Your browser is old and dusty. Try Google Chrome!

Details for ssl2749

ORF ssl2749
Accession NP_441358.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -79 -93 -1.96703 0.278
NP_440557.1_1 Forward -201 -182 -1.57384 0.276
NP_440795.1_7 Forward -374 -367 7.51227 0.24
NP_441418.1_6 Forward -375 -356 -29.7948 0.238
NP_441453.1_4 Reverse -235 -243 6.80426 0.121
NP_441453.1_4 Forward -244 -236 6.11594 0.121
NP_441453.1_7 Forward -157 -150 14.1988 0.175
NP_442173.1_1 Forward -243 -235 12.0158 0.0316
NP_442173.1_1 Reverse -236 -244 4.83764 0.241
NP_442752.1_4 Reverse -235 -242 13.8055 0.0199
NP_442975.1_10 Forward -248 -234 2.16228 0.283
NP_441675.1_4 Forward -296 -277 2.75272 0.287
NP_440784.1_7 Reverse -236 -243 6.23397 0.241
NP_440784.1_7 Forward -243 -236 6.13563 0.241
NP_441054.1_2 Forward -304 -285 14.8474 0.156
NP_441054.1_2 Forward -141 -122 10.1275 0.284
NP_441476.1_5 Reverse -188 -207 -0.983855 0.2
NP_442062.1_8 Reverse -278 -288 2.7333 0.297
NP_440044.1_8 Reverse -236 -255 -3.24547 0.281
NP_439918.1_2 Forward -58 -39 -5.21209 0.298
NP_441200.1_6 Reverse -298 -315 10.0686 0.285
NP_440132.1_1 Forward -377 -359 9.45892 0.236
NP_441083.1_5 Forward -244 -234 8.82982 0.03
NP_441083.1_5 Reverse -235 -245 -0.904945 0.283
NP_441738.1_2 Forward -242 -235 15.28 0.0102
NP_441738.1_2 Forward -249 -242 8.29857 0.176
NP_441738.1_4 Reverse -297 -316 6.09597 0.203
NP_440209.1_1 Reverse -235 -243 8.57422 0.0425
NP_440209.1_1 Forward -244 -236 5.52596 0.0821
NP_442398.1_1 Reverse -276 -295 10.5209 0.241
NP_440659.1_9 Reverse -226 -245 10.9142 0.232
NP_442570.1_3 Forward -55 -36 5.01433 0.159
NP_442570.1_3 Forward -378 -359 -9.34199 0.298
NP_441163.1_1 Forward -259 -242 8.19958 0.232
NP_440906.1_5 Reverse -236 -243 6.23397 0.234
NP_440906.1_5 Forward -243 -236 6.13563 0.241
NP_440747.1_10 Forward -290 -278 -12.2524 0.254
NP_441486.1_1 Reverse -232 -246 3.93283 0.0522
NP_441486.1_1 Forward -247 -233 2.75286 0.0765
NP_442634.1_4 Forward -377 -363 -4.91696 0.223
NP_441014.1_5 Forward -291 -273 10.2456 0.263
NP_441014.1_10 Reverse -294 -313 -1.37794 0.26
NP_443018.1_3 Forward -243 -236 11.7405 0.0655
NP_443018.1_3 Reverse -51 -58 7.6106 0.156
NP_443018.1_3 Forward -279 -272 7.11894 0.16
NP_443018.1_3 Reverse -236 -243 5.44732 0.193
NP_441634.1_8 Forward -282 -268 -0.688726 0.265
NP_440376.1_1 Reverse -235 -244 5.99792 0.111
NP_440376.1_1 Reverse -278 -287 4.42462 0.159
NP_440376.1_1 Forward -244 -235 -0.196935 0.285
NP_441588.1_4 Forward -242 -232 16.4996 0.0369
