Your browser is old and dusty. Try Google Chrome!

Details for ssl2781

ORF ssl2781
Accession NP_441332.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -319 -305 6.78443 0.114
NP_441061.1_2 Forward -394 -380 0.982901 0.196
NP_441061.1_2 Forward -150 -136 -1.77037 0.272
NP_440557.1_1 Forward -319 -300 0.58944 0.265
NP_440795.1_7 Forward -319 -312 14.6904 0.0123
NP_440795.1_7 Reverse -312 -319 14.6904 0.0123
NP_441418.1_6 Forward -320 -301 -2.36049 0.0184
NP_441418.1_6 Reverse -311 -330 -29.5982 0.23
NP_441418.1_6 Reverse -302 -321 -30.1882 0.262
NP_441480.1_1 Reverse -279 -298 0.392778 0.287
NP_442291.1_5 Reverse -310 -326 -3.8747 0.257
NP_442291.1_10 Forward -155 -136 15.8307 0.27
NP_440897.1_6 Reverse -311 -330 -2.45958 0.214
NP_441453.1_4 Reverse -311 -319 16.539 0.00633
NP_441453.1_4 Forward -320 -312 16.539 0.00633
NP_442151.1_6 Forward -151 -137 8.94771 0.162
NP_442151.1_6 Forward -320 -306 7.57108 0.194
NP_441818.1_1 Reverse -312 -323 9.69459 0.232
NP_440226.1_1 Reverse -311 -330 8.65258 0.0836
NP_440226.1_1 Forward -320 -301 6.4893 0.128
NP_440120.1_4 Reverse -57 -71 13.4709 0.29
NP_442173.1_1 Forward -319 -311 15.4574 0.00633
NP_442173.1_1 Reverse -312 -320 15.4574 0.00633
NP_442752.1_4 Forward -320 -313 13.8055 0.0199
NP_442752.1_4 Reverse -311 -318 13.8055 0.0199
NP_442752.1_4 Forward -219 -212 5.54565 0.194
NP_443027.1_4 Forward -322 -312 14.828 0.0437
NP_443027.1_4 Reverse -309 -319 14.828 0.0437
NP_441812.1_3 Forward -321 -307 13.2743 0.167
NP_442975.1_10 Forward -324 -310 5.40719 0.224
NP_440784.1_7 Forward -319 -312 15.9687 0.0123
NP_440784.1_7 Reverse -312 -319 15.9687 0.0123
NP_441250.1_3 Forward -162 -143 3.24438 0.266
NP_440061.1_9 Forward -153 -139 5.50552 0.283
NP_442062.1_8 Forward -320 -310 19.4496 0.000558
NP_442062.1_8 Reverse -311 -321 19.4496 0.000558
NP_442062.1_8 Forward -331 -321 3.22496 0.279
NP_442062.1_8 Forward -151 -141 3.12662 0.285
NP_440761.1_4 Forward -325 -306 -13.7669 0.257
NP_440304.1_4 Reverse -140 -150 14.0414 0.051
NP_440304.1_4 Forward -322 -312 10.8948 0.051
NP_440304.1_4 Reverse -309 -319 10.8948 0.051
NP_442242.1_4 Forward -319 -312 14.3954 0.0124
NP_442242.1_4 Reverse -312 -319 14.3954 0.0124
NP_442762.1_10 Reverse -374 -393 -18.5851 0.297
NP_441594.1_6 Reverse -139 -158 5.211 0.209
NP_442110.1_7 Forward -320 -306 2.65453 0.222
NP_440273.1_1 Forward -33 -14 13.3207 0.243
NP_440769.1_8 Reverse -336 -355 6.68596 0.289
NP_441083.1_5 Forward -320 -310 11.3864 0.0159
NP_441083.1_5 Reverse -311 -321 11.3864 0.0159
NP_441738.1_2 Forward -318 -311 15.28 0.0102
NP_441738.1_2 Reverse -313 -320 15.28 0.0102
NP_441558.1_5 Reverse -140 -159 6.39097 0.217
NP_441558.1_5 Forward -153 -134 5.40766 0.251
NP_440209.1_1 Reverse -311 -319 18.1123 0.00295
NP_440209.1_1 Forward -320 -312 18.1123 0.00295
NP_442889.1_8 Forward -323 -309 11.5037 0.0733
NP_441713.1_1 Reverse -305 -324 -12.6852 0.248
NP_441713.1_1 Forward -326 -307 -15.1435 0.26
NP_440178.1_7 Reverse -310 -329 -22.0267 0.249
NP_441716.1_1 Reverse -210 -224 10.4227 0.0956
NP_441716.1_1 Reverse -311 -325 6.48943 0.198
NP_442111.1_4 Forward -220 -206 2.5562 0.271
NP_441163.1_4 Forward -293 -274 14.2758 0.277
NP_440906.1_5 Forward -319 -312 15.8704 0.0124
NP_440906.1_5 Reverse -312 -319 15.8704 0.0124
NP_440747.1_10 Reverse -308 -320 7.70879 0.00236
NP_440747.1_10 Forward -323 -311 -2.02597 0.0196
NP_441130.1_10 Reverse -309 -323 11.701 0.106
NP_441486.1_1 Forward -323 -309 18.6825 0.00398
NP_441486.1_1 Reverse -308 -322 9.93102 0.0235
NP_441486.1_1 Reverse -295 -309 -6.19526 0.283
NP_440944.1_2 Forward -332 -313 2.26107 0.249
NP_442330.1_4 Forward -288 -269 13.3846 0.286
NP_442634.1_2 Forward -326 -307 0.884433 0.287
NP_442634.1_4 Forward -322 -308 -1.5737 0.149
NP_442760.1_7 Forward -224 -205 8.55425 0.229
NP_440403.1_10 Forward -64 -45 4.81767 0.251
NP_442848.1_1 Forward -326 -312 -4.32697 0.287
NP_442848.1_9 Reverse -204 -223 -0.688862 0.279
NP_443018.1_3 Forward -319 -312 14.8871 0.0123
NP_443018.1_3 Reverse -312 -319 14.8871 0.0123
NP_443018.1_3 Forward -150 -143 10.7572 0.0907
NP_443018.1_3 Reverse -143 -150 4.56234 0.241
NP_441316.1_7 Forward -322 -307 6.37141 0.107
NP_441634.1_8 Reverse -309 -323 2.35953 0.168
NP_441634.1_8 Forward -256 -242 1.86788 0.178
NP_440376.1_1 Forward -320 -311 19.4693 0.000692
NP_440376.1_1 Reverse -311 -320 19.4693 0.000692
NP_441588.1_4 Reverse -313 -323 6.96153 0.178
NP_442687.1_7 Forward -321 -311 15.8113 0.0125
NP_442687.1_7 Reverse -310 -320 15.8113 0.0125
