Your browser is old and dusty. Try Google Chrome!

Details for ssl2923

ORF ssl2923
Accession NP_440332.1
Symbol vapC
Category Transformation
Definition similar to virulence-associated protein VapC
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -272 -265 14.6904 0.0123
NP_440795.1_7 Reverse -265 -272 14.6904 0.0123
NP_442291.1_5 Forward -274 -258 6.74504 0.0689
NP_442272.1_2 Forward -294 -275 11.4109 0.232
NP_440897.1_6 Reverse -264 -283 1.47364 0.17
NP_441453.1_4 Reverse -264 -272 16.539 0.00633
NP_441453.1_4 Forward -273 -265 16.539 0.00633
NP_441453.1_4 Forward -207 -199 5.52596 0.127
NP_442151.1_6 Forward -273 -259 13.3726 0.0528
NP_442151.1_6 Reverse -264 -278 8.94771 0.162
NP_441818.1_1 Forward -272 -261 9.79292 0.232
NP_440226.1_1 Forward -273 -254 10.1275 0.0654
NP_440226.1_1 Reverse -264 -283 4.32602 0.196
NP_440226.1_1 Reverse -157 -176 2.55606 0.259
NP_441342.1_2 Reverse -260 -274 10.7177 0.209
NP_441098.1_3 Reverse -298 -317 -2.38658 0.28
NP_441098.1_3 Forward -149 -130 -5.83193 0.28
NP_440996.1_1 Forward -68 -49 11.9031 0.261
NP_442173.1_1 Forward -272 -264 15.4574 0.00633
NP_442173.1_1 Reverse -265 -273 15.4574 0.00633
NP_442752.1_4 Forward -273 -266 13.8055 0.0199
NP_442752.1_4 Reverse -264 -271 13.8055 0.0199
NP_443027.1_4 Forward -275 -265 5.87989 0.294
NP_442975.1_10 Forward -277 -263 10.5204 0.0541
NP_442975.1_10 Reverse -260 -274 1.76896 0.291
NP_440784.1_7 Forward -272 -265 15.9687 0.0123
NP_440784.1_7 Reverse -265 -272 15.9687 0.0123
NP_442909.1_7 Forward -272 -258 21.5334 0.0161
NP_441681.1_8 Forward -323 -304 21.2389 0.0853
NP_440061.1_9 Forward -275 -261 12.192 0.0999
NP_441054.1_4 Forward -283 -265 -0.669169 0.187
NP_442062.1_8 Reverse -264 -274 19.4496 0.000558
NP_442062.1_8 Forward -273 -263 17.3846 0.00193
NP_441859.1_3 Forward -208 -189 11.6017 0.107
NP_440304.1_4 Forward -239 -229 9.81313 0.0524
NP_440304.1_4 Forward -354 -344 2.7333 0.299
NP_440304.1_4 Forward -275 -265 1.84832 0.299
NP_440304.1_4 Reverse -262 -272 1.84832 0.299
NP_442242.1_4 Forward -272 -265 14.3954 0.0124
NP_442242.1_4 Reverse -265 -272 14.3954 0.0124
NP_440044.1_8 Forward -272 -253 16.8141 0.0221
NP_441200.1_4 Reverse -248 -267 5.01433 0.299
NP_441208.1_9 Reverse -261 -275 6.78443 0.229
NP_440370.1_10 Reverse -255 -274 17.7974 0.0586
NP_442110.1_7 Forward -273 -259 -0.492064 0.291
NP_441083.1_5 Forward -273 -263 20.3345 0.00053
NP_441083.1_5 Reverse -264 -274 11.3864 0.0159
NP_441434.1_6 Forward -354 -344 13.648 0.296
NP_441738.1_2 Forward -271 -264 15.28 0.0102
NP_441738.1_2 Reverse -266 -273 15.28 0.0102
NP_441558.1_5 Reverse -196 -215 8.94757 0.135
NP_440209.1_1 Reverse -264 -272 18.1123 0.00295
NP_440209.1_1 Forward -273 -265 18.1123 0.00295
NP_440209.1_1 Reverse -157 -165 5.0343 0.194
NP_442889.1_8 Forward -276 -262 20.8451 0.00339
NP_442889.1_8 Reverse -154 -168 12.5853 0.0611
NP_441713.1_1 Forward -279 -260 -14.0619 0.257
NP_440178.1_7 Forward -274 -255 6.78429 0.013
NP_440178.1_7 Reverse -263 -282 -20.2567 0.188
NP_441716.1_1 Forward -273 -259 4.71948 0.252
NP_441716.1_2 Forward -148 -129 1.25016 0.254
NP_441716.1_2 Reverse -40 -59 0.197422 0.265
NP_441327.1_4 Forward -173 -159 19.6658 0.282
NP_442111.1_4 Reverse -263 -277 9.34103 0.0609
NP_440906.1_5 Forward -272 -265 15.8704 0.0124
NP_440906.1_5 Reverse -265 -272 15.8704 0.0124
NP_440906.1_5 Forward -165 -158 8.20058 0.19
NP_440747.1_10 Reverse -261 -273 14.9853 0.00221
NP_440747.1_10 Forward -276 -264 5.34885 0.0141
NP_440747.1_10 Forward -169 -157 -4.58258 0.109
NP_441130.1_10 Forward -209 -195 7.86607 0.146
NP_442973.1_5 Reverse -334 -353 11.2092 0.251
NP_441486.1_1 Reverse -261 -275 22.5174 0.00162