NP_442687.1_7 Reverse -234 -244 4.50326 0.245
NP_440066.1_5 Reverse -297 -316 6.09517 0.287
NP_442946.1_7 Reverse -35 -50 15.1181 0.284
NP_440642.1_10 Reverse -294 -308 7.07881 0.223
NP_441422.1_7 Reverse -359 -376 -6.15601 0.248
NP_441274.1_10 Forward -276 -257 12.7816 0.278
NP_442658.1_1 Reverse -233 -243 6.17443 0.235
NP_440141.1_8 Reverse -316 -335 3.93269 0.296
NP_441414.1_9 Forward -244 -225 -4.03212 0.145
NP_441414.1_9 Reverse -235 -254 -10.0303 0.275
NP_441256.1_8 Forward -139 -120 1.57275 0.294
NP_442321.1_4 Reverse -268 -287 -2.36049 0.27
NP_441958.1_5 Reverse -234 -244 0.865012 0.12
NP_442836.1_10 Reverse -236 -246 10.6981 0.269
NP_440203.1_5 Reverse -369 -379 11.7793 0.177
NP_443001.1_9 Forward -339 -325 20.6491 0.245
NP_442376.1_2 Forward -220 -201 -6.98204 0.286
NP_442690.1_1 Reverse -167 -186 -8.65367 0.189
NP_442690.1_1 Reverse -275 -294 -14.5535 0.273
NP_442911.1_2 Reverse -86 -105 -8.35868 0.233
NP_443055.1_6 Forward -252 -234 1.88669 0.224
NP_440827.1_3 Forward -70 -51 18.3873 0.101
NP_442002.1_9 Reverse -234 -241 10.7572 0.185
NP_441000.1_6 Forward -245 -231 4.22782 0.0964
NP_441000.1_6 Reverse -234 -248 -4.52363 0.245
NP_440147.1_4 Reverse -233 -246 0.314277 0.257
NP_441550.1_8 Reverse -233 -243 7.0594 0.178
NP_441331.1_10 Forward -296 -277 21.151 0.0919
NP_441041.1_4 Forward -286 -267 -4.91709 0.145
NP_441041.1_7 Reverse -232 -244 14.4144 0.0348
NP_441041.1_7 Forward -247 -235 6.64018 0.2
NP_441041.1_7 Reverse -275 -287 6.15429 0.221
NP_441725.1_5 Reverse -51 -61 5.78156 0.115
NP_439966.1_7 Forward -246 -236 9.616 0.106
NP_439966.1_9 Reverse -233 -242 0.884706 0.253
NP_440736.1_10 Forward -88 -70 12.4089 0.293
NP_440289.1_2 Forward -247 -234 -4.30728 0.286
NP_440289.1_2 Reverse -232 -245 -5.09393 0.297
NP_442281.1_1 Forward -249 -235 11.4053 0.0477
NP_442281.1_1 Forward -285 -271 3.93223 0.213
NP_442281.1_1 Reverse -356 -370 1.5723 0.296
NP_442281.1_1 Reverse -230 -244 1.5723 0.296
NP_442281.1_1 Reverse -45 -59 1.5723 0.296
NP_440177.1_1 Reverse -80 -98 3.95239 0.28
NP_441644.1_6 Forward -244 -234 7.15773 0.133
NP_441644.1_6 Reverse -79 -89 6.86274 0.144
NP_441644.1_6 Reverse -50 -60 4.89613 0.22
NP_441644.1_6 Forward -333 -323 4.20782 0.245
NP_441644.1_6 Forward -280 -270 3.22451 0.293
NP_443049.1_6 Reverse -234 -244 11.6409 0.24
NP_442215.1_2 Forward -289 -273 7.2367 0.0694
NP_442215.1_2 Reverse -364 -380 -7.31629 0.291
NP_442177.1_5 Forward -363 -349 15.8309 0.22
NP_442029.1_1 Forward -371 -352 -19.4701 0.29
NP_442029.1_6 Forward -147 -128 3.53937 0.282