NP_442485.1_3 Reverse -300 -319 12.0942 0.105
NP_441763.1_10 Forward -331 -312 5.60352 0.284
NP_440360.1_10 Forward -149 -135 4.12949 0.227
NP_442658.1_1 Reverse -309 -319 15.9091 0.00966
NP_442658.1_1 Forward -322 -312 15.9091 0.00966
NP_442658.1_1 Reverse -140 -150 15.2208 0.0156
NP_440141.1_8 Reverse -133 -152 13.6675 0.156
NP_441855.2_4 Reverse -202 -221 11.644 0.211
NP_442782.1_2 Forward -320 -306 0.982901 0.282
NP_442782.1_2 Forward -162 -148 0.0979218 0.296
NP_442496.1_5 Forward -200 -182 5.72234 0.285
NP_440656.1_8 Reverse -300 -319 -7.4737 0.256
NP_441414.1_9 Reverse -311 -330 10.7175 0.02
NP_441414.1_9 Reverse -142 -161 3.73603 0.0578
NP_441414.1_9 Forward -320 -301 -3.63879 0.14
NP_441958.1_5 Forward -321 -311 12.2714 0.00183
NP_441958.1_5 Reverse -310 -320 12.2714 0.00183
NP_440651.1_1 Reverse -374 -393 10.8159 0.231
NP_441127.1_1 Reverse -142 -156 15.0442 0.13
NP_441127.1_1 Reverse -52 -66 7.57108 0.3
NP_440203.1_5 Forward -148 -138 10.4026 0.225
NP_439905.1_1 Forward -150 -137 17.4239 0.0398
NP_440984.1_7 Reverse -306 -320 11.6026 0.122
NP_439990.1_5 Forward -156 -143 12.999 0.103
NP_442911.1_2 Forward -330 -311 16.7157 0.0087
NP_442911.1_2 Reverse -301 -320 15.4374 0.0106
NP_442911.1_2 Forward -161 -142 6.58763 0.0283
NP_441580.1_6 Forward -331 -312 -7.57203 0.244
NP_442119.1_9 Reverse -310 -329 12.2908 0.245
NP_442064.1_1 Forward -124 -105 2.0644 0.146
NP_442064.1_1 Forward -156 -137 -10.0303 0.259
NP_442064.1_4 Forward -65 -46 7.86512 0.237
NP_442051.1_5 Reverse -139 -158 8.84924 0.29
NP_441099.1_5 Forward -330 -311 -10.3253 0.25
NP_442002.1_9 Forward -321 -314 10.7572 0.185
NP_442002.1_9 Reverse -310 -317 10.7572 0.185
NP_440809.1_9 Forward -329 -311 -7.84733 0.225
NP_441294.1_4 Reverse -310 -329 7.57094 0.225
NP_441294.1_7 Forward -324 -310 9.4426 0.244
NP_442438.1_10 Reverse -306 -320 12.3893 0.0412
NP_442438.1_10 Forward -325 -311 11.2093 0.0463
NP_441000.1_6 Reverse -310 -324 13.5693 0.0396
NP_441000.1_6 Forward -321 -307 -4.03198 0.225
NP_442771.1_1 Forward -322 -304 -7.15901 0.169
NP_440147.1_4 Forward -322 -309 2.08423 0.21
NP_440147.1_4 Reverse -309 -322 2.08423 0.21
NP_441550.1_8 Reverse -309 -319 6.0761 0.214
NP_441550.1_8 Forward -322 -312 6.0761 0.214
NP_441916.1_7 Forward -320 -310 18.4663 0.00144
NP_441916.1_7 Reverse -311 -321 18.4663 0.00144
NP_441041.1_4 Reverse -311 -330 7.07928 0.041
NP_441041.1_4 Reverse -380 -399 -13.8652 0.297
NP_441041.1_7 Forward -323 -311 10.916 0.0864
NP_441041.1_7 Reverse -308 -320 7.61196 0.162
NP_442396.1_5 Reverse -307 -320 6.80412 0.219
NP_442396.1_5 Forward -324 -311 5.91914 0.26
NP_440569.1_10 Forward -171 -152 2.91208 0.28
NP_442004.1_6 Forward -400 -386 2.85119 0.255
NP_441725.1_4 Reverse -205 -219 5.80051 0.278
NP_441725.1_5 Forward -150 -140 14.6313 0.0247
NP_441725.1_5 Forward -319 -309 11.2881 0.0247
NP_441725.1_5 Reverse -312 -322 11.2881 0.0247
NP_439966.1_7 Reverse -309 -319 18.4657 0.00473
NP_439966.1_7 Forward -322 -312 18.4657 0.00473
NP_439966.1_9 Forward -322 -313 0.983037 0.253
NP_439966.1_9 Reverse -309 -318 0.983037 0.253
NP_440736.1_1 Forward -221 -202 11.2092 0.291
NP_440202.1_8 Reverse -303 -322 11.9461 0.272
NP_442941.1_3 Forward -319 -309 11.4848 0.0116
NP_442941.1_3 Reverse -312 -322 11.4848 0.0116
NP_440289.1_2 Forward -323 -310 14.6706 0.0107
NP_440289.1_2 Reverse -308 -321 5.13249 0.0636
NP_442281.1_1 Reverse -306 -320 19.1735 0.0032
NP_442281.1_1 Forward -325 -311 3.63724 0.224
NP_441334.1_7 Forward -322 -303 -21.24 0.293
NP_440437.1_1 Forward -326 -307 3.93269 0.114
NP_440437.1_1 Reverse -305 -324 2.94938 0.127
NP_442012.1_1 Forward -225 -206 8.06259 0.106
NP_440498.1_1 Reverse -302 -320 8.08229 0.0795
NP_440498.1_1 Forward -329 -311 1.49411 0.204
NP_441644.1_6 Forward -320 -310 10.1076 0.0628
NP_441644.1_6 Reverse -311 -321 10.1076 0.0628
NP_441644.1_6 Reverse -142 -152 3.91283 0.256
NP_443049.1_6 Forward -45 -35 12.812 0.231
NP_442215.1_1 Forward -324 -305 2.26107 0.296
NP_442215.1_2 Forward -322 -306 4.0901 0.0879
NP_442215.1_2 Reverse -309 -325 -4.46469 0.233
NP_440253.1_2 Reverse -311 -329 1.78911 0.152
NP_440253.1_2 Forward -320 -302 -2.14413 0.261
NP_440929.1_8 Forward -320 -311 19.2726 0.000701
NP_440929.1_8 Reverse -311 -320 19.2726 0.000701
NP_442933.1_10 Forward -320 -311 17.601 0.00325
NP_442933.1_10 Reverse -311 -320 17.601 0.00325
NP_441751.2_8 Reverse -312 -326 5.40779 0.0436
NP_441751.2_8 Forward -319 -305 -1.77037 0.13
NP_442554.1_8 Forward -319 -309 13.8447 0.0145
NP_442554.1_8 Reverse -312 -322 13.8447 0.0145
