Your browser is old and dusty. Try Google Chrome!

Details for ssl2982

ORF ssl2982
Accession NP_441766.1
Symbol ycf61
Category probable DNA-directed RNA polymerase omega subunit
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -35 -21 8.06273 0.0937
NP_440795.1_7 Forward -35 -28 14.6904 0.0123
NP_440795.1_7 Reverse -28 -35 14.6904 0.0123
NP_441418.1_2 Reverse -48 -66 15.7521 0.0797
NP_441418.1_6 Forward -36 -17 -19.8634 0.0979
NP_441418.1_6 Reverse -27 -46 -19.9617 0.0997
NP_442291.1_5 Forward -37 -21 5.86006 0.0727
NP_442291.1_5 Reverse -26 -42 5.46674 0.0762
NP_441453.1_4 Reverse -27 -35 16.539 0.00633
NP_441453.1_4 Forward -36 -28 16.539 0.00633
NP_442151.1_6 Reverse -27 -41 10.1277 0.13
NP_442151.1_6 Forward -36 -22 8.06273 0.183
NP_441818.1_1 Forward -35 -24 15.8894 0.0244
NP_441818.1_1 Reverse -28 -39 15.4961 0.0264
NP_440226.1_1 Reverse -27 -46 16.3224 0.022
NP_440226.1_1 Forward -36 -17 10.4225 0.0622
NP_440259.1_4 Forward -339 -325 10.7568 0.262
NP_441098.1_3 Reverse -102 -121 -0.663914 0.25
NP_442173.1_1 Forward -35 -27 15.4574 0.00633
NP_442173.1_1 Reverse -28 -36 15.4574 0.00633
NP_442752.1_4 Forward -36 -29 13.8055 0.0199
NP_442752.1_4 Reverse -27 -34 13.8055 0.0199
NP_443027.1_4 Reverse -25 -35 14.0414 0.0452
NP_443027.1_4 Forward -38 -28 11.0914 0.107
NP_443027.1_4 Reverse -117 -127 8.23984 0.215
NP_441812.1_3 Forward -37 -23 9.2427 0.245
NP_442975.1_10 Reverse -23 -37 12.192 0.0477
NP_440784.1_7 Forward -35 -28 15.9687 0.0123
NP_440784.1_7 Reverse -28 -35 15.9687 0.0123
NP_440061.1_9 Reverse -25 -39 17.9935 0.0113
NP_440061.1_9 Forward -38 -24 10.3237 0.126
NP_441054.1_4 Forward -46 -28 11.8189 0.0619
NP_440878.1_9 Forward -46 -27 4.916 0.174
NP_442062.1_8 Forward -36 -26 17.3846 0.00193
NP_442062.1_8 Reverse -27 -37 17.3846 0.00193
NP_440304.1_4 Reverse -25 -35 10.8948 0.051
NP_440304.1_4 Forward -38 -28 1.84832 0.299
NP_442242.1_4 Forward -35 -28 14.3954 0.0124
NP_442242.1_4 Reverse -28 -35 14.3954 0.0124
NP_440044.1_8 Forward -35 -16 10.5209 0.0551
NP_441208.1_9 Forward -76 -62 8.94771 0.219
NP_440769.1_8 Forward -361 -342 8.55425 0.23
NP_441083.1_5 Forward -36 -26 20.3345 0.00053
NP_441083.1_5 Reverse -27 -37 20.3345 0.00053
NP_442827.1_8 Forward -44 -25 1.6703 0.173
NP_441434.1_7 Reverse -29 -43 11.6026 0.13
NP_441434.1_7 Forward -50 -36 1.57289 0.299
NP_441738.1_2 Forward -34 -27 15.28 0.0102
NP_441738.1_2 Reverse -29 -36 15.28 0.0102
NP_441558.1_5 Reverse -25 -44 17.404 0.021
NP_441558.1_5 Reverse -117 -136 3.93269 0.294
NP_440209.1_1 Reverse -27 -35 18.1123 0.00295
NP_440209.1_1 Forward -36 -28 18.1123 0.00295
NP_442889.1_8 Forward -39 -25 11.602 0.0733
NP_442889.1_8 Reverse -24 -38 2.94893 0.295
NP_440178.1_7 Forward -37 -18 -13.1769 0.129
NP_441716.1_1 Forward -36 -22 10.816 0.0936
NP_441716.1_2 Reverse -344 -363 -0.951026 0.277
NP_442111.1_4 Reverse -26 -40 4.03116 0.223
NP_442111.1_4 Forward -37 -23 1.67122 0.296
NP_440906.1_5 Forward -35 -28 15.8704 0.0124
NP_440906.1_5 Reverse -28 -35 15.8704 0.0124
NP_440747.1_10 Forward -39 -27 16.7552 0.0019
NP_440747.1_10 Reverse -24 -36 7.4138 0.00422
NP_441130.1_10 Reverse -25 -39 8.45605 0.135
NP_441486.1_1 Reverse -24 -38 5.50613 0.0365
NP_441486.1_1 Forward -39 -25 3.8345 0.0534
NP_442634.1_4 Forward -38 -24 -1.96703 0.149
NP_441014.1_10 Forward -37 -18 17.2065 0.0425
