Your browser is old and dusty. Try Google Chrome!

Details for ssl2922

ORF ssl2922
Accession NP_440333.1
Symbol vapB
Category Transformation
Definition similar to virulence-associated protein VapB
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -44 -37 14.6904 0.0123
NP_440795.1_7 Reverse -37 -44 14.6904 0.0123
NP_442291.1_5 Forward -46 -30 6.74504 0.0689
NP_442272.1_2 Forward -66 -47 11.4109 0.232
NP_440897.1_6 Reverse -36 -55 1.47364 0.17
NP_441453.1_4 Reverse -36 -44 16.539 0.00633
NP_441453.1_4 Forward -45 -37 16.539 0.00633
NP_442151.1_6 Forward -45 -31 13.3726 0.0528
NP_442151.1_6 Reverse -36 -50 8.94771 0.162
NP_441818.1_1 Forward -44 -33 9.79292 0.232
NP_440226.1_1 Forward -45 -26 10.1275 0.0654
NP_440226.1_1 Reverse -36 -55 4.32602 0.196
NP_441342.1_2 Reverse -32 -46 10.7177 0.209
NP_441098.1_3 Reverse -70 -89 -2.38658 0.28
NP_441098.1_3 Forward -400 -381 -5.64052 0.28
NP_442173.1_1 Forward -44 -36 15.4574 0.00633
NP_442173.1_1 Reverse -37 -45 15.4574 0.00633
NP_442752.1_4 Forward -45 -38 13.8055 0.0199
NP_442752.1_4 Reverse -36 -43 13.8055 0.0199
NP_443027.1_4 Forward -47 -37 5.87989 0.294
NP_442975.1_10 Forward -49 -35 10.5204 0.0541
NP_442975.1_10 Reverse -32 -46 1.76896 0.291
NP_440784.1_7 Forward -44 -37 15.9687 0.0123
NP_440784.1_7 Reverse -37 -44 15.9687 0.0123
NP_442909.1_7 Forward -44 -30 21.5334 0.0161
NP_441681.1_8 Forward -95 -76 21.2389 0.0853
NP_440061.1_9 Forward -47 -33 12.192 0.0999
NP_441054.1_4 Forward -55 -37 -0.669169 0.187
NP_442062.1_8 Reverse -36 -46 19.4496 0.000558
NP_442062.1_8 Forward -45 -35 17.3846 0.00193
NP_442062.1_8 Forward -375 -365 3.02829 0.289
NP_440304.1_4 Forward -11 -1 9.81313 0.0524
NP_440304.1_4 Forward -126 -116 2.7333 0.299
NP_440304.1_4 Forward -47 -37 1.84832 0.299
NP_440304.1_4 Reverse -34 -44 1.84832 0.299
NP_442242.1_4 Forward -44 -37 14.3954 0.0124
NP_442242.1_4 Reverse -37 -44 14.3954 0.0124
NP_440044.1_8 Forward -44 -25 16.8141 0.0221
NP_441200.1_4 Reverse -20 -39 5.01433 0.299
NP_441208.1_9 Reverse -33 -47 6.78443 0.229
NP_440370.1_10 Reverse -27 -46 17.7974 0.0586
NP_442110.1_7 Forward -45 -31 -0.492064 0.291
NP_441083.1_5 Forward -45 -35 20.3345 0.00053
NP_441083.1_5 Reverse -36 -46 11.3864 0.0159
NP_441434.1_6 Forward -126 -116 13.648 0.296
NP_441141.1_3 Reverse -293 -311 19.3903 0.098
NP_441738.1_2 Forward -43 -36 15.28 0.0102
NP_441738.1_2 Reverse -38 -45 15.28 0.0102
NP_440209.1_1 Reverse -36 -44 18.1123 0.00295
NP_440209.1_1 Forward -45 -37 18.1123 0.00295
NP_442889.1_8 Forward -48 -34 20.8451 0.00339
NP_441713.1_1 Forward -51 -32 -14.0619 0.257
NP_440178.1_7 Forward -46 -27 6.78429 0.013
NP_440178.1_7 Reverse -35 -54 -20.2567 0.188
NP_441716.1_1 Forward -45 -31 4.71948 0.252
NP_442111.1_4 Reverse -35 -49 9.34103 0.0609
NP_440906.1_5 Forward -44 -37 15.8704 0.0124
NP_440906.1_5 Reverse -37 -44 15.8704 0.0124
NP_440747.1_10 Reverse -33 -45 14.9853 0.00221
NP_440747.1_10 Forward -48 -36 5.34885 0.0141
NP_442973.1_5 Reverse -106 -125 11.2092 0.251
NP_441486.1_1 Reverse -33 -47 22.5174 0.00162
NP_441486.1_1 Forward -48 -34 14.1593 0.00654