NP_442554.1_8 Forward -150 -140 6.66654 0.111
NP_442554.1_8 Reverse -143 -153 4.50326 0.184
NP_441762.1_7 Forward -321 -309 12.0354 0.0142
NP_441762.1_7 Reverse -310 -322 12.0354 0.0142
NP_441762.1_7 Reverse -301 -313 -4.28759 0.168
NP_442142.1_4 Reverse -308 -321 19.6848 0.0179
NP_442142.1_4 Forward -323 -310 18.4065 0.0255
NP_442292.1_1 Forward -319 -310 9.63616 0.0183
NP_442292.1_1 Reverse -312 -321 9.63616 0.0183
NP_442292.1_5 Reverse -363 -382 -0.295539 0.257
NP_442476.1_6 Forward -319 -305 5.01447 0.139
NP_442381.1_8 Forward -323 -304 -13.8652 0.28
NP_443009.1_5 Reverse -310 -321 11.6612 0.0602
NP_443009.1_5 Forward -321 -310 11.6612 0.0602
NP_443009.1_5 Reverse -209 -220 3.40144 0.296
NP_442408.2_1 Forward -320 -301 -5.80207 0.277
NP_441715.1_4 Forward -319 -309 16.303 0.0117
NP_441715.1_4 Reverse -312 -322 16.303 0.0117
NP_440357.1_3 Forward -153 -134 5.40766 0.242
NP_440357.1_3 Reverse -139 -158 2.55606 0.255
NP_440015.1_9 Reverse -311 -329 2.18243 0.215
NP_441198.1_8 Reverse -389 -399 14.2479 0.0869
NP_441198.1_8 Reverse -140 -150 13.2713 0.108
NP_440379.1_5 Forward -64 -45 -11.0136 0.288
NP_441468.1_1 Forward -319 -312 15.8704 0.0124
NP_441468.1_1 Reverse -312 -319 15.8704 0.0124
NP_441468.1_1 Reverse -143 -150 4.07068 0.263
NP_441020.2_6 Forward -322 -305 20.295 0.00617
NP_441020.2_6 Forward -221 -204 6.03703 0.28
NP_441673.1_1 Forward -320 -311 20.8459 0.000698
NP_441673.1_1 Reverse -311 -320 20.8459 0.000698
NP_441876.1_9 Forward -146 -136 13.4509 0.267
NP_441826.1_2 Reverse -305 -319 4.12949 0.105
NP_441826.1_2 Forward -326 -312 2.45787 0.127
NP_441637.1_9 Forward -158 -140 4.73903 0.245
NP_442490.1_9 Reverse -299 -318 1.37609 0.166
NP_441764.1_4 Forward -108 -91 14.5652 0.132
NP_441764.1_4 Reverse -113 -130 11.1276 0.232
NP_442868.1_6 Reverse -140 -150 3.81494 0.192
NP_442868.1_6 Forward -322 -312 0.963343 0.205
NP_442868.1_6 Reverse -309 -319 0.963343 0.205
NP_441251.1_6 Reverse -269 -288 13.4708 0.137
NP_441612.1_2 Reverse -116 -126 8.83972 0.21
NP_443058.1_7 Reverse -310 -329 3.73603 0.26
NP_442361.1_3 Reverse -305 -318 9.16406 0.282
NP_442808.1_1 Forward -321 -311 18.4657 0.00201
NP_442808.1_1 Reverse -310 -320 18.4657 0.00201
NP_442808.1_1 Reverse -34 -44 2.73286 0.256
NP_440871.1_2 Forward -299 -280 15.9291 0.241
NP_441849.1_2 Reverse -227 -246 4.72643 0.245
NP_442820.1_3 Forward -342 -332 17.7774 0.187
NP_442718.1_2 Reverse -142 -161 3.53937 0.19
NP_442542.1_9 Reverse -304 -318 11.5037 0.111
NP_442050.1_5 Forward -322 -312 9.12434 0.193
NP_442050.1_5 Reverse -309 -319 9.12434 0.193
NP_440038.1_8 Reverse -374 -393 14.7483 0.238
NP_440630.1_7 Reverse -184 -203 -2.45882 0.239
NP_441937.1_5 Reverse -271 -290 2.65439 0.278
NP_441114.1_3 Forward -149 -140 7.57121 0.231
NP_440558.1_2 Forward -154 -135 12.7825 0.0742
NP_440558.1_2 Reverse -138 -157 -0.295539 0.2
NP_442789.1_4 Forward -322 -303 8.65258 0.0993
NP_442789.1_4 Reverse -366 -385 -7.17871 0.292
NP_441878.1_6 Forward -321 -311 10.4031 0.0176
NP_441878.1_6 Reverse -310 -320 10.4031 0.0176
NP_441878.1_6 Reverse -141 -151 2.33998 0.0405
NP_441878.1_6 Forward -11 -1 0.0783647 0.152
NP_441036.1_8 Forward -321 -311 17.7779 0.000554
NP_441036.1_8 Reverse -310 -320 17.7779 0.000554
NP_441557.1_5 Forward -320 -311 19.9609 0.000699
NP_441557.1_5 Reverse -311 -320 19.9609 0.000699
NP_441445.1_1 Forward -329 -310 6.98095 0.138
NP_441445.1_1 Reverse -302 -321 5.80098 0.163
NP_441308.1_8 Forward -322 -312 10.1081 0.22
NP_441308.1_8 Reverse -309 -319 10.1081 0.22
NP_441458.1_10 Reverse -302 -321 1.0811 0.298
NP_442183.1_1 Forward -320 -306 11.406 0.0702
NP_442183.1_1 Forward -400 -386 7.17775 0.147
NP_442183.1_1 Reverse -311 -325 4.42448 0.261
NP_440440.1_1 Reverse -183 -202 7.07848 0.269
NP_442135.1_2 Reverse -146 -164 19.4899 0.164
NP_441574.1_5 Reverse -151 -170 9.43923 0.242
NP_440276.1_2 Reverse -103 -122 10.8738 0.243
NP_442347.1_2 Forward -319 -310 11.1111 0.056
NP_442347.1_2 Reverse -312 -321 11.1111 0.056
NP_442347.1_2 Reverse -211 -220 8.65285 0.0792
NP_442645.1_2 Forward -328 -309 -13.8652 0.165
NP_440547.1_1 Forward -66 -47 9.7334 0.237
NP_441037.1_4 Reverse -140 -150 7.9999 0.237
NP_441037.1_4 Forward -322 -312 7.02532 0.237
NP_441037.1_4 Reverse -309 -319 7.02532 0.237
NP_441633.1_3 Forward -322 -309 3.5592 0.0699
NP_441633.1_3 Reverse -309 -322 3.5592 0.0699
NP_441633.1_3 Forward -153 -140 -4.01229 0.179
NP_440136.1_2 Forward -319 -312 15.9687 0.0123
NP_440136.1_2 Reverse -312 -319 15.9687 0.0123