NP_442848.1_1 Reverse -21 -35 -1.37704 0.263
NP_443018.1_3 Forward -35 -28 14.8871 0.0123
NP_443018.1_3 Reverse -28 -35 14.8871 0.0123
NP_441634.1_8 Forward -38 -24 -3.24533 0.295
NP_440376.1_1 Forward -36 -27 19.4693 0.000692
NP_440376.1_1 Reverse -27 -36 19.4693 0.000692
NP_441588.1_4 Reverse -29 -39 6.46988 0.193
NP_441588.1_4 Forward -34 -24 6.37155 0.2
NP_442687.1_7 Forward -37 -27 8.92815 0.0994
NP_442687.1_7 Reverse -26 -36 8.92815 0.0994
NP_442485.1_3 Reverse -16 -35 -4.42544 0.28
NP_442530.1_2 Forward -369 -359 11.0914 0.284
NP_440236.1_2 Reverse -77 -95 -4.99573 0.277
NP_442658.1_1 Forward -38 -28 7.94438 0.199
NP_442658.1_1 Reverse -25 -35 6.76441 0.214
NP_442496.1_8 Forward -158 -139 18.0541 0.0494
NP_440656.1_8 Reverse -16 -35 -3.93378 0.198
NP_441414.1_9 Forward -36 -17 5.80098 0.0439
NP_441414.1_9 Reverse -27 -46 -1.57384 0.102
NP_440184.1_7 Forward -64 -45 13.5099 0.28
NP_441487.1_9 Forward -37 -18 -2.75381 0.293
NP_442937.1_5 Reverse -22 -41 6.78429 0.27
NP_442321.1_4 Forward -84 -65 -7.76869 0.284
NP_441317.1_4 Forward -72 -58 14.143 0.161
NP_441317.1_4 Forward -70 -56 14.0475 0.161
NP_441958.1_5 Forward -37 -27 12.2714 0.00183
NP_441958.1_5 Reverse -26 -36 12.2714 0.00183
NP_439905.1_1 Reverse -28 -41 18.4072 0.0274
NP_440984.1_7 Forward -41 -27 21.0424 0.00311
NP_439990.1_5 Forward -41 -28 10.1474 0.128
NP_439990.1_6 Reverse -119 -138 9.24257 0.197
NP_442690.1_1 Forward -159 -140 -9.93197 0.207
NP_442911.1_2 Reverse -17 -36 8.55425 0.0203
NP_442911.1_2 Forward -46 -27 -4.52377 0.136
NP_440153.1_5 Reverse -28 -42 3.24451 0.217
NP_443055.1_6 Reverse -19 -37 6.70489 0.165
NP_440388.1_7 Reverse -91 -110 0.491109 0.251
NP_441099.1_5 Forward -46 -27 -11.0136 0.27
NP_441099.1_5 Reverse -17 -36 -11.8986 0.291
NP_441473.1_3 Forward -136 -117 11.4058 0.107
NP_441000.1_1 Reverse -196 -214 12.8119 0.199
NP_440484.1_3 Forward -38 -24 12.1926 0.242
NP_440147.1_4 Reverse -25 -38 9.75405 0.0371
NP_440147.1_4 Forward -38 -25 8.67241 0.0475
NP_441550.1_7 Reverse -353 -372 15.5152 0.241
NP_441550.1_8 Forward -38 -28 15.1225 0.0132
NP_441550.1_8 Reverse -25 -35 12.3692 0.0336
NP_441916.1_7 Forward -36 -26 10.3048 0.0261
NP_441916.1_7 Reverse -27 -37 10.3048 0.0261
NP_441916.1_10 Reverse -19 -38 2.0644 0.253
NP_440345.1_3 Reverse -361 -375 17.2957 0.161
NP_440345.1_3 Reverse -164 -178 14.3354 0.215
NP_440345.1_3 Reverse -360 -374 11.7571 0.247
NP_441041.1_4 Forward -36 -17 -11.6036 0.25
NP_442396.1_5 Forward -40 -27 11.819 0.0913
NP_442396.1_5 Reverse -23 -36 9.65572 0.129
NP_441725.1_5 Forward -35 -25 11.2881 0.0247
NP_441725.1_5 Reverse -28 -38 2.04498 0.115
NP_439966.1_7 Reverse -25 -35 15.8108 0.0124
NP_439966.1_7 Forward -38 -28 15.3192 0.0152
NP_440736.1_4 Reverse -318 -337 14.3549 0.122
NP_442941.1_3 Forward -35 -25 19.9412 0.00262
NP_442941.1_3 Reverse -28 -38 19.2529 0.00262
NP_440289.1_2 Reverse -24 -37 3.75586 0.0741
NP_440289.1_2 Forward -39 -26 3.06754 0.0811
NP_440289.1_4 Forward -132 -113 10.9142 0.228
NP_441514.1_1 Forward -173 -163 15.5864 0.274
NP_442281.1_1 Reverse -22 -36 9.24208 0.0726
NP_442281.1_1 Forward -41 -27 7.17714 0.106
NP_441079.1_7 Forward -148 -129 -7.6711 0.296
NP_440177.1_9 Reverse -19 -38 18.9773 0.165
NP_442256.1_2 Forward -38 -20 8.96727 0.0965
NP_441644.1_6 Forward -36 -26 17.3841 0.00127
