Your browser is old and dusty. Try Google Chrome!

Details for ssl2733

ORF ssl2733
Accession NP_439936.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -357 -371 -2.26202 0.287
NP_442100.1_4 Forward -225 -206 9.53674 0.281
NP_441453.1_7 Reverse -192 -199 12.1338 0.295
NP_441818.1_9 Reverse -44 -63 -9.53865 0.291
NP_441818.1_9 Reverse -36 -55 -10.817 0.299
NP_442744.1_9 Reverse -96 -110 15.3562 0.266
NP_443002.1_5 Reverse -357 -375 16.2429 0.192
NP_442752.1_4 Reverse -55 -62 7.6106 0.151
NP_441812.1_1 Reverse -72 -86 18.5835 0.161
NP_440061.1_9 Reverse -225 -239 9.04542 0.154
NP_440110.1_8 Reverse -322 -341 -2.36049 0.266
NP_442062.1_8 Reverse -338 -348 3.42162 0.272
NP_441802.1_1 Reverse -195 -214 15.8307 0.174
NP_440304.1_4 Forward -335 -325 4.0116 0.281
NP_441208.1_1 Forward -335 -316 6.19431 0.176
NP_441594.1_6 Forward -202 -183 2.26107 0.254
NP_442110.1_7 Forward -371 -357 1.47456 0.226
NP_441925.1_4 Forward -63 -44 -5.1145 0.177
NP_441925.1_4 Forward -66 -47 -15.5375 0.266
NP_441083.1_5 Forward -111 -101 5.68323 0.11
NP_441083.1_5 Forward -178 -168 0.668351 0.22
NP_442245.1_9 Forward -271 -252 18.1907 0.25
NP_441738.1_2 Reverse -359 -366 6.52862 0.261
NP_441624.1_7 Forward -171 -157 8.35772 0.24
NP_440343.1_3 Reverse -358 -376 23.5194 0.0176
NP_440343.1_9 Forward -375 -356 12.5858 0.184
NP_440944.1_2 Forward -275 -256 -2.36049 0.272
NP_440842.1_10 Forward -336 -322 2.2612 0.277
NP_443018.1_3 Reverse -255 -262 7.6106 0.156
NP_440376.1_1 Forward -366 -357 -0.000272808 0.285
NP_442730.1_8 Reverse -252 -271 12.7816 0.15
NP_441077.1_6 Reverse -150 -166 9.93598 0.164
NP_441077.1_6 Forward -31 -15 2.12702 0.289
NP_441077.1_6 Forward -253 -237 1.74139 0.298
NP_441950.1_8 Reverse -186 -200 5.89945 0.27
NP_440141.1_8 Forward -342 -323 6.88262 0.252
NP_440617.1_3 Forward -79 -60 12.3892 0.0814
NP_442782.1_2 Reverse -157 -171 5.89945 0.234
NP_442782.1_2 Reverse -357 -371 0.589577 0.288
NP_442937.1_5 Reverse -97 -116 7.96426 0.237
NP_441958.1_5 Forward -112 -102 -0.511621 0.208
NP_440318.1_1 Reverse -350 -369 5.60432 0.218
NP_442690.1_1 Reverse -241 -260 -8.752 0.189
NP_442690.1_1 Reverse -140 -159 -10.817 0.22
NP_440153.1_8 Reverse -324 -337 5.13249 0.18
NP_443055.1_3 Reverse -93 -112 11.2181 0.266
NP_443055.1_6 Forward -179 -161 -0.473239 0.261
NP_441752.1_6 Forward -106 -87 5.01433 0.211
NP_440377.1_1 Forward -21 -4 13.1097 0.249
NP_441295.1_6 Reverse -211 -230 12.3892 0.244
NP_441916.1_10 Forward -119 -100 2.0644 0.253