NP_442590.1_10 Forward -327 -308 10.7175 0.178
NP_442998.1_10 Forward -318 -311 15.5754 0.0102
NP_442998.1_10 Reverse -313 -320 15.5754 0.0102
NP_440899.1_2 Reverse -300 -319 20.7464 0.0273
NP_440299.1_1 Reverse -307 -320 10.4418 0.0573
NP_440299.1_1 Forward -324 -311 8.18017 0.0964
NP_440299.1_1 Forward -68 -55 2.96866 0.265
NP_440299.1_1 Forward -287 -274 2.18201 0.294
NP_441799.1_1 Reverse -307 -321 15.4369 0.0182
NP_441799.1_1 Forward -324 -310 12.5853 0.0421
NP_441799.1_1 Reverse -138 -152 4.22722 0.261
NP_441799.1_1 Reverse -298 -312 3.8339 0.279
NP_441007.1_10 Reverse -306 -319 1.9859 0.202
NP_441007.1_10 Reverse -137 -150 1.00259 0.209
NP_442333.2_5 Reverse -300 -319 -13.3736 0.255
NP_440256.1_1 Forward -323 -304 1.17943 0.0775
NP_440256.1_1 Reverse -308 -327 -0.4922 0.0936
NP_441362.1_2 Forward -273 -254 4.5041 0.269
NP_441559.1_8 Forward -325 -311 0.982901 0.159
NP_441559.1_8 Forward -336 -322 -0.197071 0.174
NP_441559.1_8 Forward -346 -332 -6.19526 0.275
NP_441559.1_8 Reverse -306 -320 -7.08024 0.283
NP_440915.1_6 Forward -324 -310 3.63784 0.101
NP_440306.1_8 Forward -360 -341 0.981987 0.204
NP_442993.1_1 Reverse -311 -327 1.63183 0.0504
NP_442993.1_1 Forward -320 -304 -9.18458 0.179
NP_440677.1_1 Reverse -133 -152 8.84924 0.2
NP_442386.1_9 Reverse -310 -319 15.7322 0.0144
NP_442386.1_9 Forward -321 -312 15.7322 0.0144
NP_441340.1_5 Forward -319 -312 15.6737 0.0124
NP_441340.1_5 Reverse -312 -319 15.6737 0.0124
NP_441340.1_5 Forward -150 -143 3.97235 0.274
NP_441271.1_1 Forward -326 -308 12.6047 0.236
NP_440168.1_8 Forward -61 -42 16.2241 0.081
NP_440168.1_9 Forward -322 -303 -4.72043 0.296
NP_440161.1_3 Reverse -151 -170 11.2092 0.219
NP_440161.1_3 Reverse -309 -328 9.14423 0.255
NP_440586.1_8 Forward -319 -312 13.2151 0.026
NP_440586.1_8 Reverse -312 -319 13.2151 0.026
NP_440586.1_8 Forward -282 -275 9.18354 0.171
NP_442251.1_6 Forward -319 -312 15.2804 0.0124
NP_442251.1_6 Reverse -312 -319 15.2804 0.0124
NP_441262.1_3 Reverse -311 -318 14.7888 0.0223
NP_441262.1_3 Forward -320 -313 14.7888 0.0223
NP_440027.1_3 Reverse -301 -319 3.45998 0.272
NP_443051.1_1 Reverse -310 -319 10.4228 0.00754
NP_443051.1_1 Forward -321 -312 10.4228 0.00754
NP_439937.1_9 Reverse -310 -327 0.628129 0.0978
NP_441595.1_2 Reverse -146 -159 10.2794 0.277
NP_442374.1_3 Forward -69 -52 15.4768 0.185
NP_440408.1_7 Reverse -141 -160 7.27595 0.29
NP_440439.1_1 Reverse -308 -321 15.5556 0.0137
NP_440439.1_1 Forward -323 -310 8.37742 0.0537
NP_440372.1_2 Forward -319 -312 16.3621 0.0124
NP_440372.1_2 Reverse -312 -319 16.3621 0.0124
NP_440819.1_5 Reverse -331 -339 7.8859 0.266
NP_440316.1_10 Reverse -141 -151 6.96153 0.251
NP_441803.1_2 Reverse -306 -325 9.43923 0.0999
NP_439977.1_5 Forward -157 -138 3.73603 0.158
NP_439977.1_5 Reverse -40 -59 -3.14714 0.296
NP_440139.1_1 Forward -326 -307 13.8633 0.0567
NP_440139.1_1 Reverse -305 -324 5.70185 0.154
NP_441572.1_7 Reverse -305 -324 5.30933 0.0887
NP_441572.1_7 Forward -326 -307 1.57275 0.147
NP_442384.1_10 Forward -320 -307 13.884 0.018
NP_442384.1_10 Reverse -311 -324 7.39411 0.0822
NP_442713.1_9 Reverse -141 -160 22.8114 0.0437
NP_441018.1_7 Forward -167 -148 6.98095 0.278
NP_441018.1_7 Forward -166 -147 6.09597 0.299
NP_442262.1_10 Forward -319 -312 14.1988 0.0123
NP_442262.1_10 Reverse -312 -319 14.1988 0.0123
NP_442262.1_10 Forward -150 -143 9.87221 0.164
NP_441689.1_5 Reverse -309 -319 8.53436 0.132
NP_441689.1_5 Forward -322 -312 8.53436 0.132
NP_442244.1_9 Forward -399 -380 10.2259 0.194
NP_440163.1_10 Reverse -308 -318 16.303 0.0762
NP_440163.1_10 Forward -323 -313 15.2213 0.0762
NP_440344.1_10 Forward -327 -310 10.5603 0.00697
NP_440344.1_10 Reverse -304 -321 -1.73112 0.0566
NP_440282.1_10 Reverse -301 -320 -7.37537 0.251
NP_440531.1_6 Reverse -303 -322 5.211 0.116
NP_440531.1_8 Forward -88 -69 2.94938 0.279
NP_440487.1_1 Forward -323 -304 -4.91709 0.214
NP_441965.1_10 Forward -323 -307 17.1681 0.0425
NP_440297.1_9 Forward -319 -309 9.32148 0.0917
NP_440297.1_9 Reverse -312 -322 9.32148 0.0917
NP_440297.1_9 Forward -150 -140 7.25653 0.136
NP_441896.1_3 Reverse -302 -321 -0.590531 0.241
NP_442067.1_4 Reverse -300 -319 10.4225 0.158
NP_440999.1_9 Reverse -307 -321 1.08123 0.171
NP_440888.1_2 Reverse -311 -325 17.4035 0.00402
NP_440888.1_2 Forward -320 -306 13.9619 0.022
NP_440491.1_1 Forward -323 -304 10.4255 0.188
NP_439969.1_3 Reverse -205 -224 1.17943 0.257
NP_442277.1_2 Forward -152 -138 17.9942 0.14
NP_441543.1_2 Forward -319 -310 18.486 0.00236
NP_441543.1_2 Reverse -312 -321 18.486 0.00236
