -9.63698 0.286
NP_441335.1_8 Forward -223 -204 6.78429 0.281
NP_440562.1_1 Forward -357 -338 16.4199 0.235
NP_440297.1_9 Forward -338 -328 0.176696 0.282
NP_440297.1_9 Reverse -230 -240 -0.216628 0.282
NP_440297.1_9 Reverse -181 -191 -0.216628 0.282
NP_440297.1_9 Reverse -280 -290 -0.511621 0.289
NP_442187.1_3 Forward -239 -229 15.0247 0.12
NP_440990.1_7 Reverse -327 -346 4.52268 0.292
NP_440999.1_9 Reverse -225 -239 6.48943 0.0969
NP_440999.1_9 Reverse -170 -184 3.53951 0.128
NP_440999.1_9 Forward -108 -94 -0.885388 0.22
NP_440999.1_9 Reverse -335 -349 -1.67204 0.246
NP_440888.1_2 Reverse -95 -109 13.6669 0.026
NP_440888.1_2 Reverse -229 -243 11.307 0.0705
NP_440888.1_2 Forward -288 -274 9.34041 0.13
NP_440792.1_5 Reverse -230 -249 18.584 0.0754
NP_440600.1_4 Reverse -221 -239 17.2271 0.0557
NP_442225.1_10 Forward -114 -95 6.29183 0.287
NP_442277.1_4 Forward -113 -94 5.70185 0.172
NP_442033.1_10 Reverse -227 -246 -7.57203 0.186
NP_442033.1_10 Reverse -217 -236 -8.45701 0.199
NP_442033.1_10 Reverse -83 -102 -10.1286 0.228
NP_442033.1_10 Forward -106 -87 -13.5702 0.287
NP_440575.1_8 Reverse -131 -150 -5.50708 0.271
NP_441543.1_2 Reverse -230 -239 15.9293 0.00518
NP_441543.1_2 Forward -237 -228 8.94785 0.0968
NP_441543.1_2 Reverse -96 -105 8.65285 0.0968
NP_442845.1_2 Reverse -339 -353 6.3911 0.21
NP_441319.1_6 Reverse -93 -112 12.1925 0.284
NP_441319.1_8 Forward -70 -52 5.13236 0.281
NP_442966.1_1 Forward -210 -196 23.2057 0.0635
NP_442710.1_7 Reverse -121 -140 2.77268 0.147
NP_442710.1_7 Forward -138 -119 -8.47217 0.299
NP_441469.1_8 Reverse -228 -237 15.4377 0.0124
NP_441469.1_8 Forward -239 -230 6.5879 0.227
NP_441469.1_8 Forward -105 -96 6.39124 0.227
NP_442315.1_1 Reverse -68 -86 3.65739 0.287
NP_443064.1_6 Forward -104 -94 9.07643 0.247
NP_443064.1_6 Forward -289 -279 8.30077 0.3
NP_442578.1_7 Forward -237 -230 14.5921 0.026
NP_442578.1_7 Reverse -230 -237 14.5921 0.026
NP_442578.1_7 Forward -103 -96 6.0373 0.18
NP_440710.1_1 Forward -246 -228 -9.32229 0.297
NP_440071.1_6 Forward -194 -180 13.9988 0.251
NP_441462.1_2 Forward -104 -94 17.3846 0.00406
NP_441462.1_2 Reverse -229 -239 10.4031 0.011
NP_441462.1_2 Forward -238 -228 9.32148 0.0234
NP_441462.1_2 Forward -288 -278 -0.806614 0.254
NP_441621.1_7 Reverse -227 -241 -5.50694 0.254
NP_443062.1_1 Reverse -95 -113 13.1288 0.0663
NP_443062.1_1 Reverse -229 -247 11.2761 0.102
NP_443062.1_1 Forward -104 -86 5.5232 0.227
NP_443062.1_6 Forward -112 -93 9.0459 0.133
NP_443062.1_6 Reverse -331 -350 3.44104 0.237
NP_440911.1_9 Reverse -192 -211 5.30933 0.243
NP_442204.1_1 Forward -108 -97 2.22195 0.266
NP_442204.1_1 Forward -242 -231 1.92696 0.266
NP_442204.1_6 Reverse -327 -346 5.30933 0.271
NP_441560.1_8 Reverse -90 -109 14.6291 0.139
NP_440516.1_2 Reverse -223 -241 -1.84914 0.292