NP_441014.1_5 Reverse -360 -378 10.2456 0.263
NP_442848.1_1 Reverse -30 -44 7.76774 0.0791
NP_443018.1_3 Forward -44 -37 14.8871 0.0123
NP_443018.1_3 Reverse -37 -44 14.8871 0.0123
NP_441634.1_8 Reverse -34 -48 -3.04867 0.295
NP_440376.1_1 Forward -45 -36 19.4693 0.000692
NP_440376.1_1 Reverse -36 -45 19.4693 0.000692
NP_441588.1_4 Reverse -38 -48 14.238 0.0773
NP_441588.1_4 Forward -43 -33 8.92815 0.14
NP_442687.1_1 Forward -306 -293 16.8333 0.243
NP_442687.1_7 Forward -46 -36 15.8113 0.0125
NP_442687.1_7 Reverse -35 -45 8.92815 0.0994
NP_440642.1_10 Reverse -125 -139 5.1122 0.242
NP_441422.1_7 Forward -47 -30 5.54538 0.0992
NP_442658.1_1 Forward -47 -37 15.9091 0.00966
NP_442658.1_1 Reverse -34 -44 6.76441 0.214
NP_442198.1_3 Forward -54 -35 2.85105 0.297
NP_442782.1_2 Forward -205 -191 7.86607 0.202
NP_442205.1_9 Reverse -30 -46 -1.21977 0.264
NP_441414.1_9 Reverse -36 -55 26.8438 0.00146
NP_441414.1_9 Forward -45 -26 -9.44032 0.259
NP_441487.1_9 Forward -46 -27 20.8456 0.0255
NP_442937.1_5 Reverse -31 -50 13.9625 0.0859
NP_441958.1_5 Forward -46 -36 12.2714 0.00183
NP_441958.1_5 Reverse -35 -45 12.2714 0.00183
NP_439905.1_1 Reverse -37 -50 10.4424 0.216
NP_440984.1_7 Forward -50 -36 21.0424 0.00311
NP_440984.1_7 Reverse -31 -45 7.86607 0.161
NP_442911.1_2 Forward -55 -36 3.73603 0.042
NP_442911.1_2 Reverse -26 -45 -3.44213 0.112
NP_441580.1_6 Forward -56 -37 -5.80207 0.235
NP_440153.1_5 Forward -44 -30 2.65453 0.219
NP_443055.1_6 Reverse -28 -46 -0.0799167 0.252
NP_440602.1_8 Forward -170 -156 10.3243 0.282
NP_442002.1_9 Forward -46 -39 10.7572 0.185
NP_441294.1_7 Reverse -32 -46 9.15464 0.256
NP_442438.1_10 Reverse -31 -45 2.75286 0.168
NP_441000.1_6 Forward -46 -32 2.94952 0.123
NP_440147.1_4 Forward -47 -34 12.704 0.0326
NP_440147.1_4 Reverse -34 -47 10.1474 0.0355
NP_441550.1_8 Reverse -34 -44 14.6309 0.0132
NP_441550.1_8 Forward -47 -37 8.3377 0.124
NP_441916.1_7 Reverse -36 -46 18.4663 0.00144
NP_441916.1_7 Forward -45 -35 10.3048 0.0261
NP_441916.1_7 Reverse -366 -376 5.28991 0.138
NP_440383.1_5 Forward -325 -306 19.2414 0.246
NP_441041.1_4 Reverse -36 -55 0.786102 0.0837
NP_441041.1_4 Forward -45 -26 -5.9004 0.16
NP_441041.1_7 Forward -48 -36 9.55551 0.109
NP_442396.1_5 Forward -49 -36 18.8988 0.0167
NP_440174.1_2 Reverse -290 -309 13.5691 0.244
NP_442004.1_6 Forward -45 -31 9.83269 0.14
NP_441725.1_5 Forward -44 -34 2.04498 0.115
NP_441725.1_5 Reverse -37 -47 2.04498 0.115
NP_439966.1_7 Forward -47 -37 9.91099 0.0968
NP_439966.1_7 Reverse -34 -44 7.25606 0.15
NP_439966.1_9 Forward -47 -38 0.884706 0.253
NP_442941.1_3 Forward -44 -34 11.0914 0.0116
NP_442941.1_3 Reverse -37 -47 2.63497 0.14
NP_440289.1_2 Forward -48 -35 3.06754 0.0811
NP_442281.1_1 Forward -50 -36 11.1104 0.0507
NP_442281.1_1 Reverse -31 -45 8.06211 0.0869
NP_442012.1_1 Forward -51 -32 3.6377 0.179
NP_441556.1_10 Reverse -31 -45 9.6378 0.294
NP_440498.1_1 Forward -54 -36 8.08229 0.0795
NP_442982.1_5 Reverse -175 -194 -3.14714 0.296
NP_440375.1_8 Reverse -37 -56 10.1275 0.138
NP_440375.1_9 Reverse -139 -158 19.5698 0.119
NP_441644.1_6 Forward -45 -35 17.3841 0.00127