NP_440253.1_2 Reverse -235 -253 3.3624 0.118
NP_440253.1_2 Forward -244 -226 -1.16082 0.234
NP_440929.1_8 Forward -244 -235 7.07956 0.0713
NP_442554.1_4 Forward -294 -275 6.19431 0.291
NP_442554.1_8 Forward -243 -233 3.42162 0.226
NP_442554.1_8 Forward -87 -77 2.33998 0.274
NP_441762.1_7 Reverse -234 -246 11.642 0.0142
NP_441762.1_7 Forward -245 -233 2.0056 0.0705
NP_442142.1_4 Forward -247 -234 9.26181 0.0998
NP_442142.1_4 Reverse -232 -245 2.28034 0.295
NP_442292.1_1 Forward -243 -234 -0.196935 0.239
NP_440775.1_8 Reverse -42 -59 15.2794 0.244
NP_442381.1_8 Reverse -232 -251 -12.9802 0.267
NP_443009.1_5 Reverse -331 -342 3.49977 0.292
NP_442301.1_2 Reverse -356 -375 6.48849 0.263
NP_440357.1_3 Reverse -233 -252 0.0977854 0.285
NP_440015.1_2 Reverse -238 -257 16.3224 0.268
NP_442076.1_5 Reverse -318 -337 7.7676 0.256
NP_440379.1_5 Forward -319 -300 -10.6203 0.281
NP_441468.1_1 Reverse -236 -243 6.13563 0.209
NP_441468.1_1 Forward -243 -236 6.0373 0.223
NP_441020.2_6 Reverse -233 -250 12.2319 0.0995
NP_441020.2_6 Forward -246 -229 6.92201 0.249
NP_441673.1_1 Reverse -235 -244 1.37636 0.114
NP_441673.1_1 Forward -244 -235 1.1797 0.163
NP_441826.1_5 Forward -64 -45 2.3594 0.276
NP_442808.1_1 Forward -245 -235 19.449 0.00201
NP_442808.1_1 Reverse -71 -81 3.71617 0.227
NP_441290.1_4 Reverse -78 -97 11.1109 0.117
NP_440038.1_8 Reverse -229 -248 17.3048 0.197
NP_441114.1_3 Forward -285 -276 7.37455 0.239
NP_441114.1_3 Reverse -45 -54 7.37455 0.239
NP_440558.1_2 Forward -91 -72 -3.14714 0.234
NP_440558.1_2 Reverse -357 -376 -5.99873 0.269
NP_440558.1_2 Reverse -87 -106 -7.17871 0.289
NP_440558.1_2 Forward -290 -271 -7.37537 0.293
NP_442789.1_4 Forward -377 -358 -1.27885 0.219
NP_442789.1_4 Forward -318 -299 -6.88371 0.289
NP_441878.1_6 Reverse -277 -287 -6.11649 0.191
NP_441878.1_6 Forward -376 -366 -7.98478 0.285
NP_441036.1_8 Reverse -234 -244 6.8632 0.213
NP_441036.1_8 Forward -245 -235 6.07655 0.242
NP_441557.1_5 Reverse -235 -244 1.08137 0.0794
NP_441557.1_5 Forward -244 -235 0.589713 0.134
NP_442183.1_1 Reverse -235 -249 6.48943 0.171
NP_442166.1_7 Forward -315 -301 8.45605 0.235
NP_442135.1_5 Forward -253 -235 17.5212 0.195
NP_442170.1_5 Reverse -235 -254 -1.27885 0.254
NP_442347.1_2 Forward -243 -234 8.94785 0.0718
NP_442347.1_2 Reverse -97 -106 4.0313 0.284
NP_442347.1_2 Reverse -39 -48 3.7363 0.284
NP_441633.1_3 Forward -246 -233 -6.47056 0.253
NP_441633.1_3 Forward -289 -276 -7.25721 0.3
NP_442764.1_3 Forward -376 -366 17.6796 0.295
NP_440136.1_2 Reverse -236 -243 6.23397 0.171