NP_441486.1_1 Forward -276 -262 14.1593 0.00654
NP_440470.1_5 Forward -79 -60 5.39487 0.299
NP_441014.1_10 Reverse -120 -139 -2.75457 0.287
NP_442848.1_1 Reverse -258 -272 7.76774 0.0791
NP_443018.1_3 Forward -272 -265 14.8871 0.0123
NP_443018.1_3 Reverse -265 -272 14.8871 0.0123
NP_443018.1_3 Forward -206 -199 10.6589 0.0967
NP_443018.1_3 Reverse -199 -206 4.16902 0.278
NP_441634.1_8 Reverse -262 -276 -3.04867 0.295
NP_441182.1_1 Forward -210 -194 10.4816 0.28
NP_440376.1_1 Forward -273 -264 19.4693 0.000692
NP_440376.1_1 Reverse -264 -273 19.4693 0.000692
NP_440376.1_1 Forward -38 -29 3.04799 0.21
NP_441588.1_4 Reverse -266 -276 14.238 0.0773
NP_441588.1_4 Forward -271 -261 8.92815 0.14
NP_442687.1_7 Forward -274 -264 15.8113 0.0125
NP_442687.1_7 Reverse -263 -273 8.92815 0.0994
NP_442687.1_7 Reverse -197 -207 4.10993 0.266
NP_440642.1_10 Reverse -353 -367 5.1122 0.242
NP_441422.1_7 Forward -275 -258 5.54538 0.0992
NP_440360.1_2 Reverse -168 -182 15.3392 0.297
NP_440360.1_10 Forward -205 -191 14.7492 0.0992
NP_442658.1_1 Forward -275 -265 15.9091 0.00966
NP_442658.1_1 Forward -209 -199 7.35439 0.214
NP_442658.1_1 Reverse -262 -272 6.76441 0.214
NP_442198.1_3 Forward -282 -263 2.85105 0.297
NP_442205.1_9 Reverse -258 -274 -1.21977 0.264
NP_441414.1_9 Reverse -264 -283 26.8438 0.00146
NP_441414.1_9 Forward -273 -254 -9.44032 0.259
NP_441487.1_9 Forward -274 -255 20.8456 0.0255
NP_442937.1_5 Reverse -259 -278 13.9625 0.0859
NP_442937.1_5 Reverse -218 -237 9.63589 0.185
NP_442937.1_5 Reverse -187 -206 6.19431 0.286
NP_441958.1_5 Forward -274 -264 12.2714 0.00183
NP_441958.1_5 Reverse -263 -273 12.2714 0.00183
NP_441958.1_5 Reverse -197 -207 -2.6749 0.28
NP_440203.1_5 Reverse -86 -96 12.2709 0.16
NP_439905.1_1 Reverse -265 -278 10.4424 0.216
NP_440984.1_7 Forward -278 -264 21.0424 0.00311
NP_440984.1_7 Reverse -259 -273 7.86607 0.161
NP_442690.1_1 Reverse -115 -134 -10.7186 0.218
NP_442911.1_2 Forward -283 -264 3.73603 0.042
NP_442911.1_2 Reverse -254 -273 -3.44213 0.112
NP_441580.1_6 Forward -284 -265 -5.80207 0.235
NP_440153.1_5 Forward -272 -258 2.65453 0.219
NP_443055.1_6 Reverse -256 -274 -0.0799167 0.252
NP_440602.1_8 Forward -398 -384 10.3243 0.282
NP_440138.1_6 Forward -206 -187 7.07848 0.215
NP_442002.1_9 Forward -274 -267 10.7572 0.185
NP_441294.1_7 Reverse -260 -274 9.15464 0.256
NP_442438.1_10 Reverse -259 -273 2.75286 0.168
NP_442431.1_10 Reverse -217 -235 -0.570838 0.29
NP_441000.1_6 Forward -274 -260 2.94952 0.123
NP_440147.1_4 Forward -275 -262 12.704 0.0326
NP_440147.1_4 Reverse -262 -275 10.1474 0.0355
NP_441550.1_8 Reverse -262 -272 14.6309 0.0132
NP_441550.1_8 Reverse -196 -206 12.1726 0.0361
NP_441550.1_8 Forward -275 -265 8.3377 0.124
NP_441916.1_7 Reverse -264 -274 18.4663 0.00144
NP_441916.1_7 Forward -273 -263 10.3048 0.0261
NP_440345.1_3 Forward -115 -101 15.1948 0.213
NP_441041.1_4 Reverse -264 -283 0.786102 0.0837
NP_441041.1_4 Forward -273 -254 -5.9004 0.16
NP_441041.1_7 Forward -276 -264 9.55551 0.109
NP_442396.1_5 Forward -277 -264 18.8988 0.0167
NP_442004.1_6 Forward -273 -259 9.83269 0.14
NP_441725.1_5 Forward -272 -262 2.04498 0.115
NP_441725.1_5 Reverse -265 -275 2.04498 0.115
NP_439966.1_7 Forward -275 -265 9.91099 0.0968
NP_439966.1_7 Reverse -262 -272 7.25606 0.15
NP_439966.1_9 Forward -275 -266 0.884706 0.253
NP_442941.1_3 Forward -272 -262 11.0914 0.0116
NP_442941.1_3 Reverse -265 -275 2.63497 0.14
NP_440289.1_2 Forward -276 -263 3.06754 0.0811
NP_442281.1_1 Forward -278 -264 11.1104 0.0507
NP_442281.1_1 Reverse -259 -273 8.06211 0.0869
NP_442281.1_1 Forward -212 -198 3.24392 0.238
NP_001035871.2_2 Forward -140 -121 15.2468 0.296
NP_442012.1_1 Forward -279 -260 3.6377 0.179