NP_440516.1_6 Reverse -220 -234 16.3219 0.186
NP_440516.1_8 Forward -238 -229 18.9776 0.00442
NP_440516.1_8 Forward -104 -95 9.4395 0.0183
NP_440516.1_8 Reverse -229 -238 7.07956 0.0867
NP_440516.1_8 Reverse -95 -104 5.11294 0.118
NP_440516.1_8 Forward -246 -237 -0.491928 0.262
NP_442428.1_5 Forward -237 -230 15.8704 0.0124
NP_442428.1_5 Reverse -230 -237 15.8704 0.0124
NP_442428.1_5 Forward -103 -96 6.13563 0.209
NP_442428.1_5 Reverse -96 -103 6.0373 0.212
NP_441443.1_7 Forward -232 -213 -2.85214 0.28
NP_440673.1_2 Forward -205 -186 11.9504 0.162
NP_440673.1_3 Forward -236 -229 13.1171 0.0426
NP_440673.1_3 Reverse -231 -238 12.4288 0.0426
NP_440673.1_3 Reverse -97 -104 12.4288 0.0426
NP_440673.1_3 Reverse -239 -246 7.51227 0.252
NP_440865.1_9 Reverse -273 -292 -9.63698 0.294
NP_441052.1_2 Reverse -229 -239 10.9931 0.0285
NP_441052.1_2 Forward -238 -228 0.766681 0.256
NP_442219.1_9 Forward -237 -228 8.94785 0.0681
NP_442219.1_9 Reverse -230 -239 8.25953 0.0681
NP_440436.1_4 Reverse -230 -239 9.24241 0.0871
NP_440436.1_4 Forward -237 -228 9.04574 0.092
NP_440436.1_4 Reverse -96 -105 8.55409 0.0997
NP_440436.1_4 Forward -103 -94 5.11253 0.222
NP_441884.1_8 Forward -239 -220 -5.50708 0.188
NP_441884.1_9 Reverse -64 -83 -23.305 0.284
NP_441884.1_9 Forward -351 -332 -24.3866 0.286
NP_440314.1_9 Reverse -230 -249 12.3892 0.0261
NP_440314.1_9 Reverse -212 -231 3.53937 0.0849
NP_440314.1_9 Forward -103 -84 -7.96535 0.243
NP_441719.1_4 Forward -237 -230 16.3621 0.0124
NP_441719.1_4 Reverse -230 -237 16.3621 0.0124
NP_441719.1_4 Forward -103 -96 6.82395 0.0855
NP_441719.1_4 Reverse -96 -103 6.52896 0.188
NP_441733.1_10 Forward -107 -94 8.08242 0.143
NP_441733.1_10 Forward -241 -228 7.78743 0.15
NP_441733.1_10 Reverse -323 -336 7.09911 0.156
NP_441004.1_1 Forward -366 -347 -5.60541 0.178
NP_441004.1_1 Forward -208 -189 -11.7019 0.241
NP_441004.1_1 Forward -220 -201 -16.5201 0.286
NP_442813.1_4 Reverse -6 -25 -4.81876 0.299
NP_442366.1_3 Reverse -94 -112 6.214 0.0809
NP_440129.1_10 Forward -111 -97 11.5043 0.103
NP_442873.1_3 Reverse -219 -238 10.7167 0.169
NP_440296.1_10 Reverse -64 -83 -8.45701 0.253
NP_442206.1_10 Forward -238 -223 2.43817 0.201
NP_443054.1_2 Forward -350 -336 3.34284 0.24
NP_443054.1_2 Reverse -93 -107 1.76955 0.245
NP_441851.1_2 Reverse -145 -164 0.786102 0.266
NP_441851.1_9 Reverse -342 -361 9.14423 0.248
NP_441851.1_9 Reverse -264 -283 9.14423 0.248
NP_441851.1_10 Forward -105 -95 7.55152 0.137
NP_441851.1_10 Reverse -228 -238 6.66654 0.159
NP_442208.1_8 Forward -375 -357 17.4237 0.235
NP_442622.1_8 Forward -238 -220 -18.6637 0.243
NP_442622.1_8 Reverse -229 -247 -19.2537 0.296
NP_440611.1_6 Reverse -163 -182 6.29264 0.29
NP_441501.1_9 Reverse -172 -191 14.7483 0.253
NP_442856.1_7 Reverse -336 -355 -6.1954 0.295