NP_440136.1_2 Forward -243 -236 6.13563 0.193
NP_442998.1_5 Forward -299 -289 13.0581 0.158
NP_442998.1_5 Forward -300 -290 12.8614 0.158
NP_442998.1_10 Forward -242 -235 15.5754 0.0102
NP_441799.1_1 Forward -248 -234 7.86545 0.13
NP_441799.1_1 Reverse -231 -245 5.60385 0.201
NP_442201.1_10 Forward -255 -236 -7.08038 0.191
NP_440256.1_1 Reverse -232 -251 -8.752 0.266
NP_441559.1_8 Reverse -149 -163 -4.91696 0.241
NP_440915.1_6 Forward -85 -71 -0.688726 0.205
NP_440306.1_8 Reverse -282 -301 0.392004 0.204
NP_440677.1_6 Forward -92 -73 7.37428 0.298
NP_442386.1_9 Forward -245 -236 13.8639 0.0289
NP_442386.1_9 Reverse -234 -243 5.9975 0.23
NP_441340.1_5 Reverse -236 -243 13.5105 0.0314
NP_441340.1_5 Forward -243 -236 5.84064 0.208
NP_440586.1_1 Forward -320 -301 -5.31042 0.285
NP_440586.1_8 Forward -243 -236 9.47853 0.146
NP_440586.1_8 Reverse -236 -243 5.74197 0.283
NP_441262.1_3 Reverse -235 -242 14.7888 0.0223
NP_440027.1_3 Reverse -201 -219 1.98502 0.295
NP_440027.1_8 Forward -344 -325 4.81688 0.285
NP_443051.1_1 Reverse -234 -243 7.47288 0.0571
NP_442294.1_3 Reverse -285 -299 14.0603 0.249
NP_440836.1_1 Reverse -346 -365 7.66927 0.222
NP_440408.1_7 Reverse -78 -97 12.1925 0.212
NP_440372.1_2 Reverse -236 -243 13.8055 0.0214
NP_440372.1_2 Forward -243 -236 6.52896 0.188
NP_442783.1_10 Forward -352 -342 16.8925 0.149
NP_441181.1_6 Forward -243 -225 2.87075 0.29
NP_440819.1_5 Forward -300 -292 7.68924 0.266
NP_440316.1_10 Reverse -234 -244 11.1898 0.214
NP_441572.1_7 Reverse -297 -316 -0.295539 0.179
NP_440267.1_2 Forward -177 -163 6.29216 0.236
NP_440267.1_2 Reverse -361 -375 5.50552 0.264
NP_442790.1_4 Reverse -226 -245 -14.7502 0.281
NP_442262.1_10 Forward -243 -236 13.2155 0.0213
NP_442262.1_10 Reverse -51 -58 8.8889 0.219
NP_442262.1_10 Forward -279 -272 8.20058 0.25
NP_442244.1_3 Forward -162 -143 3.14605 0.292
NP_440344.1_10 Forward -251 -234 6.13536 0.0188
NP_440344.1_10 Reverse -228 -245 -4.18939 0.093
NP_440344.1_10 Reverse -271 -288 -9.79426 0.156
NP_440282.1_3 Reverse -45 -64 0.196116 0.281
NP_441640.1_8 Reverse -45 -64 -1.47551 0.216
NP_440297.1_9 Reverse -51 -61 7.25653 0.136
NP_441679.1_1 Reverse -273 -292 -2.26216 0.212
NP_441543.1_2 Forward -243 -234 8.65285 0.0968
NP_441543.1_3 Forward -255 -241 6.29216 0.286
NP_441469.1_8 Reverse -234 -243 6.39124 0.227
NP_441469.1_8 Forward -245 -236 5.60459 0.258
NP_442578.1_7 Reverse -236 -243 6.0373 0.18
NP_440220.1_4 Reverse -283 -302 -2.65624 0.279
NP_441462.1_2 Reverse -235 -245 7.55152 0.0543