NP_441644.1_6 Reverse -36 -46 10.1076 0.0628
NP_442215.1_2 Reverse -34 -50 7.13836 0.0694
NP_442215.1_2 Forward -47 -31 -1.61309 0.186
NP_442247.1_8 Reverse -34 -48 8.65272 0.266
NP_440929.1_8 Forward -45 -36 19.2726 0.000701
NP_440929.1_8 Reverse -36 -45 19.2726 0.000701
NP_442933.1_10 Forward -45 -36 17.601 0.00325
NP_442933.1_10 Reverse -36 -45 17.601 0.00325
NP_442933.1_10 Forward -375 -366 6.09625 0.14
NP_442933.1_10 Reverse -366 -375 5.70292 0.165
NP_442554.1_8 Forward -44 -34 15.3197 0.00882
NP_442554.1_8 Reverse -37 -47 13.2547 0.0187
NP_442970.1_1 Reverse -272 -286 13.5715 0.269
NP_441762.1_7 Reverse -35 -47 10.1671 0.0142
NP_441762.1_7 Forward -46 -34 9.57708 0.0142
NP_442142.1_4 Reverse -33 -46 5.62358 0.187
NP_442142.1_4 Forward -48 -35 4.64028 0.214
NP_442292.1_1 Forward -44 -35 18.486 0.00229
NP_442292.1_1 Reverse -37 -46 9.63616 0.0183
NP_442476.1_6 Reverse -37 -51 15.0442 0.0371
NP_442476.1_6 Forward -44 -30 1.67122 0.207
NP_443009.1_5 Reverse -35 -46 18.3477 0.00265
NP_441715.1_4 Reverse -37 -47 9.41981 0.097
NP_441715.1_4 Forward -44 -34 7.94484 0.107
NP_443034.1_3 Reverse -369 -388 11.4058 0.271
NP_440464.1_10 Forward -44 -34 13.0082 0.169
NP_441468.1_1 Forward -44 -37 15.8704 0.0124
NP_441468.1_1 Reverse -37 -44 15.8704 0.0124
NP_441020.2_6 Forward -215 -198 9.18362 0.179
NP_441020.2_6 Reverse -182 -199 6.13536 0.275
NP_441015.1_10 Reverse -31 -50 5.70265 0.112
NP_441015.1_10 Reverse -229 -248 -10.4236 0.284
NP_441673.1_1 Forward -45 -36 20.8459 0.000698
NP_441673.1_1 Reverse -36 -45 20.8459 0.000698
NP_441096.1_5 Reverse -119 -137 15.7513 0.297
NP_442868.1_6 Reverse -34 -44 9.81313 0.038
NP_442868.1_6 Forward -47 -37 0.865012 0.205
NP_442719.1_3 Forward -123 -110 15.26 0.292
NP_441251.1_5 Reverse -323 -342 17.0107 0.179
NP_441251.1_5 Reverse -280 -299 16.8141 0.179
NP_441056.1_1 Forward -45 -26 -5.60541 0.262
NP_441612.1_2 Forward -45 -35 8.54929 0.21
NP_441612.1_2 Reverse -185 -195 6.90347 0.272
NP_442427.1_8 Forward -54 -35 9.53756 0.18
NP_442808.1_1 Forward -46 -36 18.4657 0.00201
NP_442808.1_1 Reverse -35 -45 8.63269 0.0481
NP_441882.1_6 Reverse -208 -227 2.3594 0.187
NP_440145.1_3 Reverse -26 -45 12.0942 0.0316
NP_440145.1_3 Reverse -339 -358 -2.65548 0.176
NP_442050.1_5 Reverse -34 -44 7.64939 0.243
NP_440334.1_1 Reverse -103 -122 13.8937 0.298
NP_442792.1_6 Reverse -19 -38 2.75272 0.282
NP_441878.1_6 Forward -46 -36 10.4031 0.0176
NP_441878.1_6 Reverse -35 -45 10.4031 0.0176
NP_441036.1_8 Forward -46 -36 17.7779 0.000554
NP_441036.1_8 Reverse -35 -45 8.33817 0.174
NP_442650.1_2 Forward -45 -31 6.09611 0.134
NP_441557.1_5 Forward -45 -36 19.9609 0.000699
NP_441557.1_5 Reverse -36 -45 19.9609 0.000699
NP_441445.1_1 Reverse -27 -46 17.5024 0.0319
NP_442066.2_9 Forward -49 -36 11.4257 0.154
NP_442183.1_1 Reverse -36 -50 5.1128 0.231
NP_441574.1_1 Reverse -24 -43 -2.45882 0.226
NP_441574.1_1 Forward -57 -38 -4.72043 0.254
NP_442347.1_2 Forward -44 -35 12.4878 0.056
NP_442347.1_2 Reverse -37 -46 11.1111 0.056
NP_442347.1_2 Forward -315 -306 5.99792 0.201