NP_441041.1_4 Forward -377 -358 -9.44032 0.216
NP_440569.1_10 Reverse -3 -22 4.63094 0.25
NP_439966.1_7 Reverse -355 -365 7.94438 0.145
NP_439966.1_9 Forward -368 -359 5.3096 0.253
NP_440736.1_3 Reverse -160 -179 -1.7705 0.294
NP_440983.1_5 Forward -64 -45 -8.752 0.295
NP_440983.1_9 Forward -346 -327 4.52268 0.285
NP_441644.1_6 Reverse -254 -264 9.02601 0.0872
NP_441644.1_6 Reverse -102 -112 4.7978 0.224
NP_442142.1_4 Forward -56 -43 5.32859 0.194
NP_443009.1_5 Reverse -356 -367 5.26972 0.21
NP_440015.1_9 Reverse -116 -134 0.707465 0.248
NP_441426.1_7 Reverse -47 -64 18.6234 0.222
NP_441826.1_5 Reverse -363 -382 2.65439 0.276
NP_441393.1_2 Reverse -187 -206 13.2581 0.272
NP_441764.1_8 Reverse -200 -210 11.1193 0.287
NP_442868.1_6 Reverse -355 -365 3.22496 0.202
NP_442719.1_2 Reverse -162 -180 -10.3063 0.272
NP_442719.1_2 Reverse -86 -104 -11.9779 0.299
NP_441251.1_8 Forward -262 -249 11.8073 0.267
NP_442361.1_3 Forward -117 -104 11.3273 0.262
NP_442427.1_8 Reverse -245 -264 7.86593 0.203
NP_442113.1_10 Forward -60 -41 -8.45701 0.282
NP_442050.1_1 Forward -334 -315 13.6675 0.187
NP_442050.1_5 Reverse -355 -365 6.76441 0.282
NP_440346.1_6 Forward -117 -107 14.9247 0.231
NP_441114.1_3 Forward -89 -80 7.66954 0.231
NP_440558.1_2 Reverse -353 -372 3.04771 0.162
NP_441048.1_4 Forward -90 -71 15.4374 0.183
NP_441878.1_6 Forward -334 -324 -6.90313 0.198
NP_441036.1_8 Forward -112 -102 11.3864 0.123
NP_441036.1_8 Forward -367 -357 5.5849 0.271
NP_442066.2_9 Reverse -353 -366 6.31247 0.297
NP_441433.1_8 Reverse -82 -101 -3.24547 0.276
NP_441308.1_8 Forward -113 -103 8.63316 0.254
NP_441870.1_7 Reverse -179 -198 16.4207 0.291
NP_441037.1_4 Forward -335 -325 6.14821 0.278
NP_441633.1_3 Reverse -322 -335 -5.97891 0.236
NP_441799.1_4 Forward -64 -45 -5.31042 0.219
NP_441512.1_10 Reverse -51 -70 13.0775 0.258
NP_441559.1_8 Forward -370 -356 0.786239 0.161
NP_441559.1_8 Reverse -70 -84 -7.47356 0.294
NP_440915.1_6 Reverse -51 -65 6.88276 0.0779
NP_440915.1_6 Forward -370 -356 -1.27871 0.229
NP_440717.1_3 Forward -61 -47 12.6836 0.227
NP_441866.1_6 Forward -98 -79 11.7 0.191
NP_441866.1_6 Reverse -354 -373 11.3067 0.198
NP_440749.1_1 Forward -377 -358 1.86774 0.257
NP_441464.1_8 Reverse -324 -338 4.32615 0.277
NP_441464.1_10 Reverse -45 -59 13.7659 0.199
NP_442386.1_9 Forward -172 -163 9.34074 0.166
NP_441340.1_9 Forward -254 -244 16.0642 0.194
NP_443028.1_4 Forward -32 -13 7.8665 0.293
NP_440327.1_6 Forward -274 -255 3.53937 0.284
NP_442240.1_1 Reverse -264 -283 6.1935 0.258