NP_442515.1_1 Forward -349 -335 1.37622 0.161
NP_442515.1_1 Forward -247 -233 -0.688726 0.231
NP_442515.1_1 Reverse -210 -224 -3.63866 0.295
NP_442515.1_1 Forward -239 -225 -4.22864 0.298
NP_441396.1_5 Reverse -77 -86 15.1427 0.205
NP_440165.1_5 Reverse -228 -247 -6.68705 0.242
NP_442709.1_4 Forward -140 -121 8.26883 0.161
NP_442689.1_8 Reverse -133 -150 4.95539 0.157
NP_441349.1_10 Reverse -85 -104 -9.83364 0.297
NP_440432.1_9 Reverse -230 -245 15.5162 0.0126
NP_440432.1_9 Forward -237 -222 -4.24833 0.202
NP_442843.1_1 Forward -237 -218 18.289 0.0745
NP_442843.1_1 Reverse -61 -80 -7.76869 0.252
NP_442843.1_1 Reverse -331 -350 -11.1119 0.286
NP_440474.1_8 Reverse -172 -186 5.50552 0.25
NP_440474.1_8 Reverse -230 -244 5.21053 0.254
NP_439950.1_1 Reverse -82 -91 13.7661 0.24
NP_440040.1_6 Forward -27 -8 10.1275 0.181
NP_442006.1_2 Forward -348 -331 -16.7758 0.264
NP_441003.1_9 Forward -364 -345 5.60432 0.261
NP_441570.1_1 Forward -220 -202 -0.374176 0.046
NP_441570.1_1 Forward -238 -220 -2.53746 0.0659
NP_441570.1_1 Forward -382 -364 -15.9105 0.236
NP_441078.1_4 Forward -238 -229 9.93116 0.0203
NP_441078.1_4 Reverse -229 -238 9.83282 0.0226
NP_441078.1_4 Reverse -279 -288 5.40793 0.112
NP_441078.1_4 Reverse -95 -104 0.0980582 0.205
NP_441078.1_4 Forward -104 -95 0.0980582 0.205
NP_441539.1_1 Reverse -128 -142 12.3887 0.284
NP_440707.1_7 Forward -236 -217 3.34271 0.284
NP_441432.1_8 Forward -239 -230 16.8143 0.00595
NP_441432.1_8 Forward -105 -96 5.50626 0.151
NP_441432.1_8 Forward -247 -238 3.53964 0.244
NP_442320.1_8 Forward -244 -230 -4.22864 0.151
NP_442344.1_7 Reverse -230 -249 -6.1954 0.17
NP_441732.1_2 Forward -352 -336 -16.7561 0.195
NP_441732.1_2 Reverse -207 -223 -17.7394 0.292
NP_442815.1_2 Reverse -280 -298 9.0656 0.202
NP_440760.1_1 Forward -238 -219 -12.6852 0.0945
NP_440131.1_4 Reverse -69 -88 5.01433 0.275
NP_440578.1_10 Reverse -337 -356 9.83255 0.282
NP_441057.1_4 Reverse -335 -353 5.13236 0.207
NP_440913.1_1 Forward -240 -222 4.24738 0.276
NP_442489.1_7 Forward -238 -229 10.4228 0.0151
NP_442489.1_7 Reverse -229 -238 10.3245 0.0193
NP_442489.1_7 Reverse -95 -104 0.786375 0.152
NP_442489.1_7 Forward -104 -95 0.589713 0.17
NP_442489.1_7 Reverse -279 -288 -1.37691 0.195
NP_442489.1_7 Reverse -339 -348 -1.77023 0.247
NP_442079.1_6 Forward -356 -337 15.1424 0.273
NP_442079.1_7 Forward -237 -218 10.2259 0.111
NP_442079.1_7 Forward -103 -84 4.916 0.184
NP_440559.1_1 Forward -103 -94 14.651 0.0144
NP_440559.1_1 Reverse -230 -239 8.65285 0.0586
NP_441659.2_6 Reverse -130 -149 13.9616 0.234
NP_441659.2_8 Reverse -229 -239 11.3864 0.0184
NP_441659.2_8 Reverse -95 -105 6.56821 0.0714
NP_441659.2_8 Forward -288 -278 6.17489 0.084
NP_441659.2_8 Forward -238 -228 2.43831 0.2
NP_441659.2_8 Forward -104 -94 0.176696 0.271