NP_441556.1_10 Reverse -259 -273 9.6378 0.294
NP_440498.1_1 Forward -282 -264 8.08229 0.0795
NP_440375.1_8 Reverse -265 -284 10.1275 0.138
NP_440375.1_9 Reverse -367 -386 19.5698 0.119
NP_441644.1_6 Forward -273 -263 17.3841 0.00127
NP_441644.1_6 Reverse -264 -274 10.1076 0.0628
NP_441644.1_6 Forward -207 -197 8.92768 0.0895
NP_442215.1_2 Reverse -262 -278 7.13836 0.0694
NP_442215.1_2 Forward -275 -259 -1.61309 0.186
NP_442215.1_2 Reverse -81 -97 -4.07137 0.227
NP_442247.1_8 Reverse -262 -276 8.65272 0.266
NP_440929.1_8 Forward -273 -264 19.2726 0.000701
NP_440929.1_8 Reverse -264 -273 19.2726 0.000701
NP_442933.1_10 Forward -273 -264 17.601 0.00325
NP_442933.1_10 Reverse -264 -273 17.601 0.00325
NP_442554.1_8 Forward -272 -262 15.3197 0.00882
NP_442554.1_8 Reverse -265 -275 13.2547 0.0187
NP_442554.1_8 Reverse -199 -209 2.92996 0.249
NP_442554.1_8 Forward -206 -196 2.7333 0.259
NP_441762.1_7 Reverse -263 -275 10.1671 0.0142
NP_441762.1_7 Forward -274 -262 9.57708 0.0142
NP_442142.1_4 Reverse -261 -274 5.62358 0.187
NP_442142.1_4 Forward -276 -263 4.64028 0.214
NP_442292.1_1 Forward -272 -263 18.486 0.00229
NP_442292.1_1 Reverse -265 -274 9.63616 0.0183
NP_442476.1_6 Reverse -265 -279 15.0442 0.0371
NP_442476.1_6 Forward -272 -258 1.67122 0.207
NP_443009.1_5 Reverse -263 -274 18.3477 0.00265
NP_441715.1_4 Reverse -265 -275 9.41981 0.097
NP_441715.1_4 Forward -272 -262 7.94484 0.107
NP_440464.1_10 Forward -272 -262 13.0082 0.169
NP_441468.1_1 Forward -272 -265 15.8704 0.0124
NP_441468.1_1 Reverse -265 -272 15.8704 0.0124
NP_441468.1_1 Forward -206 -199 3.97235 0.277
NP_441015.1_10 Reverse -259 -278 5.70265 0.112
NP_441673.1_1 Forward -273 -264 20.8459 0.000698
NP_441673.1_1 Reverse -264 -273 20.8459 0.000698
NP_441096.1_5 Reverse -347 -365 15.7513 0.297
NP_442811.1_2 Reverse -184 -203 -2.16383 0.281
NP_441637.1_9 Forward -194 -176 6.90232 0.245
NP_442868.1_6 Reverse -262 -272 9.81313 0.038
NP_442868.1_6 Forward -275 -265 0.865012 0.205
NP_442719.1_2 Forward -75 -57 -7.94636 0.239
NP_442719.1_3 Forward -351 -338 15.26 0.292
NP_441056.1_1 Forward -273 -254 -5.60541 0.262
NP_441612.1_2 Forward -273 -263 8.54929 0.21
NP_442427.1_8 Forward -282 -263 9.53756 0.18
NP_442808.1_1 Forward -274 -264 18.4657 0.00201
NP_442808.1_1 Reverse -263 -273 8.63269 0.0481
NP_440145.1_3 Reverse -254 -273 12.0942 0.0316
NP_442050.1_5 Reverse -262 -272 7.64939 0.243
NP_440334.1_1 Reverse -331 -350 13.8937 0.298
NP_442792.1_6 Reverse -247 -266 2.75272 0.282
NP_441878.1_6 Forward -274 -264 10.4031 0.0176
NP_441878.1_6 Reverse -263 -273 10.4031 0.0176
NP_441036.1_8 Forward -274 -264 17.7779 0.000554
NP_441036.1_8 Reverse -263 -273 8.33817 0.174
NP_442650.1_2 Forward -273 -259 6.09611 0.134
NP_441557.1_5 Forward -273 -264 19.9609 0.000699
NP_441557.1_5 Reverse -264 -273 19.9609 0.000699
NP_441445.1_1 Reverse -255 -274 17.5024 0.0319
NP_442066.2_9 Forward -277 -264 11.4257 0.154
NP_442183.1_1 Reverse -264 -278 5.1128 0.231
NP_441574.1_1 Reverse -252 -271 -2.45882 0.226
NP_441574.1_1 Forward -285 -266 -4.72043 0.254
NP_442347.1_2 Forward -272 -263 12.4878 0.056
NP_442347.1_2 Reverse -265 -274 11.1111 0.056
NP_442645.1_2 Reverse -256 -275 26.2538 0.000248
NP_442645.1_2 Forward -281 -262 -12.5869 0.144
NP_442645.1_2 Forward -174 -155 -22.5183 0.291
NP_441037.1_4 Forward -275 -265 14.7245 0.028
NP_441037.1_4 Reverse -262 -272 7.9999 0.237
NP_441633.1_3 Reverse -262 -275 8.57408 0.0377
NP_441633.1_3 Forward -275 -262 3.46087 0.0699
NP_441633.1_3 Forward -381 -368 -2.43899 0.177
NP_440136.1_2 Forward -272 -265 15.9687 0.0123
NP_440136.1_2 Reverse -265 -272 15.9687 0.0123
NP_442998.1_10 Forward -271 -264 15.5754 0.0102