NP_442645.1_2 Reverse -28 -47 26.2538 0.000248
NP_442645.1_2 Forward -53 -34 -12.5869 0.144
NP_441037.1_4 Forward -47 -37 14.7245 0.028
NP_441037.1_4 Reverse -34 -44 7.9999 0.237
NP_441037.1_4 Reverse -226 -236 6.05075 0.283
NP_441633.1_3 Reverse -34 -47 8.57408 0.0377
NP_441633.1_3 Forward -47 -34 3.46087 0.0699
NP_441633.1_3 Forward -153 -140 -2.43899 0.177
NP_440136.1_2 Forward -44 -37 15.9687 0.0123
NP_440136.1_2 Reverse -37 -44 15.9687 0.0123
NP_442998.1_10 Forward -43 -36 15.5754 0.0102
NP_442998.1_10 Reverse -38 -45 15.5754 0.0102
NP_440299.1_1 Forward -49 -36 10.8351 0.0529
NP_440299.1_1 Reverse -32 -45 10.3434 0.0573
NP_441799.1_1 Reverse -32 -46 19.8618 0.00596
NP_441799.1_1 Forward -49 -35 14.5519 0.0228
NP_441007.1_10 Forward -50 -37 1.59258 0.203
NP_441007.1_10 Reverse -31 -44 1.39592 0.203
NP_442201.1_10 Reverse -25 -44 -4.72043 0.152
NP_442201.1_10 Forward -56 -37 -11.8003 0.268
NP_440256.1_1 Reverse -33 -52 -9.14533 0.275
NP_440087.1_1 Reverse -27 -46 -8.85033 0.285
NP_442158.1_2 Reverse -342 -361 15.9945 0.247
NP_441464.1_8 Forward -45 -31 9.04604 0.192
NP_442150.1_2 Reverse -25 -44 15.959 0.285
NP_440306.1_9 Reverse -28 -47 10.7175 0.253
NP_442386.1_9 Forward -46 -37 15.7322 0.0144
NP_442386.1_9 Reverse -35 -44 13.8639 0.0289
NP_441340.1_5 Forward -44 -37 15.6737 0.0124
NP_441340.1_5 Reverse -37 -44 15.6737 0.0124
NP_441271.1_10 Reverse -23 -42 15.0441 0.278
NP_442714.1_7 Forward -44 -25 1.17943 0.226
NP_440586.1_1 Reverse -224 -243 -0.885524 0.237
NP_440586.1_8 Forward -44 -37 13.2151 0.026
NP_440586.1_8 Reverse -37 -44 13.2151 0.026
NP_442251.1_6 Forward -44 -37 15.2804 0.0124
NP_442251.1_6 Reverse -37 -44 15.2804 0.0124
NP_440684.1_9 Reverse -30 -44 7.9644 0.246
NP_441262.1_3 Reverse -36 -43 14.7888 0.0223
NP_441262.1_3 Forward -45 -38 14.7888 0.0223
NP_443051.1_1 Reverse -35 -44 10.4228 0.00754
NP_443051.1_1 Forward -46 -37 10.4228 0.00754
NP_439984.1_3 Reverse -29 -43 12.0937 0.281
NP_440439.1_1 Reverse -33 -46 2.57589 0.131
NP_440372.1_2 Forward -44 -37 16.3621 0.0124
NP_440372.1_2 Reverse -37 -44 16.3621 0.0124
NP_441803.1_2 Forward -50 -31 -0.197208 0.269
NP_442416.1_8 Forward -97 -79 18.6058 0.291
NP_441572.1_7 Forward -51 -32 -3.83545 0.22
NP_442384.1_10 Reverse -36 -49 14.1789 0.0163
NP_442384.1_10 Forward -45 -32 10.049 0.047
NP_442262.1_10 Forward -44 -37 14.1988 0.0123
NP_442262.1_10 Reverse -37 -44 14.1988 0.0123
NP_441689.1_5 Reverse -34 -44 5.78111 0.197
NP_440344.1_10 Forward -52 -35 -7.13932 0.115
NP_440189.1_10 Reverse -355 -374 3.6377 0.279
NP_441965.1_3 Reverse -26 -45 -1.67217 0.29
NP_441965.1_10 Forward -48 -32 3.99177 0.252
NP_441965.1_10 Reverse -33 -49 2.51681 0.287
NP_441640.1_9 Forward -352 -333 11.6025 0.287
NP_440297.1_9 Forward -44 -34 -0.118297 0.282
NP_440297.1_9 Reverse -37 -47 -0.118297 0.282
NP_440350.1_5 Reverse -124 -143 7.37428 0.134
NP_440999.1_9 Forward -49 -35 2.16287 0.154
NP_440888.1_2 Reverse -36 -50 8.84875 0.145
NP_440888.1_2 Forward -45 -31 8.25877 0.167
NP_440052.1_5 Forward -56 -37 14.5524 0.0714
NP_439969.1_3 Reverse -357 -376 -0.688862 0.271
NP_442277.1_7 Reverse -103 -119 0.293278 0.215