NP_440860.1_8 Forward -182 -163 13.0775 0.296
NP_441022.1_1 Reverse -296 -305 12.4095 0.232
NP_441022.1_1 Forward -307 -298 11.1625 0.284
NP_441800.1_7 Forward -353 -335 -3.32411 0.275
NP_440779.1_5 Reverse -95 -112 -14.9075 0.287
NP_442346.1_5 Forward -239 -229 7.84651 0.156
NP_442346.1_5 Reverse -94 -104 5.97822 0.219
NP_442346.1_5 Reverse -228 -238 5.19158 0.256
NP_440352.1_5 Reverse -56 -75 13.8238 0.176
NP_440545.1_3 Reverse -275 -292 1.61214 0.116
NP_440545.1_3 Forward -386 -369 -2.81276 0.193
NP_441856.1_3 Reverse -307 -326 -2.65548 0.269
NP_440025.1_3 Forward -364 -350 14.8705 0.23
NP_440486.1_6 Forward -117 -98 6.29264 0.283
NP_441653.1_2 Forward -115 -96 2.27338 0.295
NP_440010.1_4 Reverse -167 -186 -2.36125 0.281
NP_440010.1_10 Reverse -348 -367 2.75272 0.272
NP_442603.1_7 Forward -238 -224 6.68548 0.232
NP_441585.1_5 Forward -85 -66 3.14526 0.256
NP_441888.1_7 Reverse -224 -238 9.93102 0.136
NP_441888.1_7 Forward -109 -95 3.73617 0.225
NP_441888.1_7 Forward -243 -229 2.94952 0.225
NP_443022.1_4 Reverse -37 -55 15.2604 0.215
NP_440449.1_6 Reverse -271 -289 4.85163 0.288
NP_441948.1_4 Forward -245 -227 -3.22577 0.189
NP_441948.1_4 Reverse -88 -106 -3.6191 0.201
NP_441502.1_3 Reverse -139 -158 5.60432 0.287
NP_441833.1_4 Forward -237 -230 15.9687 0.0124
NP_441833.1_4 Reverse -230 -237 15.9687 0.0124
NP_441833.1_4 Reverse -96 -103 6.52896 0.0924
NP_441833.1_4 Forward -103 -96 6.23397 0.163
NP_442699.1_8 Forward -356 -337 -13.1769 0.284
NP_442162.1_9 Forward -237 -230 16.2637 0.0124
NP_442162.1_9 Reverse -230 -237 16.2637 0.0124
NP_442162.1_9 Forward -103 -96 12.9205 0.0282
NP_442162.1_9 Reverse -96 -103 12.9205 0.0282
NP_440788.1_2 Forward -145 -126 7.47261 0.227
NP_440671.1_1 Reverse -126 -145 22.1136 0.0253
NP_442045.1_5 Forward -113 -94 -1.7705 0.29
NP_442199.1_5 Reverse -163 -182 -4.91709 0.233
NP_442140.1_3 Forward -237 -227 16.008 0.0287
NP_442140.1_3 Reverse -96 -106 12.1731 0.0637
NP_442140.1_3 Reverse -230 -240 4.69992 0.238
NP_442140.1_3 Reverse -172 -182 3.91327 0.271
NP_442723.1_4 Reverse -203 -221 20.0778 0.192
NP_440875.1_9 Reverse -97 -107 16.6457 0.0145
NP_440875.1_9 Reverse -231 -241 7.69067 0.255
NP_441813.1_5 Reverse -227 -237 19.4496 0.00647
NP_441813.1_5 Forward -240 -230 18.1713 0.00743
NP_441813.1_5 Reverse -93 -103 14.4347 0.0152
NP_441813.1_5 Forward -106 -96 9.7148 0.0241
NP_440590.1_4 Reverse -96 -109 14.0806 0.0112
NP_440590.1_4 Reverse -230 -243 -5.78224 0.289
NP_442497.1_10 Reverse -230 -239 17.601 0.00813
NP_442497.1_10 Forward -103 -94 8.25953 0.047
NP_442497.1_10 Forward -237 -228 1.37636 0.111
NP_442497.1_10 Reverse -96 -105 0.589713 0.153
NP_440821.1_4 Reverse -227 -237 7.84651 0.0626
NP_440821.1_4 Forward -240 -230 2.24165 0.131
NP_440821.1_4 Forward -106 -96 0.471689 0.174