NP_441543.1_2 Forward -282 -273 4.91628 0.213
NP_442845.1_2 Forward -326 -312 3.8345 0.275
NP_441551.1_5 Reverse -307 -323 6.84268 0.256
NP_441319.1_8 Reverse -305 -323 4.83737 0.285
NP_441469.1_8 Reverse -310 -319 16.126 0.00797
NP_441469.1_8 Forward -321 -312 16.126 0.00797
NP_441469.1_8 Reverse -141 -150 9.63616 0.227
NP_443064.1_6 Forward -219 -209 8.30077 0.3
NP_442578.1_7 Forward -319 -312 14.5921 0.026
NP_442578.1_7 Reverse -312 -319 14.5921 0.026
NP_441462.1_2 Forward -320 -310 11.5831 0.00406
NP_441462.1_2 Reverse -311 -321 11.5831 0.00406
NP_441621.1_7 Forward -322 -308 6.09611 0.068
NP_441621.1_7 Reverse -300 -314 -2.95034 0.188
NP_441621.1_7 Reverse -309 -323 -3.73699 0.193
NP_443062.1_1 Reverse -311 -329 18.0041 0.023
NP_443062.1_6 Forward -328 -309 20.649 0.0427
NP_442204.1_1 Forward -210 -199 6.74518 0.152
NP_442204.1_1 Reverse -307 -318 -0.137991 0.286
NP_440544.1_5 Forward -123 -116 14.5681 0.264
NP_440516.1_8 Forward -320 -311 16.9127 0.00442
NP_440516.1_8 Reverse -311 -320 16.9127 0.00442
NP_442428.1_4 Reverse -310 -329 6.58763 0.196
NP_442428.1_5 Forward -319 -312 15.8704 0.0124
NP_442428.1_5 Reverse -312 -319 15.8704 0.0124
NP_442428.1_5 Reverse -143 -150 4.46401 0.267
NP_440618.1_1 Forward -191 -172 -8.752 0.282
NP_442120.1_10 Forward -388 -369 -12.5869 0.273
NP_442120.1_10 Reverse -142 -161 -15.4385 0.294
NP_440673.1_3 Forward -318 -311 12.4288 0.0426
NP_440673.1_3 Reverse -313 -320 12.4288 0.0426
NP_440673.1_3 Forward -149 -142 8.98723 0.203
NP_440673.1_3 Forward -59 -52 7.80726 0.244
NP_440673.1_7 Forward -318 -299 2.55606 0.224
NP_441052.1_2 Forward -320 -310 10.5014 0.0285
NP_441052.1_2 Reverse -311 -321 10.5014 0.0285
NP_442219.1_9 Forward -319 -310 8.35786 0.0681
NP_442219.1_9 Reverse -312 -321 8.35786 0.0681
NP_440436.1_4 Forward -319 -310 18.1905 0.00233
NP_440436.1_4 Reverse -312 -321 18.1905 0.00233
NP_440436.1_4 Forward -150 -141 9.73406 0.0871
NP_441884.1_9 Forward -323 -304 -4.81876 0.0594
NP_441719.1_4 Forward -319 -312 16.3621 0.0124
NP_441719.1_4 Reverse -312 -319 16.3621 0.0124
NP_441733.1_10 Forward -323 -310 10.2457 0.106
NP_441733.1_10 Reverse -308 -321 7.78743 0.15
NP_441004.1_4 Reverse -139 -149 10.3048 0.254
NP_442366.1_3 Reverse -310 -328 -1.65248 0.216
NP_442366.1_3 Forward -321 -303 -2.3408 0.226
NP_441437.1_1 Forward -150 -131 12.4875 0.264
NP_441115.1_4 Reverse -310 -328 12.1131 0.115
NP_442206.1_1 Forward -151 -132 -11.2103 0.219
NP_442206.1_10 Forward -320 -305 7.15806 0.178
NP_443054.1_2 Reverse -309 -323 12.7826 0.0722
NP_443054.1_2 Forward -322 -308 3.34284 0.24
NP_441851.1_10 Forward -321 -311 16.008 0.00552
NP_441851.1_10 Reverse -310 -320 16.008 0.00552
NP_441851.1_10 Reverse -141 -151 6.07655 0.187
NP_441851.1_10 Reverse -390 -400 4.20827 0.282
YP_003858593.1_3 Reverse -144 -163 16.4199 0.282
NP_441157.1_1 Forward -104 -90 6.78381 0.187
NP_441542.1_4 Reverse -147 -161 3.24451 0.289
NP_442856.1_7 Reverse -302 -321 -5.9004 0.289
NP_442515.1_1 Reverse -141 -155 9.14437 0.066
NP_442515.1_1 Forward -321 -307 -4.62196 0.298
NP_440463.1_7 Forward -286 -272 16.4209 0.239
NP_440463.1_7 Forward -89 -75 15.3392 0.265
NP_440463.1_8 Forward -62 -43 6.43495 0.269
NP_441046.1_2 Forward -162 -143 4.62101 0.228
NP_441046.1_2 Forward -331 -312 -0.983855 0.287
NP_441046.1_2 Reverse -105 -124 -1.67217 0.292
NP_440940.1_7 Forward -330 -312 12.998 0.0844
NP_441349.1_10 Forward -330 -311 0.982764 0.0852
NP_441409.1_6 Forward -326 -307 -13.3736 0.236
NP_441409.1_6 Reverse -305 -324 -14.8485 0.269
NP_441409.1_8 Reverse -106 -125 10.5835 0.22
NP_440474.1_8 Reverse -312 -326 14.0603 0.0658
NP_440474.1_8 Forward -319 -305 5.99717 0.235
NP_440474.1_8 Reverse -143 -157 5.1122 0.257
NP_440431.1_4 Forward -40 -21 -2.62645 0.224
NP_442450.1_5 Reverse -208 -218 11.4848 0.115
NP_442450.1_5 Reverse -309 -319 9.32148 0.115
NP_442450.1_5 Forward -322 -312 9.32148 0.115
NP_440588.1_2 Reverse -293 -312 0.786102 0.144
NP_440588.1_2 Forward -329 -310 -2.75381 0.172
NP_441031.1_1 Reverse -95 -114 3.64132 0.299
NP_441570.1_1 Forward -320 -302 -7.55234 0.0914
NP_441570.1_1 Reverse -311 -329 -15.0255 0.227
NP_441078.1_4 Forward -320 -311 19.6659 0.0007
NP_441078.1_4 Reverse -311 -320 19.6659 0.0007
NP_441078.1_4 Reverse -142 -151 -1.57357 0.266
NP_442729.1_8 Reverse -307 -320 9.36073 0.125
NP_440707.1_6 Reverse -303 -322 10.4217 0.283
NP_440526.1_3 Reverse -312 -323 1.92649 0.267
NP_440526.1_3 Forward -150 -139 1.53316 0.267
NP_441432.1_8 Reverse -310 -319 8.25953 0.0755