NP_442998.1_10 Reverse -266 -273 15.5754 0.0102
NP_442998.1_10 Forward -164 -157 12.5271 0.0457
NP_440299.1_1 Forward -277 -264 10.8351 0.0529
NP_440299.1_1 Reverse -260 -273 10.3434 0.0573
NP_440299.1_1 Forward -170 -157 5.52525 0.172
NP_441799.1_1 Reverse -260 -274 19.8618 0.00596
NP_441799.1_1 Forward -277 -263 14.5519 0.0228
NP_441007.1_10 Forward -278 -265 1.59258 0.203
NP_441007.1_10 Reverse -259 -272 1.39592 0.203
NP_442201.1_10 Reverse -253 -272 -4.72043 0.152
NP_442201.1_10 Forward -284 -265 -11.8003 0.268
NP_440256.1_1 Reverse -261 -280 -9.14533 0.275
NP_440087.1_1 Reverse -255 -274 -8.85033 0.285
NP_441464.1_8 Forward -273 -259 9.04604 0.192
NP_442150.1_2 Reverse -253 -272 15.959 0.285
NP_440306.1_9 Reverse -256 -275 10.7175 0.253
NP_440695.1_6 Forward -68 -54 10.7022 0.265
NP_442386.1_9 Forward -274 -265 15.7322 0.0144
NP_442386.1_9 Reverse -263 -272 13.8639 0.0289
NP_442386.1_9 Forward -208 -199 10.8157 0.116
NP_441340.1_5 Forward -272 -265 15.6737 0.0124
NP_441340.1_5 Reverse -265 -272 15.6737 0.0124
NP_441340.1_5 Reverse -199 -206 11.3472 0.0526
NP_441271.1_10 Reverse -251 -270 15.0441 0.278
NP_440168.1_9 Forward -218 -199 -0.295539 0.273
NP_442714.1_7 Forward -272 -253 1.17943 0.226
NP_440586.1_8 Forward -272 -265 13.2151 0.026
NP_440586.1_8 Reverse -265 -272 13.2151 0.026
NP_440586.1_8 Forward -197 -190 7.02027 0.279
NP_440586.1_8 Forward -206 -199 5.74197 0.283
NP_442251.1_6 Forward -272 -265 15.2804 0.0124
NP_442251.1_6 Reverse -265 -272 15.2804 0.0124
NP_440684.1_9 Reverse -258 -272 7.9644 0.246
NP_441262.1_3 Reverse -264 -271 14.7888 0.0223
NP_441262.1_3 Forward -273 -266 14.7888 0.0223
NP_443051.1_1 Reverse -263 -272 10.4228 0.00754
NP_443051.1_1 Forward -274 -265 10.4228 0.00754
NP_443051.1_1 Reverse -197 -206 3.24465 0.123
NP_439984.1_3 Reverse -257 -271 12.0937 0.281
NP_439937.1_8 Forward -209 -190 -4.22878 0.28
NP_440439.1_1 Reverse -261 -274 2.57589 0.131
NP_440372.1_2 Forward -272 -265 16.3621 0.0124
NP_440372.1_2 Reverse -265 -272 16.3621 0.0124
NP_441138.1_5 Forward -63 -50 12.1892 0.192
NP_441803.1_2 Forward -278 -259 -0.197208 0.269
NP_442416.1_8 Forward -325 -307 18.6058 0.291
NP_441572.1_7 Forward -279 -260 -3.83545 0.22
NP_442384.1_10 Reverse -264 -277 14.1789 0.0163
NP_442384.1_10 Forward -273 -260 10.049 0.047
NP_442262.1_10 Forward -272 -265 14.1988 0.0123
NP_442262.1_10 Reverse -265 -272 14.1988 0.0123
NP_442262.1_10 Forward -206 -199 12.0355 0.062
NP_441689.1_5 Reverse -262 -272 5.78111 0.197
NP_440344.1_10 Forward -280 -263 -7.13932 0.115
NP_441965.1_3 Reverse -254 -273 -1.67217 0.29
NP_441965.1_10 Forward -276 -260 3.99177 0.252
NP_441965.1_10 Forward -36 -20 3.50012 0.263
NP_441965.1_10 Reverse -261 -277 2.51681 0.287
NP_440297.1_9 Forward -272 -262 -0.118297 0.282
NP_440297.1_9 Reverse -265 -275 -0.118297 0.282
NP_440297.1_9 Forward -206 -196 -0.314959 0.282
NP_440350.1_5 Reverse -352 -371 7.37428 0.134
NP_441103.1_2 Forward -103 -85 20.7661 0.101
NP_440999.1_9 Forward -277 -263 2.16287 0.154
NP_440888.1_2 Reverse -264 -278 8.84875 0.145
NP_440888.1_2 Forward -273 -259 8.25877 0.167
NP_440052.1_5 Forward -284 -265 14.5524 0.0714
NP_440052.1_5 Reverse -146 -165 -3.44213 0.235
NP_442277.1_7 Reverse -331 -347 0.293278 0.215
NP_441917.1_5 Forward -264 -245 14.8474 0.128
NP_441543.1_2 Reverse -265 -274 18.486 0.00236
NP_441543.1_2 Forward -272 -263 16.9127 0.00359
NP_441543.1_2 Forward -165 -156 5.70292 0.181
NP_442845.1_2 Reverse -258 -272 6.6861 0.205
NP_442845.1_2 Forward -279 -265 5.99778 0.219
NP_441469.1_8 Forward -274 -265 16.126 0.00797
NP_441469.1_8 Reverse -263 -272 6.48957 0.227
NP_443064.1_6 Forward -273 -263 12.5669 0.0796
NP_443064.1_6 Forward -39 -29 9.17338 0.242