NP_443062.1_1 Forward -244 -226 5.32818 0.231
NP_443062.1_6 Reverse -270 -289 0.491109 0.294
NP_440519.1_8 Forward -375 -359 23.8546 0.0227
NP_441560.1_8 Reverse -302 -321 12.097 0.268
NP_440504.1_1 Forward -23 -4 11.3075 0.172
NP_440516.1_8 Reverse -235 -244 18.9776 0.00442
NP_440516.1_8 Forward -244 -235 5.01461 0.118
NP_441033.1_2 Forward -254 -235 4.62101 0.106
NP_442428.1_5 Reverse -236 -243 6.13563 0.209
NP_442428.1_5 Forward -243 -236 6.0373 0.212
NP_442859.1_2 Reverse -150 -169 4.81767 0.212
NP_441867.1_2 Forward -97 -78 -20.3551 0.291
NP_440673.1_3 Forward -242 -235 12.4288 0.0426
NP_440673.1_7 Forward -135 -116 1.17943 0.253
NP_441052.1_2 Forward -244 -234 1.25834 0.249
NP_440592.1_8 Reverse -196 -215 10.6192 0.283
NP_440436.1_4 Forward -243 -234 8.55409 0.0997
NP_441884.1_8 Reverse -234 -253 -8.55534 0.262
NP_441719.1_4 Reverse -236 -243 6.82395 0.0855
NP_441719.1_4 Forward -243 -236 6.52896 0.188
NP_441733.1_10 Reverse -232 -245 10.8357 0.106
NP_441004.1_1 Forward -316 -297 -9.24366 0.206
NP_441004.1_1 Forward -381 -362 -14.3569 0.267
NP_442366.1_3 Reverse -234 -252 5.23069 0.0885
NP_442366.1_3 Forward -245 -227 0.609134 0.167
NP_442366.1_5 Reverse -232 -242 12.7626 0.108
NP_440129.1_10 Reverse -228 -242 3.93283 0.187
NP_440296.1_10 Forward -378 -359 -13.4719 0.269
NP_442206.1_10 Forward -375 -360 2.5365 0.201
NP_442206.1_10 Forward -244 -229 1.06154 0.238
NP_440094.1_9 Forward -288 -269 -4.52377 0.262
NP_443054.1_2 Forward -289 -275 13.6676 0.0722
NP_443054.1_2 Reverse -330 -344 6.6861 0.185
NP_443054.1_2 Forward -246 -232 0.687908 0.256
NP_443054.1_2 Forward -342 -328 0.491246 0.262
NP_440864.1_9 Forward -392 -373 4.32602 0.119
NP_441851.1_10 Forward -376 -366 5.19158 0.221
NP_442515.1_1 Reverse -277 -291 -1.18038 0.248
NP_440593.1_3 Reverse -74 -93 -4.32711 0.246
NP_441046.1_2 Forward -324 -305 -0.0988766 0.276
NP_441046.1_2 Forward -298 -279 -2.36049 0.299
NP_441349.1_10 Forward -254 -235 -9.24366 0.287
NP_441124.1_5 Reverse -284 -294 12.7217 0.215
NP_440588.1_2 Reverse -226 -245 -1.37718 0.155
NP_442006.1_2 Forward -313 -296 -13.1375 0.197
NP_441570.1_1 Forward -105 -87 -9.12563 0.129
NP_441570.1_1 Reverse -235 -253 -17.6804 0.287
NP_441078.1_4 Reverse -235 -244 0.196389 0.205
NP_441078.1_4 Forward -244 -235 -0.000272808 0.205
NP_442348.1_2 Reverse -277 -286 13.1761 0.206
NP_442348.1_2 Reverse -242 -251 7.37455 0.28
NP_440707.1_9 Forward -381 -362 -0.000545616 0.293
NP_442443.1_1 Forward -318 -299 -5.9004 0.287
NP_441432.1_8 Reverse -234 -243 5.50626 0.151