NP_441432.1_8 Forward -321 -312 8.25953 0.0755
NP_441432.1_8 Reverse -141 -150 6.5879 0.112
NP_442320.1_8 Forward -326 -312 6.98109 0.0223
NP_442320.1_8 Reverse -305 -319 -3.93365 0.136
NP_441732.1_2 Reverse -307 -323 -17.4444 0.258
NP_442003.1_4 Forward -306 -287 12.1925 0.272
NP_442274.1_8 Forward -62 -44 13.856 0.286
NP_440199.1_10 Forward -323 -313 14.533 0.0861
NP_441072.1_2 Forward -324 -305 8.16093 0.24
NP_442400.1_10 Reverse -154 -167 9.89744 0.27
NP_442489.1_7 Forward -320 -311 20.1576 0.000695
NP_442489.1_7 Reverse -311 -320 20.1576 0.000695
NP_442489.1_7 Reverse -142 -151 -1.57357 0.213
NP_442489.1_7 Forward -151 -142 -2.06522 0.288
NP_442079.1_7 Forward -319 -300 5.40766 0.175
NP_442079.1_7 Reverse -312 -331 2.65439 0.225
NP_440559.1_1 Reverse -312 -321 8.75118 0.0586
NP_440559.1_1 Forward -319 -310 8.75118 0.0586
NP_442763.1_1 Forward -267 -248 9.43923 0.245
NP_441659.2_8 Forward -320 -310 11.9764 0.0147
NP_441659.2_8 Reverse -311 -321 11.9764 0.0147
NP_442749.1_5 Reverse -164 -181 9.18776 0.218
NP_440708.1_6 Forward -384 -365 -5.99873 0.234
NP_442346.1_5 Reverse -141 -151 13.1564 0.029
NP_442346.1_5 Forward -321 -311 9.02648 0.118
NP_442346.1_5 Reverse -310 -320 9.02648 0.118
NP_440545.1_3 Forward -324 -307 -3.00942 0.197
NP_440545.1_3 Forward -155 -138 -6.05768 0.268
NP_440545.1_3 Reverse -42 -59 -7.04099 0.295
NP_441856.1_3 Forward -323 -304 7.17762 0.105
NP_440831.1_3 Reverse -302 -321 13.5709 0.123
NP_441629.1_1 Forward -328 -309 12.4875 0.154
NP_440459.1_2 Forward -329 -312 11.6419 0.169
NP_441653.1_2 Forward -319 -300 2.94981 0.28
NP_440010.1_10 Reverse -130 -149 6.68596 0.226
NP_442551.1_4 Forward -153 -138 8.82968 0.141
NP_442551.1_4 Reverse -139 -154 -0.413427 0.245
NP_442900.1_1 Forward -207 -188 -7.57203 0.263
NP_442311.1_5 Reverse -330 -349 1.96607 0.254
NP_440847.1_3 Forward -393 -379 11.4053 0.263
NP_440847.1_3 Reverse -33 -47 11.2087 0.271
NP_442603.1_7 Forward -320 -306 8.75042 0.166
NP_440946.1_4 Forward -87 -68 9.73422 0.229
NP_441948.1_4 Reverse -304 -322 6.01734 0.0685
NP_441948.1_4 Forward -327 -309 0.707465 0.135
NP_441358.1_3 Reverse -154 -172 11.3264 0.249
NP_441833.1_4 Forward -319 -312 15.9687 0.0124
NP_441833.1_4 Reverse -312 -319 15.9687 0.0124
NP_441329.1_6 Reverse -107 -126 -2.81744 0.294
NP_442162.1_9 Forward -319 -312 16.2637 0.0124
NP_442162.1_9 Reverse -312 -319 16.2637 0.0124
NP_440671.1_4 Forward -326 -312 14.8476 0.0546
NP_442404.1_9 Forward -148 -134 8.25877 0.296
NP_440204.1_5 Forward -126 -107 21.4356 0.0898
NP_442140.1_3 Forward -319 -309 8.33817 0.119
NP_442140.1_3 Reverse -312 -322 8.33817 0.119
NP_442140.1_3 Reverse -143 -153 3.91327 0.271
NP_440875.1_2 Reverse -30 -49 8.65258 0.203
NP_440875.1_9 Forward -318 -308 9.05339 0.233
NP_440875.1_9 Reverse -313 -323 8.37203 0.233
NP_440875.1_9 Forward -252 -242 8.08002 0.243
NP_441813.1_5 Reverse -309 -319 17.188 0.00979
NP_441813.1_5 Forward -322 -312 17.188 0.00979
NP_442028.1_1 Forward -131 -118 13.1442 0.251
NP_441227.1_6 Forward -235 -216 14.0608 0.293
NP_440590.1_4 Reverse -312 -325 5.23083 0.0585
NP_440590.1_4 Forward -319 -306 -4.89726 0.269
NP_440567.1_1 Forward -319 -305 14.0609 0.0191
NP_440567.1_1 Reverse -312 -326 10.7177 0.033
NP_442497.1_10 Forward -319 -310 10.4228 0.0087
NP_442497.1_10 Reverse -312 -321 10.4228 0.0087
NP_442497.1_10 Forward -150 -141 0.196389 0.208
NP_440821.1_4 Reverse -309 -319 19.0562 0.00399
NP_440821.1_4 Forward -322 -312 19.0562 0.00399
NP_440821.1_4 Reverse -140 -150 0.0783647 0.205
NP_441239.1_9 Forward -322 -310 15.8703 0.0178
NP_441239.1_9 Reverse -309 -321 15.8703 0.0178
NP_441239.1_9 Reverse -140 -152 8.00379 0.145
NP_441951.1_4 Forward -320 -301 1.57275 0.283
NP_440833.1_6 Forward -263 -249 7.27547 0.282
NP_440949.1_5 Forward -322 -303 17.8957 0.221
NP_440354.1_7 Reverse -305 -323 10.1472 0.224
NP_442052.1_8 Reverse -140 -150 12.7631 0.253
NP_440546.1_4 Forward -320 -310 11.8882 0.0679
NP_440546.1_4 Reverse -311 -321 11.8882 0.0679
NP_440462.1_6 Reverse -309 -319 15.418 0.0142
NP_440462.1_6 Forward -322 -312 15.418 0.0142
NP_440462.1_6 Forward -46 -36 3.02829 0.264
NP_440868.1_4 Reverse -307 -319 17.7386 0.0124
NP_440868.1_4 Forward -324 -312 8.79043 0.0582
NP_442479.1_9 Reverse -152 -171 -13.1769 0.288
NP_441474.1_1 Reverse -301 -320 0.392004 0.255
NP_441848.1_4 Reverse -337 -353 7.83714 0.288
NP_442358.1_1 Reverse -303 -321 20.767 0.0564
NP_442039.1_4 Forward -319 -312 15.1821 0.0124
NP_442039.1_4 Reverse -312 -319 15.1821 0.0124