NP_442578.1_7 Forward -272 -265 14.5921 0.026
NP_442578.1_7 Reverse -265 -272 14.5921 0.026
NP_442286.1_1 Forward -273 -254 17.0107 0.0996
NP_441462.1_2 Forward -273 -263 11.5831 0.00406
NP_441462.1_2 Reverse -264 -274 11.5831 0.00406
NP_441621.1_7 Reverse -196 -210 -4.22864 0.214
NP_443062.1_1 Reverse -264 -282 14.8839 0.0427
NP_443062.1_1 Reverse -198 -216 6.59578 0.195
NP_443062.1_1 Forward -273 -255 4.06059 0.276
NP_440519.1_8 Reverse -193 -209 2.02515 0.269
NP_440544.1_4 Reverse -245 -262 18.0334 0.201
NP_440516.1_2 Forward -279 -261 6.01734 0.122
NP_440516.1_8 Forward -273 -264 16.9127 0.00442
NP_440516.1_8 Reverse -264 -273 16.9127 0.00442
NP_441033.1_2 Reverse -73 -92 -7.17871 0.293
NP_442428.1_5 Forward -272 -265 15.8704 0.0124
NP_442428.1_5 Reverse -265 -272 15.8704 0.0124
NP_442428.1_5 Forward -206 -199 4.36568 0.271
NP_442120.1_10 Forward -358 -339 -15.8318 0.296
NP_440673.1_2 Reverse -254 -273 14.6819 0.0979
NP_440673.1_3 Forward -271 -264 12.4288 0.0426
NP_440673.1_3 Reverse -266 -273 12.4288 0.0426
NP_440673.1_3 Forward -113 -106 9.08556 0.202
NP_441052.1_2 Forward -273 -263 19.9412 0.00106
NP_441052.1_2 Reverse -264 -274 10.5014 0.0285
NP_441052.1_2 Forward -232 -222 5.68323 0.107
NP_442219.1_8 Forward -277 -258 6.33108 0.3
NP_442219.1_9 Forward -272 -263 17.7976 0.00718
NP_442219.1_9 Reverse -265 -274 8.35786 0.0681
NP_440436.1_4 Reverse -265 -274 18.1905 0.00233
NP_440436.1_4 Forward -272 -263 17.2072 0.00233
NP_440436.1_4 Forward -165 -156 5.40752 0.204
NP_440436.1_4 Reverse -199 -208 4.42421 0.265
NP_440314.1_9 Reverse -265 -284 1.96607 0.0868
NP_440314.1_9 Forward -272 -253 -0.983855 0.12
NP_440648.1_1 Reverse -264 -283 9.3409 0.184
NP_442907.1_2 Forward -272 -254 12.0155 0.181
NP_441719.1_4 Forward -272 -265 16.3621 0.0124
NP_441719.1_4 Reverse -265 -272 16.3621 0.0124
NP_442366.1_5 Reverse -261 -271 17.2858 0.0141
NP_442366.1_5 Forward -276 -266 13.3526 0.0775
NP_442854.1_6 Forward -267 -248 4.22769 0.252
NP_443054.1_2 Reverse -262 -276 1.76955 0.245
NP_441851.1_10 Forward -274 -264 16.008 0.00552
NP_441851.1_10 Reverse -263 -273 15.8113 0.00552
NP_442001.1_1 Forward -340 -321 -5.1145 0.276
NP_441668.1_4 Reverse -254 -273 2.85105 0.189
NP_441668.1_4 Forward -102 -83 -2.65548 0.293
NP_442515.1_1 Reverse -263 -277 6.6861 0.0975
NP_442515.1_1 Forward -274 -260 1.08123 0.172
NP_442515.1_1 Reverse -105 -119 -4.52363 0.298
NP_441396.1_5 Reverse -190 -199 8.35786 0.224
NP_440593.1_3 Forward -278 -259 -4.42544 0.248
NP_441982.1_6 Forward -300 -291 14.3952 0.274
NP_441046.1_2 Reverse -253 -272 12.4875 0.182
NP_441349.1_10 Reverse -254 -273 8.75091 0.026
NP_440432.1_9 Reverse -265 -280 -3.95334 0.194
NP_442843.1_1 Reverse -190 -209 -10.1286 0.276
NP_442843.1_1 Reverse -158 -177 -10.817 0.281
NP_440474.1_8 Reverse -265 -279 5.70218 0.244
NP_442450.1_5 Reverse -262 -272 7.55152 0.13
NP_442450.1_5 Forward -275 -265 7.55152 0.13
NP_442168.1_5 Forward -272 -253 -1.27885 0.264
NP_440195.1_4 Forward -219 -200 12.6841 0.127
NP_441570.1_1 Forward -273 -255 -0.7675 0.0506
NP_441078.1_4 Forward -273 -264 19.6659 0.0007
NP_441078.1_4 Reverse -264 -273 19.6659 0.0007
NP_441078.1_4 Reverse -157 -166 -1.47524 0.266
NP_442729.1_8 Forward -277 -264 10.344 0.125
NP_440707.1_7 Reverse -191 -210 5.40766 0.276
NP_440526.1_3 Forward -272 -261 0.943182 0.267
NP_441432.1_5 Forward -204 -190 11.701 0.271
NP_441432.1_8 Reverse -263 -272 16.8143 0.00595
NP_441432.1_8 Forward -274 -265 8.25953 0.0755
NP_442320.1_8 Forward -279 -265 6.19444 0.029
NP_442320.1_8 Reverse -258 -272 -2.45868 0.0894
NP_442344.1_7 Reverse -265 -284 3.53937 0.0638
NP_441732.1_2 Forward -277 -261 -6.92296 0.0558