NP_441644.1_6 Reverse -27 -37 17.3841 0.00127
NP_441644.1_6 Reverse -119 -129 4.99446 0.216
NP_442215.1_2 Reverse -25 -41 -4.1697 0.228
NP_440253.1_2 Forward -36 -18 14.4738 0.0198
NP_440253.1_2 Reverse -27 -45 -0.0791831 0.201
NP_440929.1_8 Forward -36 -27 19.2726 0.000701
NP_440929.1_8 Reverse -27 -36 19.2726 0.000701
NP_442933.1_10 Forward -36 -27 17.601 0.00325
NP_442933.1_10 Reverse -27 -36 17.601 0.00325
NP_440891.1_8 Reverse -340 -359 16.5696 0.233
NP_441751.2_8 Forward -35 -21 -1.5737 0.129
NP_441751.2_8 Reverse -28 -42 -4.52363 0.174
NP_442554.1_8 Reverse -28 -38 16.2046 0.0065
NP_442554.1_8 Forward -35 -25 15.9097 0.00747
NP_441762.1_7 Reverse -26 -38 -6.74586 0.284
NP_441762.1_7 Forward -37 -25 -6.84419 0.284
NP_442142.1_4 Reverse -24 -37 6.21356 0.17
NP_442142.1_4 Forward -39 -26 4.24695 0.227
NP_442292.1_1 Forward -35 -26 18.486 0.00229
NP_442292.1_1 Reverse -28 -37 18.486 0.00229
NP_440775.1_4 Forward -364 -345 12.3837 0.216
NP_440775.1_4 Reverse -356 -375 10.4615 0.216
NP_442476.1_6 Reverse -28 -42 18.4858 0.0295
NP_440895.1_6 Reverse -168 -181 9.2624 0.228
NP_442381.1_8 Forward -39 -20 -8.26035 0.215
NP_443009.1_5 Reverse -26 -37 8.90795 0.0965
NP_443009.1_5 Forward -37 -26 8.90795 0.0965
NP_441741.1_6 Forward -80 -61 7.96426 0.249
NP_441715.1_4 Reverse -28 -38 17.3846 0.0106
NP_441715.1_4 Forward -35 -25 14.828 0.0268
NP_441448.1_1 Reverse -10 -29 5.30933 0.261
NP_441468.1_1 Forward -35 -28 15.8704 0.0124
NP_441468.1_1 Reverse -28 -35 15.8704 0.0124
NP_441673.1_1 Forward -36 -27 20.8459 0.000698
NP_441673.1_1 Reverse -27 -36 20.8459 0.000698
NP_441826.1_2 Forward -42 -28 -3.34366 0.284
NP_442868.1_6 Forward -38 -28 19.2529 0.00563
NP_442868.1_6 Reverse -25 -35 9.91146 0.038
NP_442719.1_2 Forward -155 -137 -0.571569 0.162
NP_442719.1_2 Forward -156 -138 -10.0113 0.268
NP_441251.1_7 Reverse -133 -146 10.344 0.288
NP_441056.1_1 Forward -36 -17 -7.37537 0.272
NP_441612.1_2 Reverse -27 -37 8.54929 0.21
NP_441612.1_2 Forward -36 -26 8.54929 0.21
NP_442427.1_8 Forward -45 -26 19.3707 0.029
NP_442427.1_8 Reverse -131 -150 7.86593 0.203
NP_442808.1_1 Reverse -26 -36 8.63269 0.0481
NP_442808.1_1 Forward -37 -27 8.63269 0.0481
NP_442808.1_1 Forward -19 -9 3.22451 0.247
NP_441849.1_2 Forward -116 -97 1.76618 0.245
NP_440145.1_3 Reverse -17 -36 -5.70374 0.275
NP_441906.1_2 Reverse -144 -163 3.44025 0.286
NP_442718.1_2 Reverse -10 -29 -4.42544 0.292
NP_442718.1_2 Reverse -99 -118 -5.11376 0.292
NP_442542.1_2 Forward -38 -25 9.75405 0.131
NP_442050.1_5 Reverse -25 -35 16.4991 0.00812
NP_442050.1_5 Forward -38 -28 14.3359 0.0206
NP_440334.1_2 Reverse -372 -385 15.5556 0.203
NP_440558.1_2 Reverse -18 -37 -1.96717 0.22
NP_442724.1_1 Forward -155 -145 15.9097 0.278
NP_441518.1_3 Reverse -17 -36 -4.91709 0.121
NP_441878.1_6 Forward -37 -27 10.4031 0.0176
NP_441878.1_6 Reverse -26 -36 10.4031 0.0176
NP_441036.1_8 Forward -37 -27 8.33817 0.174
NP_441036.1_8 Reverse -26 -36 8.33817 0.174
NP_441557.1_5 Forward -36 -27 19.9609 0.000699
NP_441557.1_5 Reverse -27 -36 19.9609 0.000699
NP_441445.1_1 Reverse -18 -37 8.35759 0.122
NP_442066.2_9 Forward -40 -27 20.0788 0.00699
NP_440084.1_8 Forward -84 -70 11.9481 0.241
NP_441458.1_10 Forward -45 -26 1.37609 0.29
NP_442919.1_3 Reverse -56 -75 32.3539 0.000000334
NP_442183.1_1 Forward -36 -22 17.1092 0.0122