NP_442039.1_7 Reverse -144 -154 14.0414 0.211
NP_442039.1_7 Reverse -135 -145 12.1731 0.257
NP_442039.1_7 Reverse -276 -286 7.55152 0.275
NP_441811.1_8 Reverse -136 -150 9.34103 0.227
NP_442625.1_4 Reverse -299 -318 2.85105 0.288
NP_441926.1_3 Reverse -311 -327 5.36841 0.17
NP_442837.1_3 Forward -319 -312 15.7721 0.0124
NP_442837.1_3 Reverse -312 -319 15.7721 0.0124
NP_442837.1_3 Reverse -211 -218 6.52896 0.2
NP_442837.1_3 Forward -306 -299 6.43063 0.212
NP_440160.1_1 Reverse -111 -130 10.2463 0.244
NP_442053.1_1 Forward -320 -311 18.3876 0.0007
NP_442053.1_1 Reverse -311 -320 18.3876 0.0007
NP_440505.1_3 Forward -322 -312 13.8447 0.0247
NP_440505.1_3 Reverse -309 -319 13.8447 0.0247
NP_441102.1_1 Forward -319 -300 6.98095 0.231
NP_441203.1_1 Forward -319 -300 -0.885524 0.0636
NP_440914.1_1 Reverse -142 -152 12.226 0.0652
NP_440914.1_1 Forward -320 -310 8.6151 0.186
NP_440914.1_1 Reverse -311 -321 8.6151 0.186
NP_441011.1_8 Forward -319 -310 16.9127 0.00602
NP_441011.1_8 Reverse -312 -321 16.9127 0.00602
NP_442101.1_10 Reverse -303 -322 -6.88371 0.205
NP_442533.1_1 Forward -323 -304 -14.3569 0.242
NP_442533.1_6 Forward -320 -311 17.2076 0.00137
NP_442533.1_6 Reverse -311 -320 17.2076 0.00137
NP_442541.1_10 Forward -151 -137 2.06395 0.269
NP_440263.1_5 Forward -350 -336 16.9125 0.192
NP_442322.1_2 Reverse -152 -171 16.2232 0.229
NP_441482.1_7 Reverse -305 -319 -9.24352 0.196
NP_439944.1_9 Forward -319 -309 10.3048 0.0887
NP_439944.1_9 Reverse -312 -322 10.3048 0.0887
NP_439944.1_9 Reverse -143 -153 4.89658 0.292
NP_441028.1_6 Forward -124 -114 14.0409 0.158
NP_441028.1_6 Reverse -30 -40 7.45273 0.229
NP_442202.1_6 Reverse -142 -161 0.0977854 0.265
NP_440116.1_8 Reverse -312 -331 -5.40875 0.192
NP_441527.1_4 Reverse -105 -124 -4.91826 0.191
NP_441527.1_4 Reverse -104 -123 -5.30023 0.198
NP_441527.1_4 Reverse -106 -125 -8.54695 0.247
NP_441527.1_4 Forward -260 -241 -10.6478 0.272
NP_441527.1_4 Reverse -103 -122 -13.0351 0.298
NP_440115.1_6 Reverse -139 -149 6.46988 0.181
NP_440115.1_6 Forward -222 -212 5.68323 0.227
NP_439965.1_1 Reverse -302 -321 0.491109 0.146
NP_440608.1_6 Forward -319 -300 4.52188 0.26
NP_442673.1_5 Forward -158 -140 13.3922 0.272
NP_441106.1_1 Reverse -310 -319 18.191 0.0028
NP_441106.1_1 Forward -321 -312 18.191 0.0028
NP_442306.1_10 Forward -155 -136 -14.5535 0.197
NP_442306.1_10 Reverse -137 -156 -21.6334 0.282
NP_441286.1_1 Forward -321 -309 4.95553 0.027
NP_441286.1_1 Reverse -310 -322 4.95553 0.027
NP_441286.1_1 Forward -152 -140 3.2839 0.048
NP_442674.1_1 Reverse -139 -158 19.4926 0.133
NP_442674.1_3 Reverse -303 -322 2.85027 0.297
NP_440670.1_8 Forward -320 -311 18.3876 0.000699
NP_440670.1_8 Reverse -311 -320 18.3876 0.000699
NP_442908.1_1 Forward -124 -105 1.17943 0.277
NP_441930.1_2 Reverse -141 -151 12.2714 0.262
NP_440886.1_7 Forward -321 -311 17.7774 0.0011
NP_440886.1_7 Reverse -310 -320 17.7774 0.0011
NP_440886.1_7 Reverse -34 -44 4.20782 0.249
NP_442614.1_2 Forward -320 -306 10.3243 0.234
NP_439995.1_5 Forward -330 -311 5.30933 0.276
NP_440205.1_3 Forward -52 -33 10.4225 0.174
NP_442072.1_9 Reverse -310 -328 -3.22577 0.0354
NP_441753.1_10 Forward -329 -310 3.6377 0.214
NP_440907.2_8 Forward -319 -309 7.84605 0.117
NP_440907.2_8 Reverse -312 -322 7.84605 0.117
NP_440907.2_8 Forward -399 -389 3.8145 0.297
NP_442264.1_2 Reverse -132 -149 6.03703 0.267
NP_441021.1_8 Forward -325 -307 0.707465 0.299
NP_441463.1_3 Forward -330 -311 -1.27885 0.138
NP_441463.1_6 Forward -322 -308 6.12603 0.283
NP_441626.1_2 Forward -319 -312 15.7721 0.0124
NP_441626.1_2 Reverse -312 -319 15.7721 0.0124
NP_442912.1_5 Forward -365 -346 14.0608 0.279
NP_442365.1_5 Forward -150 -131 6.88262 0.268
NP_440107.1_5 Forward -321 -302 -1.37718 0.178
NP_441401.1_4 Forward -31 -18 13.294 0.28
NP_442615.1_1 Forward -329 -311 -3.32411 0.159
NP_441962.1_4 Reverse -137 -156 -3.63879 0.151
NP_441962.1_4 Forward -259 -240 -8.65367 0.203
NP_441962.1_4 Reverse -41 -60 -12.5869 0.26
NP_440387.1_1 Forward -320 -304 3.79511 0.0519
NP_440387.1_1 Reverse -311 -327 -1.12144 0.142
NP_441836.1_2 Reverse -136 -155 -4.52377 0.259
NP_440814.1_4 Forward -329 -310 -12.0953 0.229
NP_440114.1_10 Reverse -311 -325 12.8809 0.0698
NP_440114.1_10 Forward -320 -306 6.3911 0.273
NP_442698.1_10 Reverse -138 -157 6.78429 0.233
NP_441510.2_7 Reverse -305 -319 10.2254 0.281
NP_440766.1_4 Forward -324 -310 8.35772 0.0871
NP_440766.1_4 Reverse -307 -321 7.9644 0.0871
NP_441237.1_9 Forward -150 -140 14.1397 0.0488
NP_442743.1_4 Forward -319 -300 -6.49039 0.279