NP_441239.1_9 Reverse -227 -239 13.9036 0.0335
NP_441239.1_9 Reverse -93 -105 12.3303 0.0477
NP_441239.1_9 Forward -240 -228 6.03717 0.202
NP_441239.1_9 Forward -182 -170 4.95553 0.234
NP_441239.1_9 Reverse -178 -190 4.66053 0.248
NP_441239.1_9 Forward -106 -94 3.87389 0.272
NP_441009.1_4 Forward -282 -263 10.9142 0.26
NP_442325.1_6 Reverse -216 -235 6.58763 0.254
NP_442193.1_1 Forward -204 -186 8.08229 0.275
NP_441698.1_1 Reverse -36 -53 20.3607 0.166
NP_441698.1_7 Reverse -59 -77 20.472 0.0758
NP_441541.1_1 Reverse -127 -145 10.6016 0.0858
NP_440354.1_5 Reverse -336 -355 11.2092 0.174
NP_440354.1_7 Forward -244 -226 9.26226 0.228
NP_442138.1_10 Reverse -229 -248 10.3242 0.0361
NP_442809.1_6 Forward -360 -341 4.03102 0.256
NP_442809.1_6 Forward -258 -239 3.14605 0.256
NP_440546.1_4 Forward -104 -94 15.4756 0.0459
NP_440546.1_4 Forward -238 -228 13.0517 0.0572
NP_440546.1_4 Reverse -229 -239 10.8217 0.104
NP_440546.1_4 Reverse -95 -105 10.046 0.109
NP_441230.1_5 Reverse -232 -251 4.42435 0.188
NP_440675.1_4 Forward -224 -205 12.7825 0.299
NP_440462.1_6 Forward -240 -230 18.7612 0.00454
NP_440462.1_6 Reverse -227 -237 16.303 0.0113
NP_440462.1_6 Forward -106 -96 7.74818 0.0699
NP_440462.1_6 Reverse -93 -103 6.07655 0.129
NP_442340.1_3 Reverse -245 -264 -9.93197 0.277
NP_440868.1_4 Reverse -225 -237 13.8053 0.0205
NP_440868.1_4 Forward -242 -230 7.70879 0.0648
NP_440868.1_4 Forward -108 -96 1.02229 0.193
NP_441497.1_3 Forward -388 -369 -11.1119 0.294
NP_442402.1_10 Forward -114 -104 10.4026 0.29
NP_441084.1_6 Forward -357 -343 12.1559 0.169
NP_440653.1_10 Reverse -340 -359 8.16093 0.201
NP_440696.1_3 Reverse -335 -353 -1.25915 0.253
NP_440696.1_3 Forward -238 -220 -2.0458 0.272
NP_442039.1_4 Forward -237 -230 15.1821 0.0124
NP_442039.1_4 Reverse -230 -237 15.1821 0.0124
NP_442039.1_4 Forward -103 -96 11.6422 0.0747
NP_442039.1_7 Reverse -143 -153 14.4347 0.211
NP_440753.1_5 Forward -379 -360 9.83255 0.233
NP_441926.1_3 Reverse -229 -245 14.5132 0.0449
NP_442837.1_3 Forward -237 -230 15.7721 0.0124
NP_442837.1_3 Reverse -230 -237 15.7721 0.0124
NP_442837.1_3 Forward -103 -96 6.0373 0.25
NP_442837.1_3 Reverse -96 -103 6.0373 0.25
NP_440160.1_3 Forward -351 -332 17.1082 0.149
NP_442053.1_1 Forward -238 -229 17.601 0.00138
NP_442053.1_1 Reverse -229 -238 16.2243 0.00451
NP_442053.1_1 Reverse -95 -104 7.17789 0.104
NP_440505.1_3 Forward -240 -230 17.188 0.00332
NP_440505.1_3 Forward -106 -96 14.3364 0.0224
NP_440505.1_3 Forward -231 -221 7.05986 0.165
NP_440505.1_3 Reverse -227 -237 6.07655 0.197
NP_442532.1_7 Forward -238 -224 12.6843 0.0917
NP_440914.1_1 Reverse -229 -239 13.7874 0.0256
NP_440914.1_1 Forward -238 -228 7.34642 0.241
NP_441011.1_8 Reverse -230 -239 16.6177 0.00602
NP_441011.1_8 Forward -237 -228 15.3394 0.012