NP_441574.1_1 Reverse -15 -34 -4.42544 0.252
NP_442347.1_2 Forward -35 -26 12.4878 0.056
NP_442347.1_2 Reverse -28 -37 12.4878 0.056
NP_442645.1_2 Reverse -19 -38 -13.8652 0.165
NP_442645.1_2 Forward -44 -25 -22.2233 0.29
NP_441633.1_3 Forward -38 -25 3.36254 0.0699
NP_441633.1_3 Reverse -25 -38 -5.97891 0.236
NP_440136.1_2 Forward -35 -28 15.9687 0.0123
NP_440136.1_2 Reverse -28 -35 15.9687 0.0123
NP_442998.1_5 Forward -142 -132 7.15819 0.299
NP_442998.1_10 Forward -34 -27 15.5754 0.0102
NP_442998.1_10 Reverse -29 -36 15.5754 0.0102
NP_440899.1_1 Reverse -16 -35 11.2376 0.164
NP_440899.1_8 Forward -115 -96 -10.3253 0.277
NP_440299.1_1 Reverse -23 -36 13.0967 0.0319
NP_440299.1_1 Forward -40 -27 10.9334 0.0529
NP_440299.1_1 Reverse -43 -56 2.87033 0.269
NP_441799.1_1 Forward -40 -26 13.5686 0.0311
NP_441799.1_1 Reverse -23 -37 10.0287 0.0797
NP_440977.1_1 Reverse -36 -55 37.3652 0.000000188
NP_440977.1_4 Reverse -101 -120 37.8569 0.000000502
NP_441007.1_10 Forward -41 -28 8.57408 0.112
NP_441007.1_10 Reverse -22 -35 -1.06236 0.3
NP_442201.1_10 Reverse -16 -35 -4.72043 0.152
NP_440256.1_1 Reverse -24 -43 1.86774 0.0702
NP_440256.1_1 Forward -39 -20 -2.75381 0.122
NP_440087.1_1 Reverse -288 -307 -5.60541 0.249
NP_442860.1_7 Reverse -56 -74 8.22348 0.283
NP_440915.1_6 Forward -40 -26 0.687908 0.155
NP_441704.1_8 Forward -47 -28 9.34008 0.182
NP_440695.1_5 Reverse -15 -34 0.58944 0.284
NP_442386.1_9 Reverse -26 -35 13.8639 0.0289
NP_442386.1_9 Forward -37 -28 13.8639 0.0289
NP_441340.1_5 Forward -35 -28 15.6737 0.0124
NP_441340.1_5 Reverse -28 -35 15.6737 0.0124
NP_442484.1_2 Forward -47 -28 19.9606 0.0181
NP_440168.1_9 Forward -38 -19 -5.01543 0.296
NP_442474.1_1 Reverse -64 -83 -4.22878 0.297
NP_440586.1_8 Forward -35 -28 13.2151 0.026
NP_440586.1_8 Reverse -28 -35 13.2151 0.026
NP_440586.1_8 Reverse -120 -127 5.64364 0.297
NP_442251.1_6 Forward -35 -28 15.2804 0.0124
NP_442251.1_6 Reverse -28 -35 15.2804 0.0124
NP_440684.1_9 Reverse -21 -35 8.65272 0.225
NP_441262.1_3 Reverse -27 -34 14.7888 0.0223
NP_441262.1_3 Forward -36 -29 14.7888 0.0223
NP_443051.1_1 Reverse -26 -35 10.4228 0.00754
NP_443051.1_1 Forward -37 -28 10.4228 0.00754
NP_440408.1_7 Reverse -27 -46 7.27595 0.29
NP_440372.1_2 Forward -35 -28 16.3621 0.0124
NP_440372.1_2 Reverse -28 -35 16.3621 0.0124
NP_440271.1_2 Reverse -1 -20 6.19431 0.23
NP_440991.1_8 Forward -177 -158 14.9299 0.268
NP_439977.1_5 Forward -42 -23 -1.27885 0.245
NP_442384.1_10 Reverse -27 -40 19.2922 0.00338
NP_442384.1_10 Forward -36 -23 8.77074 0.0608
NP_440699.1_1 Reverse -51 -70 3.10306 0.288
NP_441877.1_9 Forward -284 -267 2.59545 0.285
NP_442790.1_4 Forward -45 -26 -8.752 0.174
NP_442262.1_2 Reverse -64 -83 15.3417 0.247
NP_442262.1_10 Forward -35 -28 14.1988 0.0123
NP_442262.1_10 Reverse -28 -35 14.1988 0.0123
NP_441689.1_5 Reverse -25 -35 15.3192 0.0403
NP_441689.1_5 Forward -38 -28 5.78111 0.197
NP_440163.1_10 Reverse -24 -34 10.4031 0.201
NP_440344.1_10 Reverse -20 -37 -9.49926 0.147
NP_440531.1_6 Forward -44 -25 -0.885524 0.225
NP_441965.1_10 Reverse -24 -40 11.6616 0.107
NP_440297.1_9 Forward -35 -25 9.32148 0.0917
NP_440297.1_9 Reverse -28 -38 -0.118297 0.282
NP_442280.1_10 Forward -332 -314 4.87002 0.292
NP_441894.1_1 Reverse -315 -334 -5.21209 0.258