NP_440575.1_1 Reverse -381 -400 -3.73788 0.299
NP_440575.1_8 Forward -275 -256 -7.57203 0.298
NP_441917.1_5 Forward -36 -17 14.8474 0.128
NP_441543.1_2 Reverse -37 -46 18.486 0.00236
NP_441543.1_2 Forward -44 -35 16.9127 0.00359
NP_442845.1_2 Reverse -30 -44 6.6861 0.205
NP_442845.1_2 Forward -51 -37 5.99778 0.219
NP_440722.1_3 Reverse -331 -345 7.86607 0.295
NP_441469.1_8 Forward -46 -37 16.126 0.00797
NP_441469.1_8 Reverse -35 -44 6.48957 0.227
NP_443064.1_6 Forward -45 -35 12.5669 0.0796
NP_442578.1_7 Forward -44 -37 14.5921 0.026
NP_442578.1_7 Reverse -37 -44 14.5921 0.026
NP_442578.1_7 Forward -374 -367 5.34899 0.2
NP_442286.1_1 Forward -45 -26 17.0107 0.0996
NP_441462.1_2 Forward -45 -35 11.5831 0.00406
NP_441462.1_2 Reverse -36 -46 11.5831 0.00406
NP_443062.1_1 Reverse -36 -54 14.8839 0.0427
NP_443062.1_1 Forward -45 -27 4.06059 0.276
NP_442204.1_1 Reverse -230 -241 4.97522 0.225
NP_440544.1_4 Reverse -17 -34 18.0334 0.201
NP_442780.1_3 Reverse -266 -285 8.92807 0.249
NP_440516.1_2 Forward -51 -33 6.01734 0.122
NP_440516.1_8 Forward -45 -36 16.9127 0.00442
NP_440516.1_8 Reverse -36 -45 16.9127 0.00442
NP_442428.1_5 Forward -44 -37 15.8704 0.0124
NP_442428.1_5 Reverse -37 -44 15.8704 0.0124
NP_442120.1_10 Forward -130 -111 -15.8318 0.296
NP_440673.1_2 Reverse -26 -45 14.6819 0.0979
NP_440673.1_3 Forward -43 -36 12.4288 0.0426
NP_440673.1_3 Reverse -38 -45 12.4288 0.0426
NP_441052.1_2 Forward -45 -35 19.9412 0.00106
NP_441052.1_2 Reverse -36 -46 10.5014 0.0285
NP_442219.1_8 Forward -49 -30 6.33108 0.3
NP_442219.1_9 Forward -44 -35 17.7976 0.00718
NP_442219.1_9 Reverse -37 -46 8.35786 0.0681
NP_440436.1_4 Reverse -37 -46 18.1905 0.00233
NP_440436.1_4 Forward -44 -35 17.2072 0.00233
NP_442412.1_5 Forward -381 -362 3.34271 0.294
NP_440314.1_9 Reverse -37 -56 1.96607 0.0868
NP_440314.1_9 Forward -44 -25 -0.983855 0.12
NP_440648.1_1 Reverse -36 -55 9.3409 0.184
NP_442907.1_2 Forward -44 -26 12.0155 0.181
NP_441719.1_4 Forward -44 -37 16.3621 0.0124
NP_441719.1_4 Reverse -37 -44 16.3621 0.0124
NP_441719.1_4 Forward -374 -367 3.97235 0.231
NP_442366.1_5 Reverse -33 -43 17.2858 0.0141
NP_442366.1_5 Forward -48 -38 13.3526 0.0775
NP_440129.1_10 Forward -244 -230 1.76955 0.297
NP_442854.1_6 Forward -39 -20 4.22769 0.252
NP_443054.1_2 Reverse -34 -48 1.76955 0.245
NP_441851.1_10 Forward -46 -36 16.008 0.00552
NP_441851.1_10 Reverse -35 -45 15.8113 0.00552
NP_442001.1_1 Forward -112 -93 -5.1145 0.276
NP_441668.1_4 Reverse -26 -45 2.85105 0.189
NP_442515.1_1 Reverse -35 -49 6.6861 0.0975
NP_442515.1_1 Forward -46 -32 1.08123 0.172
NP_440593.1_3 Forward -248 -229 -4.22878 0.246
NP_440593.1_3 Forward -50 -31 -4.42544 0.248
NP_441982.1_6 Forward -72 -63 14.3952 0.274
NP_441982.1_6 Forward -311 -302 10.289 0.297
NP_441046.1_2 Reverse -25 -44 12.4875 0.182
NP_441349.1_10 Reverse -26 -45 8.75091 0.026
NP_440432.1_9 Reverse -37 -52 -3.95334 0.194
NP_440474.1_8 Reverse -37 -51 5.70218 0.244
NP_441124.1_5 Reverse -375 -385 11.4803 0.254
NP_442450.1_5 Reverse -34 -44 7.55152 0.13
NP_442450.1_5 Forward -47 -37 7.55152 0.13