NP_441011.1_8 Forward -103 -94 12.0944 0.0517
NP_441011.1_8 Reverse -96 -105 7.07956 0.179
NP_442533.1_6 Reverse -279 -288 12.8811 0.0253
NP_442533.1_6 Forward -238 -229 7.86621 0.0862
NP_442533.1_6 Reverse -229 -238 7.37455 0.0898
NP_442533.1_6 Forward -104 -95 5.40793 0.14
NP_442533.1_6 Reverse -95 -104 4.52295 0.179
NP_442533.1_6 Forward -189 -180 1.96635 0.28
NP_442533.1_6 Forward -354 -345 1.57302 0.294
NP_443016.1_1 Forward -244 -225 -8.45701 0.298
NP_441482.1_7 Forward -244 -230 2.85119 0.0554
NP_441482.1_7 Forward -252 -238 -2.06536 0.0922
NP_441482.1_7 Reverse -223 -237 -5.11362 0.172
NP_441482.1_7 Reverse -205 -219 -11.4068 0.262
NP_441482.1_7 Forward -294 -280 -11.8001 0.284
NP_441482.1_7 Reverse -89 -103 -12.2918 0.292
NP_439944.1_8 Forward -248 -229 11.5042 0.298
NP_439944.1_9 Reverse -230 -240 9.12481 0.1
NP_441028.1_6 Forward -29 -19 3.51951 0.292
NP_442202.1_10 Forward -349 -335 3.93283 0.278
NP_440116.1_8 Forward -103 -84 0.491109 0.0975
NP_440115.1_6 Reverse -92 -102 5.19158 0.265
NP_440115.1_6 Forward -241 -231 4.79825 0.282
NP_441347.1_9 Reverse -128 -141 10.3498 0.251
NP_442890.1_1 Forward -247 -228 18.4857 0.194
NP_441106.1_1 Forward -239 -230 18.486 0.0028
NP_441106.1_1 Reverse -228 -237 9.04618 0.0371
NP_441106.1_1 Forward -105 -96 8.45619 0.0548
NP_439903.1_6 Reverse -234 -253 5.2102 0.186
NP_439903.1_6 Reverse -321 -340 -1.18128 0.293
NP_441286.1_1 Forward -239 -227 -4.38592 0.156
NP_440670.1_8 Forward -238 -229 9.04618 0.0606
NP_440670.1_8 Reverse -229 -238 8.75118 0.0606
NP_440670.1_8 Forward -104 -95 8.65285 0.0627
NP_440670.1_8 Reverse -95 -104 6.29291 0.124
NP_441705.1_3 Forward -252 -233 -6.68705 0.291
NP_441930.1_2 Forward -229 -219 13.8447 0.236
NP_440886.1_7 Reverse -228 -238 17.7774 0.0011
NP_440886.1_7 Forward -239 -229 6.76441 0.114
NP_441001.1_10 Forward -190 -171 7.47261 0.249
NP_442614.1_2 Forward -104 -90 9.2427 0.242
NP_442072.1_9 Forward -184 -166 -22.7936 0.259
NP_440513.1_4 Forward -238 -219 13.7658 0.19
NP_440907.2_8 Reverse -230 -240 9.616 0.103
NP_440907.2_8 Reverse -96 -106 6.17443 0.178
NP_440841.1_4 Forward -248 -229 -7.57203 0.237
NP_441463.1_2 Reverse -123 -141 10.0777 0.138
NP_441463.1_3 Forward -190 -171 -5.40875 0.226
NP_441463.1_3 Reverse -219 -238 -7.27704 0.256
NP_441626.1_2 Forward -237 -230 15.7721 0.0124
NP_441626.1_2 Reverse -230 -237 15.7721 0.0124
NP_441626.1_2 Forward -103 -96 12.2322 0.0511
NP_441626.1_2 Reverse -96 -103 5.93897 0.231
NP_442365.1_7 Reverse -225 -244 0.982764 0.175
NP_442365.1_7 Reverse -239 -258 -3.73712 0.222
NP_442615.1_1 Forward -247 -229 -2.14413 0.139
NP_442615.1_1 Reverse -86 -104 -5.97904 0.231
NP_441962.1_4 Reverse -215 -234 -15.1435 0.299
NP_440387.1_1 Reverse -229 -245 -0.236458 0.137
NP_440387.1_1 Forward -238 -222 -4.26803 0.181