NP_441732.1_2 Forward -42 -26 -16.5594 0.174
NP_441732.1_2 Reverse -260 -276 -17.1494 0.24
NP_441030.1_4 Reverse -291 -310 11.1244 0.18
NP_442003.1_9 Reverse -229 -248 6.29264 0.235
NP_440760.1_1 Reverse -264 -283 -0.688862 0.0279
NP_440760.1_1 Forward -273 -254 -3.3438 0.0342
NP_439935.1_1 Forward -21 -2 10.0292 0.229
NP_442489.1_2 Forward -278 -259 0.687771 0.297
NP_442489.1_7 Forward -273 -264 20.1576 0.000695
NP_442489.1_7 Reverse -264 -273 20.1576 0.000695
NP_441706.1_9 Forward -183 -164 20.1564 0.159
NP_440559.1_1 Forward -272 -263 17.4043 0.00658
NP_440559.1_1 Reverse -265 -274 8.75118 0.0586
NP_441659.2_8 Forward -273 -263 18.1713 0.00133
NP_441659.2_8 Reverse -264 -274 11.9764 0.0147
NP_441659.2_8 Reverse -157 -167 1.94665 0.22
NP_441659.2_8 Forward -207 -197 0.865012 0.256
NP_442913.1_10 Reverse -255 -274 6.78429 0.058
NP_442913.1_10 Forward -282 -263 1.96607 0.133
NP_442913.1_10 Reverse -74 -93 0.196116 0.155
NP_441040.1_5 Forward -278 -259 8.06259 0.229
NP_442008.1_9 Reverse -172 -191 9.69201 0.249
NP_441800.1_7 Forward -272 -254 -0.865831 0.233
NP_442346.1_5 Reverse -263 -273 16.6963 0.00248
NP_442346.1_5 Forward -274 -264 9.02648 0.118
NP_440545.1_3 Reverse -260 -277 1.90713 0.11
NP_440545.1_3 Forward -42 -25 -2.22277 0.181
NP_440545.1_3 Forward -170 -153 -6.64766 0.285
NP_441856.1_3 Reverse -261 -280 0.0977854 0.216
NP_440459.1_2 Reverse -262 -279 10.0686 0.21
NP_440459.1_2 Reverse -81 -98 7.70866 0.283
NP_441943.1_5 Forward -183 -164 13.882 0.288
NP_441833.1_4 Forward -272 -265 15.9687 0.0124
NP_441833.1_4 Reverse -265 -272 15.9687 0.0124
NP_441329.1_3 Forward -301 -291 12.0145 0.273
NP_441329.1_4 Forward -139 -121 10.4106 0.282
NP_441329.1_6 Forward -139 -120 9.40553 0.129
NP_440912.1_3 Forward -66 -47 8.55343 0.271
NP_442162.1_9 Forward -272 -265 16.2637 0.0124
NP_442162.1_9 Reverse -265 -272 16.2637 0.0124
NP_442140.1_3 Reverse -265 -275 16.2046 0.0255
NP_442140.1_3 Forward -206 -196 12.7631 0.0632
NP_442140.1_3 Forward -272 -262 12.2714 0.0632
NP_442140.1_3 Reverse -199 -209 4.10993 0.261
NP_441813.1_5 Forward -275 -265 9.91146 0.021
NP_441813.1_5 Reverse -262 -272 8.63316 0.0367
NP_441813.1_5 Reverse -155 -165 -0.216628 0.237
NP_440590.1_4 Forward -272 -259 9.65572 0.0341
NP_440590.1_4 Reverse -265 -278 8.57408 0.0435
NP_440590.1_4 Forward -165 -152 -2.144 0.237
NP_440590.1_4 Reverse -84 -97 -3.02898 0.252
NP_440590.1_4 Reverse -199 -212 -6.07724 0.299
NP_440567.1_1 Reverse -265 -279 14.4542 0.0187
NP_440567.1_1 Forward -272 -258 1.47456 0.204
NP_442497.1_10 Forward -272 -263 10.4228 0.0087
NP_442497.1_10 Reverse -265 -274 10.4228 0.0087
NP_440821.1_4 Forward -275 -265 10.2065 0.0163
NP_440821.1_4 Reverse -262 -272 9.41981 0.0286
NP_440821.1_4 Reverse -196 -206 -0.609952 0.279
NP_441239.1_9 Forward -275 -263 12.3303 0.0477
NP_441239.1_9 Forward -209 -197 12.1337 0.0494
NP_441239.1_9 Reverse -262 -274 5.93884 0.202
NP_441239.1_9 Reverse -196 -208 3.77555 0.276
NP_441009.1_4 Forward -284 -265 10.8159 0.26
NP_440706.1_1 Reverse -194 -213 -3.44213 0.258
NP_441892.1_1 Reverse -255 -272 -3.20608 0.235
NP_440665.1_4 Forward -240 -221 13.0775 0.117
NP_442643.1_5 Reverse -86 -105 -6.29373 0.293
NP_441541.1_1 Forward -308 -290 4.10814 0.171
NP_440264.1_1 Forward -112 -98 17.5018 0.227
NP_440546.1_4 Reverse -264 -274 11.8882 0.0679
NP_440546.1_4 Forward -273 -263 10.046 0.109
NP_439974.1_4 Forward -375 -356 13.2741 0.195
NP_440462.1_6 Forward -275 -265 9.02648 0.0498
NP_440462.1_6 Forward -209 -199 4.60159 0.194
NP_440462.1_6 Reverse -262 -272 1.35667 0.294
NP_440868.1_4 Reverse -260 -272 15.4769 0.0164
NP_440868.1_4 Forward -277 -265 10.6587 0.0364
NP_442479.1_9 Reverse -59 -78 -7.27704 0.266