NP_442240.1_6 Reverse -338 -357 16.7157 0.221
NP_440586.1_8 Reverse -63 -70 5.93863 0.283
NP_440684.1_9 Reverse -96 -110 9.83269 0.216
NP_440684.1_9 Reverse -171 -185 8.06273 0.24
NP_439937.1_9 Forward -65 -48 -9.30325 0.184
NP_440836.1_3 Reverse -45 -64 17.109 0.137
NP_440316.1_10 Reverse -190 -200 6.37155 0.263
NP_442384.1_10 Reverse -55 -68 3.75586 0.179
NP_441877.1_5 Forward -104 -85 5.99764 0.195
NP_442572.1_6 Reverse -357 -376 12.2908 0.229
NP_440530.1_6 Reverse -14 -28 18.3446 0.129
NP_442790.1_4 Reverse -266 -285 -10.9153 0.219
NP_442262.1_10 Reverse -255 -262 8.8889 0.219
NP_441814.1_1 Forward -58 -39 5.99764 0.177
NP_440344.1_10 Forward -289 -272 -3.00942 0.0772
NP_441640.1_8 Forward -382 -363 0.687771 0.187
NP_441640.1_8 Reverse -363 -382 -3.24547 0.253
NP_440297.1_8 Forward -335 -317 10.0489 0.295
NP_442280.1_10 Forward -312 -294 5.45442 0.284
NP_440894.1_10 Reverse -179 -198 8.94757 0.168
NP_440888.1_2 Reverse -254 -268 13.7653 0.0246
NP_440888.1_2 Forward -223 -209 5.01387 0.298
NP_440822.1_8 Reverse -76 -95 8.25926 0.258
NP_442033.1_8 Reverse -322 -340 17.4237 0.229
NP_442710.1_7 Forward -32 -13 -5.68499 0.294
NP_442637.1_1 Forward -344 -325 -9.34199 0.228
NP_440148.1_1 Forward -22 -3 -5.31042 0.231
NP_440519.1_6 Reverse -249 -263 19.2725 0.0983
NP_440519.1_6 Forward -205 -191 10.3243 0.29
NP_442204.1_1 Forward -115 -104 7.04017 0.144
NP_440504.1_7 Reverse -221 -240 3.34271 0.216
NP_440516.1_8 Reverse -102 -111 3.7363 0.127
NP_441443.1_7 Forward -331 -312 -0.4922 0.245
NP_440673.1_3 Reverse -256 -263 8.98723 0.203
NP_440314.1_9 Forward -110 -91 -7.67036 0.241
NP_441669.1_2 Reverse -6 -20 15.9285 0.279
NP_441086.1_3 Forward -264 -245 5.17542 0.29
NP_441004.1_1 Forward -333 -314 -16.9135 0.287
NP_441004.1_1 Reverse -35 -54 -18.2901 0.299
NP_441004.1_4 Reverse -113 -123 8.82982 0.263
NP_442813.1_2 Reverse -237 -256 -0.197208 0.273
NP_441396.1_5 Reverse -45 -54 7.27622 0.29
NP_440593.1_9 Reverse -321 -335 7.86607 0.267
NP_442689.1_8 Reverse -245 -262 -6.25434 0.28
NP_442689.1_8 Reverse -144 -161 -7.63097 0.292
NP_441394.1_2 Reverse -79 -98 16.3224 0.251
NP_440389.1_3 Reverse -315 -334 21.0423 0.0735
NP_441124.1_5 Reverse -91 -101 11.7668 0.245
NP_440023.1_2 Reverse -90 -109 6.78429 0.245
NP_440943.1_5 Reverse -79 -93 14.1593 0.22
NP_442443.1_1 Forward -373 -354 4.62101 0.157
NP_441432.1_8 Forward -264 -255 12.2911 0.0444
NP_441432.1_8 Forward -366 -357 2.55633 0.298
NP_441732.1_2 Forward -115 -99 -8.20127 0.124