NP_441431.1_2 Reverse -202 -216 8.3571 0.218
NP_441431.1_2 Reverse -92 -106 7.47213 0.241
NP_441431.1_2 Forward -107 -93 6.39049 0.272
NP_440634.1_8 Forward -345 -326 2.6536 0.285
NP_441993.1_1 Forward -228 -209 3.60346 0.231
NP_440814.1_4 Forward -113 -94 -11.3086 0.224
NP_442805.1_1 Reverse -129 -146 8.49531 0.22
NP_440467.1_8 Forward -351 -332 17.0107 0.0964
NP_440114.1_10 Reverse -229 -243 14.5526 0.0382
NP_440114.1_10 Forward -238 -224 9.14437 0.183
NP_442087.1_2 Forward -238 -219 13.8895 0.228
NP_440766.1_4 Forward -108 -94 10.6193 0.0863
NP_440766.1_5 Forward -144 -132 8.80169 0.277
NP_441237.1_9 Forward -334 -324 10.1081 0.248
NP_442743.1_4 Reverse -96 -115 -3.14714 0.224
NP_439910.1_2 Reverse -87 -104 -22.5773 0.267
NP_442867.1_8 Forward -283 -264 4.42435 0.283
NP_440457.1_1 Forward -108 -96 8.59377 0.101
NP_440457.1_1 Forward -104 -92 1.21895 0.244
NP_440457.1_1 Forward -250 -238 -0.354346 0.262
NP_440457.1_1 Forward -242 -230 -0.551008 0.268
NP_442940.1_2 Forward -94 -75 -1.18052 0.296
NP_440798.1_6 Reverse -374 -387 0.0192843 0.294
NP_441801.1_4 Forward -89 -79 2.53664 0.292
NP_440801.1_8 Reverse -228 -247 3.44104 0.226
NP_440801.1_8 Forward -86 -67 -1.96717 0.284
NP_440473.1_9 Forward -249 -230 -8.65367 0.254
NP_442509.1_9 Forward -238 -228 14.7292 0.0242
NP_442509.1_9 Forward -93 -83 13.1559 0.061
NP_440660.1_6 Forward -356 -337 10.8159 0.28
NP_441253.1_1 Forward -83 -64 14.2574 0.162
NP_440524.1_2 Reverse -347 -366 -1.37718 0.27
NP_440554.1_4 Reverse -230 -240 17.9746 0.0131
NP_440554.1_4 Reverse -96 -106 13.5497 0.0245
NP_440554.1_4 Forward -237 -227 9.91146 0.0608
NP_441885.1_5 Forward -104 -94 7.84651 0.0419
NP_441885.1_5 Forward -238 -228 2.33998 0.0799
NP_441885.1_5 Reverse -229 -239 1.55333 0.109
NP_440478.1_10 Reverse -227 -241 12.0943 0.169
NP_441428.1_7 Reverse -309 -328 6.4893 0.254
NP_442341.1_7 Forward -349 -335 3.73617 0.214
NP_440423.1_6 Forward -246 -227 -12.2919 0.194
NP_443000.1_7 Forward -240 -230 20.3345 0.00223
NP_443000.1_7 Reverse -227 -237 2.53664 0.226
NP_443000.1_7 Forward -106 -96 1.84832 0.228
NP_443000.1_7 Reverse -93 -103 1.16001 0.271
NP_440507.2_3 Forward -223 -204 7.37347 0.281
NP_440552.1_8 Forward -143 -126 11.9886 0.235
NP_440275.1_3 Forward -240 -230 16.1063 0.0155
NP_440275.1_3 Forward -106 -96 12.8614 0.0299
NP_440275.1_3 Reverse -227 -237 6.76487 0.0966
NP_440679.1_10 Reverse -332 -351 -11.4069 0.182
NP_440679.1_10 Forward -236 -217 -14.2585 0.226
NP_441359.1_5 Forward -291 -272 4.22769 0.227
NP_439962.1_4 Reverse -212 -231 -5.9004 0.28
NP_440175.1_7 Reverse -335 -353 13.462 0.19
NP_440149.1_8 Forward -238 -219 -3.63879 0.193
NP_441105.1_3 Forward -161 -142 -7.67036 0.258
NP_440216.1_1 Reverse -229 -243 5.01447 0.0225
NP_440216.1_1 Forward -238 -224 -2.45868 0.0513