NP_442450.1_5 Reverse -364 -374 5.28991 0.251
NP_442168.1_5 Forward -44 -25 -1.27885 0.264
NP_442006.1_2 Reverse -233 -250 -18.0541 0.287
NP_441570.1_1 Forward -45 -27 -0.7675 0.0506
NP_441078.1_4 Forward -45 -36 19.6659 0.0007
NP_441078.1_4 Reverse -36 -45 19.6659 0.0007
NP_442729.1_8 Forward -49 -36 10.344 0.125
NP_440526.1_3 Forward -44 -33 0.943182 0.267
NP_441432.1_8 Reverse -35 -44 16.8143 0.00595
NP_441432.1_8 Forward -46 -37 8.25953 0.0755
NP_442320.1_8 Forward -51 -37 6.19444 0.029
NP_442320.1_8 Reverse -30 -44 -2.45868 0.0894
NP_442344.1_7 Reverse -37 -56 3.53937 0.0638
NP_441732.1_2 Forward -49 -33 -6.92296 0.0558
NP_441732.1_2 Reverse -32 -48 -17.1494 0.24
NP_441030.1_4 Reverse -63 -82 11.1244 0.18
NP_442003.1_9 Reverse -1 -20 6.29264 0.235
NP_440760.1_1 Reverse -36 -55 -0.688862 0.0279
NP_440760.1_1 Forward -45 -26 -3.3438 0.0342
NP_440461.1_3 Forward -379 -360 16.0274 0.212
NP_442489.1_2 Forward -50 -31 0.687771 0.297
NP_442489.1_7 Forward -45 -36 20.1576 0.000695
NP_442489.1_7 Reverse -36 -45 20.1576 0.000695
NP_440559.1_1 Forward -44 -35 17.4043 0.00658
NP_440559.1_1 Reverse -37 -46 8.75118 0.0586
NP_440559.1_1 Forward -374 -365 4.81794 0.193
NP_441659.2_8 Forward -45 -35 18.1713 0.00133
NP_441659.2_8 Reverse -36 -46 11.9764 0.0147
NP_442749.1_5 Reverse -341 -358 9.28417 0.216
NP_442913.1_10 Reverse -27 -46 6.78429 0.058
NP_442913.1_10 Forward -54 -35 1.96607 0.133
NP_441040.1_5 Forward -50 -31 8.06259 0.229
NP_441800.1_7 Forward -44 -26 -0.865831 0.233
NP_442346.1_5 Reverse -35 -45 16.6963 0.00248
NP_442346.1_5 Forward -46 -36 9.02648 0.118
NP_440545.1_3 Reverse -32 -49 1.90713 0.11
NP_441856.1_3 Reverse -33 -52 0.0977854 0.216
NP_440459.1_2 Reverse -34 -51 10.0686 0.21
NP_440459.1_2 Forward -268 -251 8.29864 0.266
NP_441833.1_4 Forward -44 -37 15.9687 0.0124
NP_441833.1_4 Reverse -37 -44 15.9687 0.0124
NP_441329.1_3 Forward -73 -63 12.0145 0.273
NP_442162.1_9 Forward -44 -37 16.2637 0.0124
NP_442162.1_9 Reverse -37 -44 16.2637 0.0124
NP_440204.1_4 Reverse -200 -219 0.58944 0.275
NP_442140.1_3 Reverse -37 -47 16.2046 0.0255
NP_442140.1_3 Forward -44 -34 12.2714 0.0632
NP_441671.1_10 Reverse -304 -323 0.687771 0.281
NP_440875.1_9 Reverse -368 -378 9.63741 0.233
NP_441813.1_5 Forward -47 -37 9.91146 0.021
NP_441813.1_5 Reverse -34 -44 8.63316 0.0367
NP_440594.1_8 Reverse -367 -380 8.18017 0.243
NP_440590.1_4 Forward -44 -31 9.65572 0.0341
NP_440590.1_4 Reverse -37 -50 8.57408 0.0435
NP_440567.1_1 Reverse -37 -51 14.4542 0.0187
NP_440567.1_1 Forward -44 -30 1.47456 0.204
NP_442497.1_10 Forward -44 -35 10.4228 0.0087
NP_442497.1_10 Reverse -37 -46 10.4228 0.0087
NP_440821.1_4 Forward -47 -37 10.2065 0.0163
NP_440821.1_4 Reverse -34 -44 9.41981 0.0286
NP_441239.1_9 Forward -47 -35 12.3303 0.0477
NP_441239.1_9 Reverse -34 -46 5.93884 0.202
NP_441009.1_4 Forward -56 -37 10.8159 0.26
NP_441727.1_3 Reverse -221 -240 2.45773 0.3
NP_441892.1_1 Reverse -27 -44 -3.20608 0.235
NP_441541.1_1 Forward -80 -62 4.10814 0.171
NP_440546.1_4 Reverse -36 -46 11.8882 0.0679
NP_440546.1_4 Forward -45 -35 10.046 0.109