NP_442067.1_3 Reverse -337 -356 14.6508 0.224
NP_440999.1_9 Forward -40 -26 -0.787057 0.217
NP_440888.1_2 Reverse -27 -41 16.8135 0.00536
NP_440888.1_2 Forward -36 -22 15.8302 0.00862
NP_440600.1_4 Forward -44 -26 5.91901 0.104
NP_441543.1_2 Forward -35 -26 16.9127 0.00359
NP_441543.1_2 Reverse -28 -37 16.9127 0.00359
NP_442845.1_2 Reverse -21 -35 4.52282 0.258
NP_441469.1_8 Forward -37 -28 6.48957 0.227
NP_441469.1_8 Reverse -26 -35 6.48957 0.227
NP_442637.1_1 Reverse -70 -89 -3.54046 0.16
NP_442637.1_7 Forward -120 -101 3.73603 0.166
NP_443064.1_6 Forward -36 -26 12.5669 0.0796
NP_443064.1_6 Reverse -27 -37 12.5669 0.0796
NP_442578.1_7 Forward -35 -28 14.5921 0.026
NP_442578.1_7 Reverse -28 -35 14.5921 0.026
NP_440710.1_1 Forward -44 -26 -1.35749 0.179
NP_440710.1_1 Reverse -19 -37 -3.81576 0.208
NP_441462.1_2 Forward -36 -26 11.5831 0.00406
NP_441462.1_2 Reverse -27 -37 11.5831 0.00406
NP_443062.1_1 Forward -36 -18 14.0063 0.0538
NP_440519.1_2 Forward -189 -170 12.1925 0.194
NP_440255.1_8 Reverse -20 -39 13.7525 0.28
NP_440516.1_8 Forward -36 -27 16.9127 0.00442
NP_440516.1_8 Reverse -27 -36 16.9127 0.00442
NP_441033.1_2 Reverse -17 -36 -7.96535 0.293
NP_442428.1_5 Forward -35 -28 15.8704 0.0124
NP_442428.1_5 Reverse -28 -35 15.8704 0.0124
NP_440673.1_2 Reverse -17 -36 10.5847 0.203
NP_440673.1_3 Forward -34 -27 12.4288 0.0426
NP_440673.1_3 Reverse -29 -36 12.4288 0.0426
NP_440673.1_3 Forward -126 -119 10.9539 0.106
NP_441052.1_2 Forward -36 -26 19.9412 0.00106
NP_441052.1_2 Reverse -27 -37 19.9412 0.00106
NP_442219.1_9 Forward -35 -26 17.7976 0.00718
NP_442219.1_9 Reverse -28 -37 17.7976 0.00718
NP_440436.1_4 Forward -35 -26 17.2072 0.00233
NP_440436.1_4 Reverse -28 -37 17.2072 0.00233
NP_441884.1_9 Reverse -24 -43 -23.895 0.284
NP_440314.1_9 Forward -35 -16 10.2259 0.0289
NP_441719.1_4 Forward -35 -28 16.3621 0.0124
NP_441719.1_4 Reverse -28 -35 16.3621 0.0124
NP_441115.1_4 Reverse -118 -136 7.58986 0.279
NP_442694.1_4 Forward -75 -66 14.8477 0.164
NP_442694.1_4 Reverse -341 -350 11.0128 0.286
NP_441851.1_10 Forward -37 -27 15.8113 0.00552
NP_441851.1_10 Reverse -26 -36 15.8113 0.00552
NP_442001.1_1 Forward -121 -102 -5.31116 0.276
NP_441354.1_1 Reverse -70 -89 4.22769 0.213
NP_441542.1_4 Forward -153 -139 9.73436 0.25
NP_441668.1_4 Reverse -17 -36 3.04771 0.188
NP_442515.1_1 Reverse -26 -40 20.3541 0.0162
NP_442515.1_1 Forward -37 -23 18.7808 0.0192
NP_441982.1_6 Reverse -381 -390 13.2493 0.274
NP_441982.1_6 Reverse -366 -375 11.9124 0.288
NP_441349.1_10 Reverse -17 -36 -5.21209 0.194
NP_440874.1_2 Forward -118 -99 20.5519 0.0141
NP_440432.1_9 Forward -35 -20 8.33803 0.0427
NP_440432.1_9 Reverse -28 -43 4.50312 0.0691
NP_440474.1_8 Forward -35 -21 4.62054 0.271
NP_442450.1_5 Reverse -25 -35 9.32148 0.115
NP_441031.1_1 Reverse -261 -280 9.32929 0.212
NP_439950.1_3 Reverse -76 -95 3.14605 0.293
NP_443047.1_7 Forward -35 -16 5.01433 0.246
NP_442243.1_1 Forward -42 -24 1.5917 0.21
NP_441570.1_1 Forward -36 -18 -0.669169 0.0498
NP_441570.1_1 Reverse -27 -45 -15.0255 0.227
NP_441078.1_4 Forward -36 -27 19.6659 0.0007
NP_441078.1_4 Reverse -27 -36 19.6659 0.0007
NP_442729.1_8 Forward -40 -27 10.639 0.125
NP_442729.1_8 Reverse -23 -36 10.1474 0.125
NP_442348.1_2 Forward -75 -66 6.68623 0.299
NP_440526.1_3 Reverse -28 -39 1.04151 0.267