NP_440216.1_1 Reverse -95 -109 -3.63866 0.0849
NP_440216.1_1 Forward -104 -90 -4.03198 0.096
NP_440216.1_9 Forward -352 -343 8.25953 0.286
NP_440172.1_1 Forward -238 -228 9.7148 0.0586
NP_440172.1_1 Forward -104 -94 8.82982 0.0586
NP_440172.1_1 Reverse -229 -239 7.74818 0.0738
NP_440172.1_1 Forward -204 -194 1.94665 0.29
NP_442371.1_1 Forward -15 -5 15.1225 0.176
NP_442371.1_1 Reverse -149 -159 11.7793 0.281
NP_442015.1_10 Forward -352 -339 4.64084 0.166
NP_442015.1_10 Reverse -91 -104 2.77255 0.187
NP_441226.1_7 Forward -237 -230 14.4934 0.0123
NP_441226.1_7 Reverse -230 -237 14.4934 0.0123
NP_441226.1_7 Forward -103 -96 12.7234 0.0312
NP_441226.1_7 Reverse -96 -103 11.5435 0.0757
NP_440198.1_6 Forward -366 -348 14.4738 0.276
NP_441111.1_7 Reverse -230 -238 18.7023 0.00294
NP_441111.1_7 Forward -237 -229 8.96754 0.0463
NP_441111.1_7 Reverse -96 -104 8.86921 0.0589
NP_441766.1_2 Reverse -229 -238 18.2893 0.00297
NP_441766.1_2 Forward -238 -229 9.14451 0.0337
NP_441766.1_2 Forward -104 -95 8.1612 0.0645
NP_441766.1_2 Reverse -95 -104 5.89959 0.103
NP_441766.1_9 Reverse -337 -356 -1.57384 0.272
NP_442417.1_5 Forward -238 -224 9.63603 0.128
NP_442417.1_5 Reverse -229 -243 8.75105 0.147
NP_442252.1_3 Forward -111 -93 7.68896 0.291
NP_442179.1_6 Forward -178 -160 19.3903 0.191
NP_440416.1_1 Forward -288 -269 -9.53865 0.272
NP_440416.1_1 Reverse -76 -95 -12.3902 0.272
NP_440416.1_1 Reverse -229 -248 -12.7836 0.272
NP_440416.1_9 Forward -111 -92 10.3242 0.0222
NP_440416.1_9 Forward -187 -168 -18.7818 0.264
NP_440591.1_9 Forward -221 -203 6.214 0.225
NP_442154.1_1 Reverse -337 -355 -6.37237 0.137
NP_442154.1_1 Forward -230 -212 -17.8771 0.272
NP_440261.1_5 Forward -103 -90 -4.9956 0.183
NP_440261.1_5 Reverse -280 -293 -12.1738 0.272
NP_440261.1_5 Reverse -230 -243 -12.1738 0.272
NP_440261.1_5 Forward -237 -224 -12.2721 0.277
NP_440988.1_10 Forward -356 -342 10.3203 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAACAGCTTAACCAGAATGGGATAGCATTCCTCGGTTTGCTTAATGCCCAGGGCAAACACCGCCATGGAACGCACCTGTAAAGTATCGTCATCTAAAACTTTTTTAATCAGGGGCACCGCCTCCTCACTGGAATAGGGTCTCAGGGAAGCTAGGGCAATCAGGCGATCGCGGGAATTGGGGCTGTCGAGTTGGCTGGCAATTTGTTCGAGGGTCAGGGCTGTCATGGCTGGGTTTCTGAGAATTTCTTCTGCCATTGTAACAAAACTTTATAAAGCTATCCTGGTACTTCTCACCGGCGATCGGTCGGTAAACCCCCCACGGACAAATTCTCCCCGGGCAACATAATCCCGTAAACTTTCTTAATATAGTTTGTCCCCTGAGGACAGGAGGAAATTGCA

CDS

GTGACCATTACCTTTGTTAAAGAGCAGAAGGATATTGTTGTGGCCCAGGGTGCCAACCTACGGGAAAAGGCCCTGCAGAATGGCGTTGATATTTATACCTTGAAAGGAAAACTGATGAACTGCGGAGGCTACGGCCAATGTGGCACTTGCATCGTGGAAATCACAGCGGGTATGGAAAATCTTTCCCCGAAAACCGACTTTGAAAATAGGGTATTGCGCAAAAAGCCCGACAATTTCCGTCTCGCCTGTCAAACCTTGGTCAATGGGCCGGTGAGTGTGAACACCAAACCCAAAGGCTAG

Protein

MTITFVKEQKDIVVAQGANLREKALQNGVDIYTLKGKLMNCGGYGQCGTCIVEITAGMENLSPKTDFENRVLRKKPDNFRLACQTLVNGPVSVNTKPKG