NP_441848.1_7 Forward -266 -247 -4.1312 0.287
NP_442039.1_4 Forward -272 -265 15.1821 0.0124
NP_442039.1_4 Reverse -265 -272 15.1821 0.0124
NP_442039.1_7 Forward -96 -86 6.76487 0.299
NP_441811.1_8 Reverse -258 -272 7.66941 0.241
NP_442829.1_2 Forward -136 -120 9.20406 0.287
NP_440825.1_7 Forward -114 -104 14.7639 0.152
NP_440825.1_7 Forward -272 -262 12.9096 0.152
NP_440825.1_7 Reverse -265 -275 12.4217 0.155
NP_442837.1_3 Forward -272 -265 15.7721 0.0124
NP_442837.1_3 Reverse -265 -272 15.7721 0.0124
NP_442053.1_1 Forward -273 -264 18.3876 0.0007
NP_442053.1_1 Reverse -264 -273 18.3876 0.0007
NP_440505.1_3 Reverse -262 -272 9.22315 0.122
NP_440505.1_3 Forward -275 -265 6.76487 0.169
NP_440505.1_3 Reverse -155 -165 5.28991 0.236
NP_440914.1_1 Forward -273 -263 17.5935 0.000537
NP_440914.1_1 Reverse -264 -274 8.6151 0.186
NP_441011.1_8 Reverse -265 -274 16.9127 0.00602
NP_441011.1_8 Forward -272 -263 8.25953 0.144
NP_441011.1_8 Reverse -199 -208 5.01461 0.289
NP_442101.1_10 Forward -281 -262 -10.227 0.255
NP_442533.1_6 Forward -273 -264 17.2076 0.00137
NP_442533.1_6 Reverse -264 -273 17.2076 0.00137
NP_440263.1_5 Forward -64 -50 10.1277 0.294
NP_442232.1_3 Reverse -190 -209 -7.08038 0.194
NP_442229.1_1 Reverse -262 -276 8.84875 0.184
NP_441482.1_7 Reverse -258 -272 -8.65353 0.193
NP_439944.1_9 Forward -272 -262 10.5014 0.0887
NP_441028.1_6 Reverse -31 -41 8.14104 0.217
NP_440116.1_5 Reverse -232 -249 1.71047 0.298
NP_441527.1_4 Forward -365 -346 -11.6027 0.284
NP_441527.1_4 Forward -295 -276 -11.6027 0.284
NP_440115.1_6 Reverse -261 -271 8.33817 0.13
NP_440115.1_6 Forward -95 -85 5.68323 0.227
NP_440608.1_6 Reverse -265 -284 5.89851 0.242
NP_441972.1_5 Forward -272 -253 -9.24366 0.282
NP_441106.1_1 Forward -274 -265 18.191 0.0028
NP_441106.1_1 Reverse -263 -272 9.63616 0.0311
NP_441106.1_1 Forward -208 -199 4.52295 0.219
NP_439903.1_6 Forward -265 -246 2.35861 0.227
NP_439903.1_6 Reverse -3 -22 1.08032 0.255
NP_441286.1_1 Reverse -263 -275 6.03717 0.0258
NP_441286.1_1 Forward -274 -262 3.38223 0.0467
NP_440670.1_8 Forward -273 -264 18.3876 0.000699
NP_440670.1_8 Reverse -264 -273 18.3876 0.000699
NP_440670.1_8 Forward -166 -157 3.7363 0.23
NP_440886.1_7 Forward -274 -264 17.7774 0.0011
NP_440886.1_7 Reverse -263 -273 7.94438 0.0805
NP_440886.1_7 Reverse -156 -166 4.01116 0.255
NP_439995.1_5 Forward -283 -264 6.09597 0.276
NP_440205.1_4 Forward -147 -128 14.2574 0.238
NP_442072.1_9 Reverse -197 -215 -15.3205 0.177
NP_442072.1_9 Reverse -263 -281 -21.5153 0.209
NP_442401.1_2 Forward -274 -255 13.0766 0.159
NP_440907.2_8 Reverse -265 -275 14.2375 0.0312
NP_440907.2_8 Forward -272 -262 7.64939 0.117
NP_440907.2_8 Forward -206 -196 6.0761 0.179
NP_441021.1_8 Reverse -259 -277 2.87075 0.238
NP_441626.1_2 Forward -272 -265 15.7721 0.0124
NP_441626.1_2 Reverse -265 -272 15.7721 0.0124
NP_442365.1_7 Forward -271 -252 -6.09707 0.285
NP_440107.1_5 Forward -274 -255 -3.3438 0.178
NP_442794.1_1 Reverse -260 -272 2.69391 0.286
NP_442615.1_1 Reverse -255 -273 -0.275845 0.114
NP_442615.1_1 Forward -282 -264 -3.6191 0.165
NP_441962.1_4 Reverse -259 -278 -4.6221 0.158
NP_440387.1_1 Forward -273 -257 11.6616 0.0157
NP_440387.1_1 Reverse -264 -280 5.76173 0.031
NP_441431.1_2 Forward -210 -196 9.43874 0.186
NP_441431.1_2 Forward -276 -262 8.16044 0.222
NP_441431.1_2 Reverse -261 -275 7.86545 0.231
NP_440114.1_10 Reverse -264 -278 11.111 0.125
NP_440114.1_10 Forward -273 -259 9.83269 0.16
NP_440114.1_10 Forward -207 -193 7.66941 0.229
NP_442698.1_10 Reverse -260 -279 4.32602 0.279
NP_440311.1_10 Reverse -276 -294 14.3747 0.289
NP_442087.1_2 Reverse -264 -283 14.2768 0.22
NP_440766.1_4 Reverse -194 -208 3.8345 0.141