NP_440526.1_3 Forward -35 -24 0.943182 0.267
NP_441432.1_8 Reverse -26 -35 16.8143 0.00595
NP_441432.1_8 Forward -37 -28 16.8143 0.00595
NP_441432.1_9 Forward -102 -89 11.604 0.221
NP_441432.1_9 Forward -400 -387 7.91967 0.298
NP_441333.1_1 Forward -69 -59 12.9245 0.217
NP_442320.1_8 Reverse -21 -35 11.6026 0.0179
NP_442320.1_8 Forward -42 -28 -4.52363 0.171
NP_441732.1_2 Reverse -23 -39 -16.5594 0.174
NP_440760.1_1 Reverse -27 -46 -5.60541 0.0503
NP_440760.1_1 Forward -36 -17 -20.65 0.224
NP_440199.1_10 Reverse -24 -34 7.64985 0.231
NP_442489.1_7 Forward -36 -27 20.1576 0.000695
NP_442489.1_7 Reverse -27 -36 20.1576 0.000695
NP_440386.1_3 Reverse -100 -119 -4.72043 0.221
NP_442079.1_7 Forward -35 -16 9.73422 0.111
NP_440559.1_1 Forward -35 -26 17.4043 0.00658
NP_440559.1_1 Reverse -28 -37 17.4043 0.00658
NP_441659.2_8 Forward -36 -26 18.1713 0.00133
NP_441659.2_8 Reverse -27 -37 18.1713 0.00133
NP_442913.1_10 Reverse -18 -37 -0.000545616 0.156
NP_442346.1_5 Forward -37 -27 16.6963 0.00248
NP_442346.1_5 Reverse -26 -36 16.6963 0.00248
NP_442346.1_5 Reverse -118 -128 7.35486 0.172
NP_440025.1_3 Forward -31 -17 9.44903 0.296
NP_440459.1_2 Reverse -25 -42 8.10198 0.27
NP_441653.1_2 Forward -47 -28 5.07576 0.248
NP_442603.1_7 Reverse -27 -41 17.8952 0.0187
NP_442603.1_7 Forward -36 -22 8.84875 0.162
NP_441833.1_4 Forward -35 -28 15.9687 0.0124
NP_441833.1_4 Reverse -28 -35 15.9687 0.0124
NP_441329.1_3 Reverse -347 -357 15.3887 0.25
NP_441329.1_6 Reverse -50 -69 5.1084 0.191
NP_441329.1_6 Reverse -52 -71 -3.00842 0.294
NP_440912.1_3 Forward -72 -53 10.52 0.254
NP_442162.1_9 Forward -35 -28 16.2637 0.0124
NP_442162.1_9 Reverse -28 -35 16.2637 0.0124
NP_442140.1_3 Reverse -28 -38 10.3048 0.0902
NP_442140.1_3 Forward -35 -25 4.40493 0.243
NP_441692.1_2 Reverse -81 -100 34.317 0.000000227
NP_441813.1_5 Forward -38 -28 18.1713 0.00743
NP_441813.1_5 Reverse -25 -35 15.9097 0.01
NP_440590.1_4 Reverse -28 -41 9.75405 0.0335
NP_440590.1_4 Forward -35 -22 -6.07724 0.299
NP_440567.1_1 Forward -35 -21 3.53951 0.141
NP_442497.1_10 Forward -35 -26 10.4228 0.0087
NP_442497.1_10 Reverse -28 -37 10.4228 0.0087
NP_440821.1_4 Reverse -25 -35 18.2696 0.00448
NP_440821.1_4 Forward -38 -28 9.41981 0.0286
NP_441239.1_9 Forward -38 -26 5.25052 0.223
NP_441239.1_9 Reverse -25 -37 4.36554 0.253
NP_442568.1_5 Reverse -319 -338 13.0775 0.177
NP_440796.1_3 Reverse -20 -38 10.4414 0.204
NP_440219.1_4 Forward -173 -160 15.829 0.223
NP_441017.1_6 Reverse -23 -37 13.1753 0.203
NP_440354.1_7 Forward -42 -24 5.91901 0.296
NP_442138.1_10 Forward -36 -17 -7.17871 0.286
NP_440546.1_4 Forward -36 -26 10.046 0.109
NP_440546.1_4 Reverse -27 -37 10.046 0.109
NP_440546.1_4 Reverse -333 -343 7.33119 0.246
NP_440462.1_6 Forward -38 -28 9.61647 0.0429
NP_440462.1_6 Reverse -25 -35 7.74818 0.0699
NP_440868.1_4 Forward -40 -28 9.97041 0.0405
NP_440868.1_4 Reverse -23 -35 5.84051 0.0879
NP_441848.1_7 Forward -109 -90 0.195343 0.228
NP_441084.1_6 Reverse -374 -388 9.05325 0.295
NP_442358.1_1 Reverse -19 -37 21.7503 0.0326
NP_442039.1_4 Forward -35 -28 15.1821 0.0124
NP_442039.1_4 Reverse -28 -35 15.1821 0.0124
NP_442679.1_1 Reverse -318 -337 -4.03212 0.269
NP_441926.1_3 Forward -36 -20 5.6634 0.17
NP_442837.1_3 Forward -35 -28 15.7721 0.0124
NP_442837.1_3 Reverse -28 -35 15.7721 0.0124