NP_441432.1_8 Forward -341 -332 2.55633 0.298
NP_442344.1_7 Forward -243 -224 -8.35868 0.211
NP_440313.1_5 Forward -349 -331 15.7513 0.214
NP_442274.1_3 Reverse -330 -349 9.83255 0.297
NP_441945.1_10 Forward -317 -298 9.73422 0.258
NP_442751.1_2 Forward -218 -199 2.35861 0.292
NP_442489.1_2 Reverse -224 -243 5.60432 0.192
NP_442489.1_7 Forward -244 -235 0.688044 0.152
NP_442489.1_7 Reverse -235 -244 0.688044 0.152
NP_442489.1_7 Forward -287 -278 -1.57357 0.213
NP_442489.1_7 Reverse -278 -287 -1.6719 0.235
NP_442913.1_9 Reverse -229 -248 6.78429 0.294
NP_442776.1_1 Forward -286 -267 6.4893 0.226
NP_440352.1_5 Forward -310 -291 13.8238 0.176
NP_440459.1_2 Reverse -70 -87 8.20031 0.267
NP_440459.1_2 Forward -289 -272 8.10198 0.27
NP_440847.1_5 Forward -350 -331 13.7658 0.281
NP_440847.1_8 Reverse -290 -309 14.9458 0.272
NP_441047.1_2 Forward -315 -296 5.30933 0.211
NP_441358.1_2 Forward -316 -297 22.6156 0.0487
NP_441358.1_6 Forward -99 -80 22.4189 0.0358
NP_441502.1_3 Forward -289 -270 5.40766 0.289
NP_441833.1_4 Forward -243 -236 6.52896 0.0924
NP_441833.1_4 Reverse -236 -243 6.23397 0.163
NP_442162.1_9 Forward -243 -236 12.9205 0.0282
NP_442162.1_9 Reverse -236 -243 12.9205 0.0282
NP_440671.1_1 Reverse -164 -183 8.81077 0.204
NP_442140.1_3 Forward -243 -233 14.1397 0.0501
NP_442140.1_3 Reverse -236 -246 8.73149 0.119
NP_442723.1_1 Reverse -290 -309 5.89851 0.276
NP_440875.1_9 Forward -242 -232 8.46937 0.233
NP_441813.1_5 Forward -246 -236 6.76487 0.0792
NP_441813.1_5 Reverse -233 -243 0.176696 0.215
NP_442089.1_1 Reverse -232 -251 9.3409 0.102
NP_440567.1_1 Forward -243 -229 2.45787 0.174
NP_442497.1_10 Forward -243 -234 0.589713 0.153
NP_440821.1_4 Reverse -233 -243 0.471689 0.174
NP_441239.1_9 Forward -246 -234 13.3137 0.037
NP_441541.1_1 Reverse -165 -183 -1.23941 0.237
NP_440354.1_7 Reverse -318 -336 7.68896 0.26
NP_440546.1_4 Reverse -235 -245 14.0213 0.0459
NP_440546.1_4 Forward -382 -372 6.94336 0.269
NP_440546.1_4 Forward -244 -234 6.55553 0.291
NP_440462.1_6 Forward -246 -236 5.09324 0.168
NP_440868.1_4 Reverse -231 -243 8.20045 0.0602
NP_440868.1_4 Forward -248 -236 0.432302 0.212
NP_440402.1_3 Forward -295 -276 5.89931 0.276
NP_442402.1_1 Reverse -283 -302 8.25926 0.278
NP_442402.1_4 Reverse -283 -302 -1.96793 0.195
NP_442402.1_4 Reverse -358 -377 -3.04956 0.211
NP_441848.1_4 Reverse -169 -185 10.9884 0.238
NP_441848.1_4 Forward -294 -278 8.79206 0.288
NP_441848.1_7 Reverse -286 -305 6.39016 0.196
NP_440653.1_10 Forward -286 -267 15.1424 0.103
