Your browser is old and dusty. Try Google Chrome!

Details for ssl2717

ORF ssl2717
Accession NP_441553.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -157 -143 -0.0987402 0.221
NP_440557.1_1 Forward -41 -22 11.5042 0.101
NP_440557.1_1 Forward -366 -347 -2.0655 0.282
NP_440795.1_7 Reverse -118 -125 7.31561 0.259
NP_441418.1_6 Reverse -143 -162 -28.1232 0.203
NP_441418.1_6 Reverse -149 -168 -28.8115 0.211
NP_441453.1_4 Forward -42 -34 3.756 0.288
NP_441960.1_4 Reverse -212 -228 19.9206 0.135
NP_442151.1_6 Reverse -143 -157 10.3243 0.125
NP_442151.1_6 Reverse -185 -199 8.65272 0.167
NP_441818.1_9 Reverse -277 -296 0.294447 0.191
NP_441818.1_9 Reverse -143 -162 -2.45882 0.203
NP_441818.1_9 Reverse -150 -169 -9.34199 0.29
NP_442752.1_4 Forward -194 -187 4.26735 0.293
NP_442909.1_7 Forward -193 -179 5.89884 0.264
NP_441250.1_3 Reverse -301 -320 6.39097 0.228
NP_440061.1_9 Forward -169 -155 12.3887 0.0971
NP_440061.1_9 Forward -196 -182 9.43874 0.145
NP_440110.1_8 Reverse -141 -160 8.65258 0.0906
NP_439979.1_2 Reverse -140 -159 6.29264 0.292
NP_442062.1_8 Forward -42 -32 6.56821 0.123
NP_442062.1_8 Reverse -158 -168 5.09324 0.184
NP_442062.1_8 Forward -97 -87 4.69992 0.201
NP_442062.1_8 Reverse -185 -195 4.3066 0.221
NP_442062.1_8 Reverse -26 -36 3.91327 0.243
NP_440304.1_4 Reverse -319 -329 5.68323 0.196
NP_441581.1_6 Forward -173 -154 9.09856 0.297
NP_440916.1_1 Reverse -197 -211 13.5693 0.206
NP_440893.1_3 Forward -178 -159 -0.591301 0.281
NP_441208.1_9 Reverse -155 -169 5.89945 0.259
NP_441594.1_6 Reverse -276 -295 5.40766 0.209
NP_441925.1_4 Forward -170 -151 -5.40949 0.177
NP_441925.1_4 Forward -171 -152 -16.4225 0.282
NP_441925.1_4 Forward -168 -149 -17.1108 0.288
NP_440769.1_8 Reverse -92 -111 6.58763 0.296
NP_440856.1_1 Reverse -119 -138 -5.11376 0.276
NP_440856.1_7 Forward -288 -269 1.57275 0.161
NP_440856.1_7 Reverse -137 -156 -3.83545 0.203
NP_441083.1_5 Reverse -185 -195 8.23984 0.0429
NP_441083.1_5 Forward -152 -142 4.50326 0.141
NP_441083.1_5 Reverse -33 -43 0.373358 0.231
NP_441083.1_5 Forward -194 -184 0.275027 0.237
NP_441434.1_7 Forward -150 -136 8.84938 0.225
NP_441738.1_4 Reverse -245 -264 4.62101 0.218
NP_441558.1_5 Forward -44 -25 16.8141 0.0262
NP_441942.1_2 Reverse -148 -167 15.3391 0.197
NP_440209.1_1 Forward -42 -34 5.0343 0.194
NP_440870.1_4 Reverse -114 -132 1.29745 0.239
NP_441713.1_3 Reverse -149 -168 2.3594 0.277
NP_440178.1_7 Reverse -184 -203 -11.4069 0.0927
NP_442570.1_3 Reverse -141 -160 -7.08038 0.265
NP_441716.1_1 Reverse -33 -47 3.63784 0.259
NP_441716.1_1 Reverse -185 -199 3.44117 0.265
NP_441624.1_7 Reverse -191 -205 7.57108 0.249
NP_441495.1_1 Reverse -25 -44 10.6192 0.194
NP_440343.1_1 Forward -212 -193 16.7157 0.179
NP_440906.1_5 Reverse -384 -391 5.64398 0.292
NP_440747.1_10 Forward -197 -185 -11.8591 0.161
NP_440747.1_10 Forward -170 -158 -12.0557 0.199