NP_439974.1_4 Forward -147 -128 13.2741 0.195
NP_440462.1_6 Forward -47 -37 9.02648 0.0498
NP_440462.1_6 Forward -377 -367 5.97822 0.135
NP_440462.1_6 Reverse -34 -44 1.35667 0.294
NP_440868.1_4 Reverse -32 -44 15.4769 0.0164
NP_440868.1_4 Forward -49 -37 10.6587 0.0364
NP_440868.1_8 Reverse -224 -243 3.83436 0.114
NP_441848.1_7 Forward -38 -19 -4.1312 0.287
NP_439948.1_2 Forward -368 -350 14.5168 0.259
NP_442039.1_4 Forward -44 -37 15.1821 0.0124
NP_442039.1_4 Reverse -37 -44 15.1821 0.0124
NP_442039.1_4 Reverse -371 -378 8.69224 0.172
NP_442039.1_7 Forward -263 -253 12.2714 0.249
NP_441811.1_8 Reverse -30 -44 7.66941 0.241
NP_440825.1_7 Forward -44 -34 12.9096 0.152
NP_440825.1_7 Reverse -37 -47 12.4217 0.155
NP_442837.1_3 Forward -44 -37 15.7721 0.0124
NP_442837.1_3 Reverse -37 -44 15.7721 0.0124
NP_442053.1_1 Forward -45 -36 18.3876 0.0007
NP_442053.1_1 Reverse -36 -45 18.3876 0.0007
NP_440505.1_3 Reverse -34 -44 9.22315 0.122
NP_440505.1_3 Forward -47 -37 6.76487 0.169
NP_440914.1_1 Forward -45 -35 17.5935 0.000537
NP_440914.1_1 Reverse -36 -46 8.6151 0.186
NP_441011.1_8 Reverse -37 -46 16.9127 0.00602
NP_441011.1_8 Forward -44 -35 8.25953 0.144
NP_442101.1_10 Forward -53 -34 -10.227 0.255
NP_442533.1_6 Forward -45 -36 17.2076 0.00137
NP_442533.1_6 Reverse -36 -45 17.2076 0.00137
NP_442229.1_1 Reverse -34 -48 8.84875 0.184
NP_441482.1_7 Reverse -30 -44 -8.65353 0.193
NP_439944.1_9 Forward -44 -34 10.5014 0.0887
NP_441028.1_6 Forward -246 -236 3.51951 0.292
NP_440116.1_5 Reverse -4 -21 1.71047 0.298
NP_441527.1_4 Forward -137 -118 -11.6027 0.284
NP_441527.1_4 Forward -67 -48 -11.6027 0.284
NP_441527.1_4 Forward -224 -205 -12.1756 0.285
NP_440115.1_6 Reverse -33 -43 8.33817 0.13
NP_440115.1_6 Forward -378 -368 5.19158 0.265
NP_440608.1_6 Reverse -37 -56 5.89851 0.242
NP_441972.1_5 Forward -44 -25 -9.24366 0.282
NP_441106.1_1 Forward -46 -37 18.191 0.0028
NP_441106.1_1 Reverse -35 -44 9.63616 0.0311
NP_439903.1_6 Forward -341 -322 2.85027 0.219
NP_439903.1_6 Forward -37 -18 2.35861 0.227
NP_441286.1_1 Reverse -35 -47 6.03717 0.0258
NP_441286.1_1 Forward -46 -34 3.38223 0.0467
NP_440670.1_8 Forward -45 -36 18.3876 0.000699
NP_440670.1_8 Reverse -36 -45 18.3876 0.000699
NP_440886.1_7 Forward -46 -36 17.7774 0.0011
NP_440886.1_7 Reverse -35 -45 7.94438 0.0805
NP_439995.1_5 Forward -55 -36 6.09597 0.276
NP_442072.1_9 Reverse -35 -53 -21.5153 0.209
NP_442401.1_2 Forward -46 -27 13.0766 0.159
NP_440907.2_8 Reverse -37 -47 14.2375 0.0312
NP_440907.2_8 Forward -44 -34 7.64939 0.117
NP_441021.1_8 Reverse -31 -49 2.87075 0.238
NP_441626.1_2 Forward -44 -37 15.7721 0.0124
NP_441626.1_2 Reverse -37 -44 15.7721 0.0124
NP_442365.1_7 Forward -43 -24 -6.09707 0.285
NP_440107.1_5 Forward -46 -27 -3.3438 0.178
NP_442794.1_1 Reverse -32 -44 2.69391 0.286
NP_442615.1_1 Reverse -27 -45 -0.275845 0.114
NP_442615.1_1 Forward -54 -36 -3.6191 0.165
NP_441962.1_4 Reverse -31 -50 -4.6221 0.158
NP_440387.1_1 Forward -45 -29 11.6616 0.0157
NP_440387.1_1 Reverse -36 -52 5.76173 0.031
NP_441431.1_2 Forward -48 -34 8.16044 0.222