NP_442743.1_8 Forward -134 -115 7.48206 0.278
NP_439910.1_2 Forward -328 -311 16.1651 0.00114
NP_440457.1_1 Forward -324 -312 9.57708 0.092
NP_440457.1_1 Forward -223 -211 7.02048 0.105
NP_440457.1_1 Reverse -307 -319 1.21895 0.244
NP_442940.1_2 Forward -398 -379 3.34271 0.258
NP_440798.1_6 Forward -319 -306 3.85419 0.147
NP_441981.1_3 Forward -187 -173 16.4507 0.268
NP_440142.1_7 Forward -192 -173 7.57094 0.252
NP_441332.1_3 Reverse -344 -363 7.47261 0.259
NP_441436.1_2 Forward -203 -184 -6.78538 0.296
NP_442509.1_9 Forward -320 -310 16.2041 0.00739
NP_442509.1_9 Reverse -311 -321 16.2041 0.00739
NP_442509.1_9 Reverse -210 -220 7.94438 0.195
NP_441489.1_3 Reverse -145 -159 10.8977 0.229
NP_441489.1_3 Reverse -114 -128 7.84196 0.244
NP_441159.1_8 Forward -127 -108 10.1267 0.126
NP_440554.1_4 Forward -319 -309 14.6313 0.02
NP_440554.1_4 Reverse -312 -322 14.6313 0.02
NP_441845.1_6 Forward -332 -314 15.7521 0.0973
NP_441885.1_5 Forward -320 -310 11.4848 0.00668
NP_441885.1_5 Reverse -311 -321 11.4848 0.00668
NP_441428.1_8 Reverse -134 -153 7.37428 0.206
NP_442703.1_9 Reverse -107 -125 4.9357 0.244
NP_442703.1_9 Reverse -92 -110 3.65739 0.285
NP_442341.1_7 Forward -321 -307 14.0609 0.0326
NP_442341.1_7 Reverse -310 -324 10.0294 0.0682
NP_442341.1_7 Forward -220 -206 1.76955 0.281
NP_442341.1_9 Forward -322 -308 8.06211 0.179
NP_442341.1_9 Reverse -309 -323 6.19383 0.238
NP_440191.1_4 Forward -348 -338 14.9903 0.254
NP_443000.1_7 Forward -322 -312 8.73149 0.0437
NP_443000.1_7 Reverse -309 -319 8.73149 0.0437
NP_441842.1_10 Reverse -304 -318 6.78443 0.272
NP_440275.1_3 Forward -322 -312 8.4365 0.0602
NP_440275.1_3 Reverse -309 -319 8.4365 0.0602
NP_440091.1_1 Forward -324 -312 20.1968 0.00953
NP_440091.1_1 Reverse -307 -319 1.41561 0.197
NP_440091.1_1 Reverse -51 -63 0.23564 0.259
NP_441183.1_2 Reverse -121 -131 18.1647 0.243
NP_441902.1_3 Reverse -115 -125 12.2043 0.259
NP_440679.1_10 Forward -318 -299 13.1758 0.0419
NP_440679.1_10 Reverse -135 -154 -20.0601 0.283
NP_443010.1_10 Reverse -308 -325 8.76209 0.16
NP_442451.1_2 Reverse -303 -322 -7.96535 0.241
NP_440258.1_7 Forward -129 -110 12.7478 0.287
NP_439962.1_4 Reverse -303 -322 -5.70374 0.28
NP_442495.1_5 Reverse -380 -399 6.39097 0.291
NP_440149.1_8 Forward -320 -301 19.2723 0.00869
NP_440216.1_1 Reverse -311 -325 7.66941 0.00931
NP_440216.1_1 Forward -320 -306 7.57108 0.00935
NP_440216.1_1 Forward -331 -317 -12.4884 0.274
NP_440172.1_1 Forward -320 -310 8.73149 0.0586
NP_440172.1_1 Reverse -311 -321 8.73149 0.0586
NP_440172.1_1 Reverse -142 -152 2.43831 0.279
NP_442015.1_10 Reverse -307 -320 9.36073 0.0503
NP_442015.1_10 Forward -324 -311 0.904263 0.216
NP_441226.1_7 Forward -319 -312 14.4934 0.0123
NP_441226.1_7 Reverse -312 -319 14.4934 0.0123
NP_442446.1_7 Reverse -359 -378 -1.86883 0.294
NP_441757.1_3 Forward -321 -302 0.58944 0.188
NP_441111.1_7 Forward -319 -311 18.7023 0.00294
NP_441111.1_7 Reverse -312 -320 18.7023 0.00294
NP_441766.1_2 Forward -320 -311 17.5026 0.00297
NP_441766.1_2 Reverse -311 -320 17.5026 0.00297
NP_441766.1_9 Reverse -303 -322 -2.55715 0.284
NP_442417.1_5 Forward -283 -269 12.1926 0.0981
NP_442417.1_5 Forward -320 -306 9.73436 0.127
NP_440416.1_9 Reverse -304 -323 -6.1954 0.0866
NP_440416.1_9 Forward -327 -308 -17.7985 0.247
NP_443052.1_8 Forward -330 -311 -5.01543 0.125
NP_443052.1_8 Reverse -301 -320 -9.73531 0.194
NP_443052.1_8 Reverse -45 -64 -11.1119 0.223
NP_440591.1_9 Forward -290 -272 7.09898 0.214
NP_442046.1_2 Reverse -122 -135 14.8617 0.262
NP_440261.1_5 Forward -319 -306 8.37742 0.0263
NP_440261.1_5 Forward -150 -137 4.8375 0.0516
NP_440261.1_5 Forward -310 -297 -6.56889 0.201
NP_440261.1_5 Reverse -312 -325 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGGATTCCACCCGCACCGTCAACTTGATTGGCCCGTAGGTGAAAAAGATATTTTCCGCAGTTTTGCCCGGCAATTGAACGGCGATCGCCGTGAGGGCTCCCAAACAAACGGACTGCAGCCAACGACGGAGGTTTAAGGGAAAAGTGACCATGGAAGCTATATCGAGATTAATTAAAGGGGGGGGATCAACCAAGTTGCTGGACTGGAGCAGTGGGCAAGAAACCTGAGCTAATTCTAGGCAATTTTGTTGCCATTGCCCCCAACGTAAAGTTATTTTTTTCTCCATTACCTTTTGTTACCTAAAATTTAATGGAGCCAACCTAGGCTGGACCTTTTGTCACCGTTGCTCTGTCCACGGGATGGAGGATAATCTAAACGAAATCATTAGGGACCCTGACC

CDS

ATGCAAAAAGCCGACGAATTTGCCATCCATCTGTTTTTGGCCAATGGCCATCGAGAGGAAGTCCGTTTCATGACCATTCAAGATTTCCAAAAATGGTATAGCAACGAAGTTGTGCCCAAGCACGATTCCCAGGAATTTATCAGTGTGCCTATCAGAAATATTCAGGGCGAGTACATGGTGGTGCGACCCTCGGCGATCGTTGCCATTCGGGTGGAACCAATTTTCTTTGGCAGTGTGGAGCGCATGTAA

Protein

MQKADEFAIHLFLANGHREEVRFMTIQDFQKWYSNEVVPKHDSQEFISVPIRNIQGEYMVVRPSAIVAIRVEPIFFGSVERM