NP_442053.1_1 Forward -36 -27 18.3876 0.0007
NP_442053.1_1 Reverse -27 -36 18.3876 0.0007
NP_440505.1_3 Forward -38 -28 18.3679 0.00213
NP_440505.1_3 Reverse -25 -35 16.303 0.00696
NP_441701.1_3 Reverse -335 -352 6.03703 0.294
NP_441959.1_8 Forward -116 -103 10.4446 0.286
NP_441203.1_1 Forward -35 -16 -14.9469 0.208
NP_440013.1_2 Reverse -223 -237 16.1259 0.176
NP_442532.1_1 Reverse -55 -69 11.8628 0.215
NP_440914.1_1 Forward -36 -26 17.5935 0.000537
NP_440914.1_1 Reverse -27 -37 17.5935 0.000537
NP_441699.1_7 Reverse -143 -162 4.12856 0.255
NP_441011.1_8 Forward -35 -26 8.25953 0.144
NP_441011.1_8 Reverse -28 -37 8.25953 0.144
NP_442101.1_6 Reverse -339 -358 11.0125 0.29
NP_442101.1_10 Reverse -19 -38 -10.4236 0.255
NP_442533.1_6 Forward -36 -27 17.2076 0.00137
NP_442533.1_6 Reverse -27 -36 17.2076 0.00137
NP_443016.1_1 Reverse -21 -40 -4.72043 0.235
NP_441482.1_7 Forward -42 -28 -2.85201 0.1
NP_441482.1_7 Reverse -21 -35 -3.44199 0.124
NP_439944.1_9 Forward -35 -25 19.0562 0.00329
NP_439944.1_9 Reverse -28 -38 10.5014 0.0887
NP_441028.1_6 Forward -23 -13 7.94438 0.217
NP_441527.1_4 Reverse -89 -108 0.715766 0.134
NP_441527.1_4 Reverse -4 -23 -5.49121 0.202
NP_441527.1_4 Reverse -317 -336 -6.25514 0.215
NP_441527.1_4 Reverse -328 -347 -9.1199 0.255
NP_441527.1_4 Reverse -314 -333 -11.2207 0.278
NP_441527.1_7 Forward -346 -327 6.88182 0.298
NP_440115.1_6 Forward -39 -29 6.76487 0.167
NP_442673.1_7 Forward -70 -51 16.6629 0.13
NP_441972.1_5 Reverse -28 -47 -8.85033 0.272
NP_441106.1_1 Forward -37 -28 9.63616 0.0311
NP_441106.1_1 Reverse -26 -35 9.63616 0.0311
NP_441825.1_4 Forward -76 -66 13.8447 0.249
NP_442306.1_10 Forward -41 -22 -19.8634 0.201
NP_441286.1_1 Forward -37 -25 21.3768 0.00196
NP_441286.1_1 Reverse -26 -38 12.9203 0.00815
NP_440670.1_8 Forward -36 -27 18.3876 0.000699
NP_440670.1_8 Reverse -27 -36 18.3876 0.000699
NP_440886.1_7 Forward -37 -27 7.94438 0.0805
NP_440886.1_7 Reverse -26 -36 7.94438 0.0805
NP_442614.1_2 Reverse -27 -41 8.94771 0.242
NP_442072.1_9 Reverse -26 -44 -21.712 0.212
NP_441021.1_1 Forward -35 -16 -12.9802 0.3
NP_440326.1_9 Forward -363 -344 11.8967 0.274
NP_440326.1_9 Forward -118 -99 11.5033 0.274
NP_441463.1_3 Reverse -17 -36 1.37609 0.127
NP_441463.1_6 Reverse -25 -39 8.0587 0.25
NP_442842.1_10 Forward -109 -90 5.22221 0.207
NP_442061.1_6 Forward -253 -243 16.1063 0.27
NP_441626.1_2 Forward -35 -28 15.7721 0.0124
NP_441626.1_2 Reverse -28 -35 15.7721 0.0124
NP_439958.1_2 Reverse -96 -110 17.5025 0.115
NP_442365.1_7 Forward -40 -21 9.63589 0.0723
NP_442365.1_7 Forward -34 -15 -2.65548 0.202
NP_442238.1_7 Forward -147 -128 10.7167 0.201
NP_442794.1_1 Forward -40 -28 7.31547 0.142
NP_442794.1_1 Reverse -23 -35 7.11881 0.148
NP_442615.1_1 Forward -45 -27 -4.70074 0.192
NP_440387.1_1 Forward -36 -20 14.6115 0.00635
NP_440387.1_1 Reverse -27 -43 -4.75968 0.198
NP_441836.1_2 Forward -189 -170 0.786102 0.197
NP_441836.1_2 Reverse -21 -40 -6.39206 0.297
NP_440114.1_10 Forward -36 -22 6.3911 0.273
NP_440114.1_10 Reverse -27 -41 6.09611 0.285
NP_441425.1_2 Forward -171 -152 13.0324 0.247
NP_442698.1_10 Reverse -53 -72 7.86593 0.233
NP_442087.1_2 Reverse -27 -46 16.3099 0.133
NP_442087.1_7 Forward -86 -67 -3.73788 0.285
NP_440293.1_9 Forward -251 -237 13.1803 0.216
NP_439910.1_2 Reverse -19 -36 -21.594 0.183