NP_441431.1_2 Reverse -33 -47 7.86545 0.231
NP_440114.1_10 Reverse -36 -50 11.111 0.125
NP_440114.1_10 Forward -45 -31 9.83269 0.16
NP_442698.1_10 Reverse -32 -51 4.32602 0.279
NP_440311.1_10 Reverse -48 -66 14.3747 0.289
NP_442087.1_2 Reverse -36 -55 14.2768 0.22
NP_441237.1_9 Forward -44 -34 14.828 0.0242
NP_442743.1_5 Reverse -31 -50 10.2259 0.144
NP_439910.1_2 Forward -53 -36 -21.9873 0.202
NP_440798.1_6 Reverse -37 -50 5.91914 0.14
NP_440798.1_6 Forward -44 -31 5.23083 0.14
NP_440801.1_8 Forward -46 -27 6.4893 0.166
NP_442509.1_9 Reverse -36 -46 16.2041 0.00739
NP_442509.1_9 Forward -45 -35 8.14104 0.192
NP_440554.1_4 Reverse -37 -47 7.35486 0.103
NP_442737.1_4 Reverse -360 -379 19.469 0.151
NP_441885.1_5 Forward -45 -35 20.9245 0.000538
NP_441885.1_5 Reverse -36 -46 11.4848 0.00668
NP_440478.1_10 Forward -47 -33 10.6193 0.193
NP_442341.1_7 Reverse -35 -49 15.3392 0.0229
NP_442341.1_7 Forward -46 -32 7.9644 0.0956
NP_442341.1_9 Forward -47 -33 14.7486 0.062
NP_443000.1_7 Reverse -34 -44 10.3048 0.0345
NP_443000.1_7 Forward -47 -37 1.94665 0.226
NP_440552.1_8 Forward -82 -65 15.2354 0.14
NP_442513.1_5 Reverse -28 -47 6.1935 0.282
NP_440275.1_3 Forward -47 -37 8.33817 0.0602
NP_440275.1_3 Reverse -34 -44 8.04317 0.0602
NP_440091.1_1 Reverse -32 -44 6.43049 0.095
NP_441635.1_1 Reverse -46 -65 3.00757 0.29
NP_440149.1_8 Forward -45 -26 1.86774 0.117
NP_441105.1_3 Reverse -359 -378 -9.047 0.283
NP_442373.1_2 Reverse -18 -37 -6.98204 0.233
NP_440216.1_1 Reverse -36 -50 7.37441 0.00942
NP_440216.1_1 Forward -45 -31 -1.47537 0.0328
NP_440216.1_1 Forward -56 -42 -12.4884 0.274
NP_440172.1_1 Forward -45 -35 15.0247 0.00945
NP_440172.1_1 Reverse -36 -46 8.73149 0.0586
NP_442015.1_10 Reverse -32 -45 10.5407 0.0391
NP_442015.1_10 Forward -49 -36 1.69091 0.204
NP_441226.1_7 Forward -44 -37 14.4934 0.0123
NP_441226.1_7 Reverse -37 -44 14.4934 0.0123
NP_441111.1_7 Forward -44 -36 18.7023 0.00294
NP_441111.1_7 Reverse -37 -45 18.7023 0.00294
NP_441766.1_2 Forward -45 -36 17.5026 0.00297
NP_441766.1_2 Reverse -36 -45 17.5026 0.00297
NP_442417.1_5 Reverse -36 -50 8.84938 0.145
NP_443052.1_8 Reverse -26 -45 1.27776 0.061
NP_443052.1_8 Forward -55 -36 -7.67036 0.162
NP_440261.1_5 Reverse -37 -50 -0.865694 0.0655
NP_440261.1_5 Forward -44 -31 -12.0754 0.27
NP_440988.1_10 Forward -17 -3 5.18926 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGGTTCAGTAAATCAATTTTTGGAAGCGCTCGATCAAGAATGAAAATTGCCTGGTCTCCAAAATCATTACGTTCATTCAAGCGCCTGATTCCCAAAAATCCTAATCTGAGACCGATGATTGAACAAATATTACATCAGTTGGCAACAGATCCTTTTCACCCTAGCCTACGCACCCATAAACTCAAAGGAGAACTAGCTAACGTTTGGTCATGCTCTATCGACTATAATTATCGTCTGCTATTTGAATTTGTAAACAACCCAGAAGACAAGGAAGAGGCAATTTTATTACTTAATTTAGGTTCCCATGATGAAGTCTATTAATTTAACTTGTCAAAAAAGAAAAGTCGATCTTTCGGCGATCGCCAACTCTTCCCCCTTACTTATCCTAGAGGCAACGTC

CDS

ATGAACACAGCTCAAATTAGCACCGATGGCACCCATCAAATCGTTATTTTACCAGAAAACTTTACGATAGCCGGAAGCGAAGTTTACATTAAAAAAATTGGAAGTACAATTATTTTGATTGCTAAAAATAACCCTTGGCAATCCTTAATTGAAAGCTTAGATCAATTTTCAGATGATTTTATGAAAACTAGGGAACAGCCTCCCTTAGATATACGAGAAGAGTTCTAA

Protein

MNTAQISTDGTHQIVILPENFTIAGSEVYIKKIGSTIILIAKNNPWQSLIESLDQFSDDFMKTREQPPLDIREEF