NP_441732.1_2 Reverse -358 -374 -17.4444 0.258
NP_441732.1_7 Reverse -340 -359 14.0608 0.27
NP_442797.1_7 Forward -367 -349 1.78911 0.25
NP_441659.2_8 Reverse -102 -112 4.60159 0.13
NP_441659.2_8 Reverse -254 -264 0.865012 0.256
NP_441022.1_1 Forward -150 -141 11.834 0.273
NP_441040.1_2 Forward -207 -188 -14.8485 0.286
NP_440335.1_9 Forward -34 -16 12.0155 0.273
NP_442346.1_5 Reverse -115 -125 6.17489 0.212
NP_440545.1_3 Reverse -320 -337 -5.46769 0.25
NP_440025.1_3 Reverse -112 -126 10.0299 0.29
NP_441629.1_3 Forward -63 -44 15.3382 0.0672
NP_440459.1_2 Forward -311 -294 7.512 0.288
NP_441653.1_2 Reverse -63 -82 4.20605 0.26
NP_441948.1_4 Reverse -265 -283 -5.68405 0.275
NP_440671.1_5 Forward -61 -47 15.1419 0.236
NP_442199.1_7 Forward -99 -80 13.175 0.11
NP_441609.1_1 Reverse -96 -115 1.47442 0.196
NP_440875.1_9 Reverse -359 -369 6.91198 0.294
NP_440590.1_4 Forward -365 -352 -1.75067 0.228
NP_441727.1_3 Reverse -247 -266 2.94938 0.296
NP_440863.1_1 Reverse -197 -211 16.1291 0.203
NP_441617.1_6 Reverse -95 -114 -2.95047 0.262
NP_440546.1_6 Forward -376 -357 6.88262 0.283
NP_442349.1_6 Forward -68 -49 -3.14714 0.281
NP_442611.1_1 Reverse -357 -376 4.12936 0.197
NP_442611.1_1 Reverse -102 -121 -1.37718 0.281
NP_440705.1_4 Forward -374 -355 9.53756 0.296
NP_442499.1_1 Forward -303 -284 1.96607 0.298
NP_442402.1_10 Reverse -223 -233 12.3692 0.212
NP_441848.1_4 Forward -111 -95 7.07321 0.297
NP_440696.1_9 Reverse -359 -378 17.8948 0.296
NP_442039.1_7 Reverse -303 -313 7.25653 0.277
NP_442829.1_2 Forward -31 -15 8.81753 0.287
NP_441701.1_3 Forward -375 -358 8.29864 0.247
NP_442844.1_2 Forward -30 -15 19.3463 0.229
NP_442533.1_6 Reverse -357 -366 2.94966 0.232
NP_442533.1_6 Forward -64 -55 2.26134 0.266
NP_442322.1_4 Reverse -354 -371 -4.87838 0.264
NP_442322.1_9 Forward -229 -211 12.0147 0.251
NP_441028.1_6 Reverse -175 -185 10.4026 0.203
NP_441028.1_6 Reverse -249 -259 5.19112 0.265
NP_440116.1_5 Reverse -99 -116 4.56207 0.192
NP_441527.1_4 Forward -41 -22 -6.8281 0.226
NP_441527.1_4 Forward -262 -243 -10.7433 0.274
NP_441527.1_4 Forward -33 -14 -11.2207 0.278
NP_441527.1_4 Reverse -375 -394 -12.9396 0.296
NP_441961.1_4 Forward -374 -355 7.57094 0.269
NP_441602.1_3 Reverse -352 -371 -2.75381 0.238
NP_441972.1_5 Forward -376 -357 -6.88371 0.238
NP_441286.1_1 Reverse -323 -335 -5.86088 0.229
NP_440670.1_8 Forward -111 -102 6.48957 0.118
NP_440670.1_8 Reverse -102 -111 3.63797 0.239
NP_440886.1_7 Forward -57 -47 4.89613 0.213
NP_442072.1_9 Reverse -168 -186 -22.597 0.246