NP_442882.1_7 Reverse -228 -242 18.7801 0.24
NP_442039.1_4 Reverse -236 -243 11.6422 0.0747
NP_442679.1_1 Forward -314 -295 -5.70374 0.296
NP_442837.1_3 Forward -243 -236 6.0373 0.25
NP_442837.1_3 Reverse -236 -243 6.0373 0.25
NP_442053.1_1 Forward -244 -235 14.4544 0.0114
NP_442053.1_1 Reverse -235 -244 7.86621 0.0863
NP_440505.1_3 Reverse -233 -243 5.19158 0.241
NP_442360.1_5 Forward -381 -371 15.8113 0.172
NP_440914.1_1 Forward -375 -365 6.85846 0.263
NP_441011.1_8 Reverse -236 -245 11.7994 0.0629
NP_441011.1_8 Forward -243 -234 7.07956 0.179
NP_442533.1_6 Forward -244 -235 4.42462 0.179
NP_442533.1_6 Reverse -79 -88 1.57302 0.294
NP_440263.1_5 Reverse -281 -295 8.25939 0.294
NP_442232.1_3 Forward -378 -359 -7.08038 0.194
NP_442232.1_3 Forward -210 -191 -13.8652 0.283
NP_442229.1_1 Forward -246 -232 11.307 0.18
NP_442229.1_1 Forward -253 -239 6.88214 0.202
NP_441028.1_6 Reverse -293 -303 7.94438 0.217
NP_441028.1_6 Reverse -292 -302 5.38779 0.255
NP_440007.1_9 Forward -97 -83 0.982901 0.29
NP_440007.1_9 Forward -85 -71 0.491246 0.297
NP_442492.1_2 Reverse -235 -254 2.0644 0.224
NP_442673.1_5 Reverse -264 -282 12.1139 0.272
NP_441972.1_5 Forward -286 -267 -9.93197 0.294
NP_441106.1_1 Reverse -234 -243 8.45619 0.0548
NP_440429.1_2 Reverse -296 -315 15.1424 0.176
NP_440670.1_8 Reverse -235 -244 8.75118 0.0606
NP_440670.1_8 Forward -244 -235 6.19458 0.124
NP_440886.1_7 Forward -245 -235 16.4991 0.0104
NP_440886.1_7 Reverse -234 -244 6.86274 0.113
NP_442022.1_4 Forward -394 -375 12.1925 0.189
NP_440907.2_8 Forward -243 -233 12.4676 0.0624
NP_441021.1_8 Reverse -230 -248 1.88744 0.256
NP_441021.1_8 Forward -249 -231 1.69077 0.259
NP_441463.1_3 Forward -254 -235 -8.45701 0.27
NP_441463.1_3 Reverse -4 -23 -10.6203 0.299
NP_441626.1_2 Reverse -236 -243 12.2322 0.0511
NP_441626.1_2 Forward -243 -236 5.93897 0.231
NP_442365.1_5 Reverse -236 -255 9.53756 0.204
NP_442615.1_1 Reverse -226 -244 2.96908 0.0595
NP_441962.1_4 Reverse -302 -321 -12.0953 0.252
NP_441962.1_9 Forward -99 -80 6.29264 0.258
NP_441431.1_2 Forward -247 -233 11.7003 0.135
NP_441431.1_2 Reverse -232 -246 11.1104 0.146
NP_441836.1_1 Reverse -224 -243 16.3693 0.12
NP_439938.1_10 Forward -318 -299 17.404 0.255
NP_440114.1_10 Reverse -235 -249 12.586 0.0783
NP_440114.1_10 Forward -244 -230 9.93102 0.159
NP_440114.1_10 Forward -341 -327 6.19444 0.282
NP_442323.1_7 Reverse -45 -64 9.83173 0.156
NP_441510.2_7 Reverse -229 -243 13.372 0.28
NP_440766.1_4 Reverse -231 -245 3.63784 0.144
NP_440766.1_5 Forward -302 -290 9.27915 0.275