NP_440457.1_1 Reverse -23 -35 0.0389777 0.25
NP_440457.1_1 Forward -40 -28 -0.74767 0.273
NP_442680.1_5 Reverse -83 -102 4.07754 0.227
NP_442297.1_10 Reverse -85 -104 17.404 0.11
NP_440054.1_4 Reverse -368 -387 14.4541 0.135
NP_441332.1_6 Forward -19 -9 12.6149 0.221
NP_442509.1_9 Forward -36 -26 8.14104 0.192
NP_442509.1_9 Reverse -27 -37 8.14104 0.192
NP_441489.1_3 Reverse -93 -107 8.79688 0.232
NP_442582.1_3 Forward -156 -142 12.6166 0.284
NP_441765.1_8 Forward -125 -106 18.9765 0.0776
NP_440554.1_4 Reverse -28 -38 8.92815 0.0646
NP_440554.1_4 Forward -35 -25 7.05986 0.106
NP_442862.1_3 Forward -146 -129 6.13536 0.267
NP_441885.1_5 Forward -36 -26 20.9245 0.000538
NP_441885.1_5 Reverse -27 -37 20.9245 0.000538
NP_441275.1_3 Reverse -137 -151 21.5341 0.0286
NP_440628.1_1 Reverse -57 -67 13.6803 0.279
NP_442703.1_8 Forward -338 -320 10.7364 0.266
NP_442341.1_7 Forward -37 -23 7.66941 0.0994
NP_442341.1_7 Reverse -26 -40 6.78443 0.118
NP_440423.1_6 Reverse -19 -38 -15.5368 0.229
NP_443000.1_7 Forward -38 -28 19.9412 0.00223
NP_443000.1_7 Reverse -25 -35 17.0896 0.00865
NP_440507.2_3 Reverse -18 -37 9.63507 0.218
NP_440275.1_3 Forward -38 -28 15.123 0.0182
NP_440275.1_3 Reverse -25 -35 8.1415 0.0602
NP_440091.1_1 Reverse -23 -35 7.11881 0.0874
NP_442451.1_2 Forward -44 -25 -7.17871 0.232
NP_441635.1_2 Reverse -75 -94 10.074 0.283
NP_441207.1_7 Reverse -100 -114 8.67452 0.282
NP_441207.1_7 Forward -172 -158 7.7064 0.295
NP_440258.1_3 Forward -381 -362 -1.37718 0.18
NP_440175.1_7 Forward -102 -84 8.97275 0.282
NP_440149.1_8 Reverse -27 -46 13.9625 0.0273
NP_440149.1_8 Forward -36 -17 -2.85214 0.176
NP_440216.1_1 Reverse -27 -41 8.94771 0.00589
NP_440216.1_1 Forward -36 -22 -2.85201 0.0608
NP_440216.1_9 Reverse -316 -325 5.3096 0.298
NP_440172.1_1 Forward -36 -26 15.0247 0.00945
NP_440172.1_1 Reverse -27 -37 15.0247 0.00945
NP_442015.1_10 Forward -40 -27 2.67422 0.187
NP_442015.1_10 Reverse -23 -36 0.510939 0.224
NP_441226.1_7 Forward -35 -28 14.4934 0.0123
NP_441226.1_7 Reverse -28 -35 14.4934 0.0123
NP_441757.1_3 Reverse -26 -45 0.491109 0.188
NP_441111.1_7 Forward -35 -27 18.7023 0.00294
NP_441111.1_7 Reverse -28 -36 18.7023 0.00294
NP_442379.1_10 Reverse -20 -37 -3.20608 0.252
NP_441766.1_2 Forward -36 -27 17.5026 0.00297
NP_441766.1_2 Reverse -27 -36 17.5026 0.00297
NP_443052.1_8 Reverse -17 -36 7.96426 0.026
NP_442116.1_6 Reverse -166 -183 10.7472 0.215
NP_442116.1_6 Reverse -100 -117 5.87715 0.289
NP_440261.1_5 Reverse -28 -41 6.90245 0.0316
NP_440988.1_10 Reverse -25 -39 7.51277 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTTCCTTCCTTTTCGACAATTCCTTTTTTAAGGAAAATATTATTTCTCTAAAAACTCCCACATCCCTTTTTTTGCTTGCCTTTGAGAATGTAGATATATCGACTGTCTCTCCTCGTAAGTTCAGTCTTTTAAACATACTCCTCATGCTTGTCTGGCTCTGGTCTAACACTAATCCTAACCAGATACTCACAAACTTAAATGTGTCTAATACTGGGTAGTCATCTTTAGGAAAATTAGATAGATAAGTTTTGACAATATGTCCAAAATTTGATATCATCGCTTCAATTATTCTAATATTTCTGCCCTTTATTCTATCATTTTAAAGGGCTTTTTTTCTCTTTATAACTATCGTTCAACACTTCTGGCGATCGCCATATTGTCCCCCTTACCCTGTTTACC

CDS

ATGACCAAGCGTAGTAATTTGGATTCTAACCACATTATTTATCGTTCCGAAGAGCTCCTAGGAGCCGCATCAAACCGCTACAACATTACTGTCAGGGTAGCCAAGCGAGCCAAGGAAAATCGCTCCGAAGATTTTGACAGCATTGACGATCCCAACATGAAGCCGGCTATCCGGGCCATCATTGAAATGTCCGACGAGCTCACCCGCCCAGAAATTATTAGCGATAATTAA

Protein

MTKRSNLDSNHIIYRSEELLGAASNRYNITVRVAKRAKENRSEDFDSIDDPNMKPAIRAIIEMSDELTRPEIISDN