NP_439988.1_7 Forward -205 -191 12.487 0.292
NP_441237.1_9 Forward -272 -262 14.828 0.0242
NP_442743.1_5 Reverse -259 -278 10.2259 0.144
NP_439910.1_2 Forward -215 -198 -14.2191 0.183
NP_439910.1_2 Forward -281 -264 -21.9873 0.202
NP_440457.1_1 Reverse -194 -206 -0.452677 0.263
NP_440798.1_6 Reverse -265 -278 5.91914 0.14
NP_440798.1_6 Forward -272 -259 5.23083 0.14
NP_440801.1_8 Forward -274 -255 6.4893 0.166
NP_442509.1_9 Reverse -264 -274 16.2041 0.00739
NP_442509.1_9 Forward -273 -263 8.14104 0.192
NP_440554.1_4 Reverse -265 -275 7.35486 0.103
NP_440554.1_4 Reverse -199 -209 3.32329 0.234
NP_441885.1_5 Forward -273 -263 20.9245 0.000538
NP_441885.1_5 Reverse -264 -274 11.4848 0.00668
NP_441885.1_5 Reverse -157 -167 0.963343 0.116
NP_441885.1_5 Forward -92 -82 -1.29827 0.259
NP_440478.1_10 Forward -275 -261 10.6193 0.193
NP_442703.1_6 Forward -132 -113 21.533 0.027
NP_442310.1_1 Reverse -203 -222 15.1424 0.148
NP_442341.1_7 Reverse -263 -277 15.3392 0.0229
NP_442341.1_7 Forward -274 -260 7.9644 0.0956
NP_442341.1_9 Forward -275 -261 14.7486 0.062
NP_441173.1_9 Forward -182 -174 10.6388 0.261
NP_443000.1_7 Reverse -262 -272 10.3048 0.0345
NP_443000.1_7 Forward -275 -265 1.94665 0.226
NP_440552.1_8 Forward -310 -293 15.2354 0.14
NP_442513.1_5 Reverse -256 -275 6.1935 0.282
NP_440275.1_3 Forward -275 -265 8.33817 0.0602
NP_440275.1_3 Reverse -262 -272 8.04317 0.0602
NP_440275.1_3 Reverse -196 -206 7.25653 0.0823
NP_440091.1_1 Reverse -260 -272 6.43049 0.095
NP_441635.1_1 Reverse -274 -293 3.00757 0.29
NP_440149.1_8 Forward -273 -254 1.86774 0.117
NP_442373.1_2 Reverse -246 -265 -6.98204 0.233
NP_440216.1_1 Reverse -264 -278 7.37441 0.00942
NP_440216.1_1 Forward -273 -259 -1.47537 0.0328
NP_440216.1_1 Forward -166 -152 -11.8985 0.228
NP_440216.1_1 Forward -284 -270 -12.4884 0.274
NP_440172.1_1 Forward -273 -263 15.0247 0.00945
NP_440172.1_1 Reverse -264 -274 8.73149 0.0586
NP_442290.1_8 Reverse -197 -211 18.3875 0.165
NP_442015.1_10 Reverse -260 -273 10.5407 0.0391
NP_442015.1_10 Forward -277 -264 1.69091 0.204
NP_441226.1_7 Forward -272 -265 14.4934 0.0123
NP_441226.1_7 Reverse -265 -272 14.4934 0.0123
NP_441226.1_7 Reverse -199 -206 12.4284 0.0404
NP_441111.1_7 Forward -272 -264 18.7023 0.00294
NP_441111.1_7 Reverse -265 -273 18.7023 0.00294
NP_441766.1_2 Forward -273 -264 17.5026 0.00297
NP_441766.1_2 Reverse -264 -273 17.5026 0.00297
NP_442417.1_5 Reverse -264 -278 8.84938 0.145
NP_443052.1_8 Reverse -254 -273 1.27776 0.061
NP_443052.1_8 Forward -283 -264 -7.67036 0.162
NP_442116.1_6 Forward -183 -166 7.02305 0.266
NP_442116.1_6 Reverse -131 -148 6.83207 0.271
NP_440261.1_5 Reverse -265 -278 -0.865694 0.0655
NP_440261.1_5 Forward -206 -193 -4.60227 0.158
NP_440261.1_5 Forward -272 -259 -12.0754 0.27
NP_440261.1_5 Forward -165 -152 -12.1738 0.272
NP_440988.1_10 Forward -245 -231 5.18926 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTATCGTCTGCTATTTGAATTTGTAAACAACCCAGAAGACAAGGAAGAGGCAATTTTATTACTTAATTTAGGTTCCCATGATGAAGTCTATTAATTTAACTTGTCAAAAAAGAAAAGTCGATCTTTCGGCGATCGCCAACTCTTCCCCCTTACTTATCCTAGAGGCAACGTCATGAACACAGCTCAAATTAGCACCGATGGCACCCATCAAATCGTTATTTTACCAGAAAACTTTACGATAGCCGGAAGCGAAGTTTACATTAAAAAAATTGGAAGTACAATTATTTTGATTGCTAAAAATAACCCTTGGCAATCCTTAATTGAAAGCTTAGATCAATTTTCAGATGATTTTATGAAAACTAGGGAACAGCCTCCCTTAGATATACGAGAAGAGTTCTAA

CDS

ATGAAGTATTTACTAGATACGAATATTTGCATTTATCTCATTAAGAAGAAACCGTTTAAAGTCTTGGCAAAATTTCAAACCCTGGAGATATCAGACATTGGTATTTCATCCATTACCGTGGCGGAATTAGAATATGGTGTCAGTAAAAGTCAACAACAATCGAAAAATCGTGATGCCTTAATGCAATTCTTGATGCCGCTAGAAATCGTGGAATTTAATTCAGGAAGCGGCGATCGCCTATGGCAACATTAG

Protein

MKYLLDTNICIYLIKKKPFKVLAKFQTLEISDIGISSITVAELEYGVSKSQQQSKNRDALMQFLMPLEIVEFNSGSGDRLWQH