NP_439988.1_7 Reverse -363 -377 12.5853 0.292
NP_440457.1_1 Forward -63 -51 3.97222 0.177
NP_440798.1_6 Reverse -229 -242 0.314277 0.274
NP_441801.1_4 Forward -160 -150 11.0914 0.231
NP_440054.1_4 Forward -252 -233 12.9791 0.158
NP_442509.1_9 Reverse -235 -245 11.9759 0.107
NP_442509.1_9 Forward -244 -234 9.71433 0.192
NP_441496.1_1 Reverse -284 -298 14.5264 0.265
NP_442514.1_5 Reverse -295 -314 -8.45774 0.285
NP_440554.1_4 Forward -243 -233 4.40493 0.19
NP_440554.1_4 Forward -141 -131 1.74999 0.29
NP_441325.1_3 Forward -377 -358 8.75091 0.3
NP_441885.1_5 Reverse -235 -245 0.0783647 0.183
NP_442341.1_7 Forward -245 -231 6.19444 0.134
NP_442341.1_9 Reverse -233 -247 8.45543 0.17
NP_441756.1_5 Forward -87 -68 -4.13045 0.292
NP_440423.1_6 Reverse -227 -246 -21.4367 0.294
NP_443000.1_7 Forward -107 -97 2.14332 0.226
NP_441842.1_10 Reverse -228 -242 16.6175 0.0301
NP_440275.1_3 Reverse -233 -243 5.78156 0.131
NP_439962.1_4 Reverse -296 -315 -5.9004 0.28
NP_442495.1_4 Reverse -270 -280 13.0581 0.198
NP_441875.1_3 Forward -170 -151 16.1249 0.252
NP_441105.1_3 Reverse -39 -58 -8.45701 0.272
NP_441105.1_3 Forward -292 -273 -8.94866 0.281
NP_442373.1_2 Forward -319 -300 -11.5053 0.297
NP_441718.1_4 Reverse -320 -339 17.9932 0.0973
NP_441226.1_7 Reverse -236 -243 12.7234 0.0312
NP_441226.1_7 Forward -243 -236 11.5435 0.0757
NP_441111.1_7 Forward -243 -235 8.86921 0.0589
NP_441766.1_2 Forward -244 -235 14.7494 0.00772
NP_440416.1_9 Reverse -296 -315 -14.9469 0.182
NP_440416.1_9 Reverse -359 -378 -16.0285 0.206
NP_442154.1_1 Forward -54 -36 -16.7954 0.245
NP_442154.1_1 Forward -390 -372 -17.3854 0.254
NP_440261.1_5 Reverse -367 -380 -11.2888 0.255
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACCGGGGCCTGTATTGTAGCTCTGGGGGATGACATTGGTGGCTTATGGAGTCCCAATCAGGAATTGGCCGATGAACTCAAAGTGGCGGCCGATAAGGCGGGGGAAAAATTCTGGCAAATGCCCATGGAATCCAAATATTTTGAAGGTCTCAAATCCCCGATCGCCGATATGAAAAATACGGGGCCCCGTTCCGGTGGTTCCATTACAGCGGCGTTATTTTTACAACAATTCATCAAGGAAACTCCCTGGGCCCATTTAGACATTGCAGGGCCTGTGTGGACTGATAAGCAAAATGGAGTTCACAATGCTGGTGCCACGGGCTATCCAGTACGGACCCTAGTGCAATGGGTATTGGGATTAGCGGAATAGTCCCTCAGTGGTTCATGTTATTGATGAACA

CDS

ATGAAATGCCAATCAGTCCTGCAATTGCTAAGTCAAAGTAAACCAGATTTACAATCTCGTTTTGGTGTTACCCAGTTAGCACTGTTTGGTTCCACCGCAAGGGATGAAGCTGGTCCCCATAGTGATGTAGATATTCTCGTCAGCTTCGATGGACCTGCCACATCCCACCGGTATTTCGGAGTGCAGTTTTATCTAGAAGACTTGTTAGGTTGTGCCGTGGACCTAGCAACAGAAAAGGCCCTCAGACCAGAATTACGCTCCCAGATCGAACAGGAAAAAATAGATGTCTAA

Protein

MKCQSVLQLLSQSKPDLQSRFGVTQLALFGSTARDEAGPHSDVDILVSFDGPATSHRYFGVQFYLEDLLGCAVDLATEKALRPELRSQIEQEKIDV