NP_441753.1_10 Forward -286 -267 9.63589 0.17
NP_440028.1_6 Forward -382 -364 13.0972 0.24
NP_440841.1_4 Forward -265 -246 11.9958 0.0542
NP_442842.1_4 Forward -376 -357 4.03102 0.254
NP_442365.1_7 Reverse -250 -269 -3.54046 0.221
NP_442805.1_5 Reverse -358 -377 -6.78612 0.297
NP_440457.1_1 Forward -337 -325 3.38223 0.196
NP_440457.1_1 Forward -267 -255 -0.452677 0.263
NP_441981.1_8 Forward -114 -100 14.7492 0.261
NP_440801.1_8 Forward -187 -168 0.491109 0.253
NP_442297.1_3 Forward -62 -43 17.8948 0.0666
NP_441332.1_6 Reverse -326 -336 10.9691 0.278
NP_441436.1_8 Forward -335 -316 8.16093 0.283
NP_443037.1_7 Reverse -90 -109 -4.42544 0.276
NP_442862.1_3 Reverse -85 -102 12.8219 0.181
NP_441885.1_5 Forward -111 -101 -0.806614 0.228
NP_441885.1_5 Forward -263 -253 -1.49493 0.264
NP_442703.1_1 Forward -36 -17 6.44528 0.266
NP_442341.1_7 Forward -65 -51 3.63784 0.217
NP_441173.1_9 Reverse -353 -361 12.1137 0.21
NP_441173.1_9 Forward -155 -147 11.8187 0.222
NP_441173.1_9 Reverse -250 -258 11.7204 0.226
NP_442395.2_4 Forward -117 -98 0.195343 0.276
NP_443000.1_8 Forward -199 -180 12.8808 0.296
NP_441397.1_8 Forward -256 -243 16.6774 0.142
NP_441902.1_3 Reverse -196 -206 14.9252 0.205
NP_442495.1_5 Forward -241 -222 5.70265 0.291
NP_440804.1_4 Forward -22 -13 16.716 0.145
NP_440216.1_6 Reverse -226 -242 6.74504 0.189
NP_440172.1_1 Reverse -102 -112 2.92996 0.258
NP_441718.1_4 Forward -95 -76 11.405 0.299
NP_440244.1_1 Reverse -199 -218 -7.17871 0.287
NP_442417.1_5 Reverse -368 -382 5.89945 0.244
NP_440416.1_9 Reverse -253 -272 -19.7651 0.278
NP_443052.1_9 Reverse -358 -377 -5.11376 0.265
NP_442116.1_6 Reverse -15 -32 6.92756 0.271
NP_440988.1_10 Forward -335 -321 3.64026 0.285
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATTATTTTGGTTTGTACCCATTTCGGTGGCGCAGGGATTGGCAGAACACTTTTCAAACCCTGTGGGGCGGCGGCAAAGTACGGGTGGCTCCCATTTTGCAAGAGCTAATTCTCAACCGGGAACCGGAAGCCGTATGGCAATGGGTAGAAAAAATTACTAGCTGGCCGGTGGAAACCCTCATTCCCTGTCACTTTTCTGCCCCAGTGGCTACCAATGGAGAGCAAATCCGCCAAGCCTTTAGCTTTTTACAAAAGTCTTTCTCTGACAATGAAGAGTCATTACCCCAAGAAGATCGGCAAATTCTGCAACGCATTGACCAATTCCTGGTACGTTGGCGCATCACCCCACCACCGACTAGTAAACGTGAATAAACTATAAAAAATTAGCGAGGATTTACA

CDS

ATGAACTACAGAAACTACATTACGATTGAACCCAATAAACGAGGAGGTAAACCTTGTGTGCGCGGTTTACGTATCACTGTTTATGAAGTACTCGAATATTTAGCGTCTGAGATGACTGAGGCGGAAATTCTCGAAGATTTTCCAGATTTAACTAAAGAAGATTTGAAGGCTTGTATTGCTTATGCAGCCGACCGTGAACGTCGATTGATGATTTCTCCCCTGTCTGCATGA

Protein

MNYRNYITIEPNKRGGKPCVRGLRITVYEVLEYLASEMTEAEILEDFPDLTKEDLKACIAYAADRERRLMISPLSA