NP_441130.1_10 Forward -196 -182 11.701 0.106
NP_441486.1_1 Reverse -30 -44 1.17956 0.117
NP_441486.1_1 Forward -45 -31 0.786239 0.126
NP_442850.1_1 Forward -44 -25 17.1332 0.253
NP_440944.1_2 Forward -206 -187 -2.85214 0.28
NP_442634.1_2 Reverse -114 -133 -0.197208 0.293
NP_443018.1_3 Reverse -34 -41 4.26735 0.267
NP_443018.1_3 Forward -41 -34 4.07068 0.299
NP_441634.1_5 Reverse -72 -86 17.7975 0.154
NP_441634.1_8 Reverse -274 -288 -1.27871 0.285
NP_440376.1_1 Reverse -185 -194 7.86621 0.0583
NP_440376.1_1 Reverse -33 -42 6.48957 0.0963
NP_440376.1_1 Reverse -158 -167 4.32629 0.163
NP_440376.1_1 Forward -97 -88 3.63797 0.2
NP_440376.1_1 Reverse -321 -330 2.06468 0.236
NP_440376.1_1 Forward -194 -185 0.589713 0.267
NP_440376.1_1 Forward -42 -33 -0.0986038 0.285
NP_442687.1_7 Forward -43 -33 15.418 0.0158
NP_442687.1_7 Forward -127 -117 7.94484 0.121
NP_442687.1_7 Forward -195 -185 5.38824 0.206
NP_442687.1_7 Reverse -142 -152 4.69992 0.238
NP_442687.1_7 Forward -168 -158 3.81494 0.286
NP_442485.1_3 Forward -169 -150 -3.44213 0.274
NP_442485.1_3 Reverse -207 -226 -5.40875 0.291
NP_442946.1_7 Reverse -330 -345 12.5151 0.284
NP_441846.1_10 Reverse -142 -161 -3.73712 0.153
NP_441846.1_10 Reverse -143 -162 -13.4719 0.206
NP_441846.1_10 Reverse -150 -169 -18.6834 0.256
NP_441846.1_10 Reverse -140 -159 -21.9284 0.257
NP_440642.1_10 Reverse -8 -22 6.78381 0.225
NP_441013.1_2 Reverse -28 -46 -3.42244 0.29
NP_441682.1_2 Forward -287 -268 1.57275 0.241
NP_441422.1_3 Reverse -153 -172 16.9342 0.187
NP_441029.1_10 Reverse -268 -287 21.2389 0.142
NP_442483.1_6 Reverse -365 -384 18.4848 0.131
NP_440667.1_2 Forward -372 -353 -9.14533 0.297
NP_441950.1_7 Reverse -152 -171 -8.26035 0.287
NP_441763.1_5 Reverse -257 -276 -2.75381 0.234
NP_442658.1_1 Reverse -31 -41 11.6809 0.0768
NP_441553.1_4 Forward -322 -304 15.8536 0.283
NP_442544.1_2 Forward -185 -171 -1.37704 0.287
NP_441414.1_9 Reverse -185 -204 -5.40875 0.176
NP_441256.1_1 Reverse -261 -280 3.14605 0.124
NP_441256.1_1 Forward -288 -269 -8.94866 0.269
NP_442937.1_2 Reverse -11 -30 13.6666 0.293
NP_441165.1_6 Reverse -150 -169 9.53756 0.231
NP_441958.1_5 Reverse -184 -194 1.25834 0.108
NP_441958.1_5 Forward -43 -33 1.16001 0.114
NP_441127.1_1 Forward -270 -256 9.43936 0.275
NP_441127.1_1 Reverse -85 -99 8.55439 0.29
NP_442836.1_5 Reverse -152 -171 3.53937 0.23
NP_440203.1_5 Forward -191 -181 9.12434 0.271
NP_440984.1_7 Reverse -28 -42 5.89945 0.235
NP_441097.1_2 Reverse -145 -162 5.34871 0.259
NP_441097.1_2 Reverse -125 -142 3.97208 0.291
NP_439990.1_5 Forward -199 -186 9.2624 0.147
NP_442911.1_2 Forward -204 -185 1.76941 0.0563
NP_442911.1_2 Reverse -175 -194 -8.06369 0.226
NP_442911.1_2 Reverse -78 -97 -8.06369 0.226
NP_440858.1_1 Forward -324 -305 1.57275 0.196
NP_443055.1_6 Forward -167 -149 -0.374908 0.259
NP_442236.1_3 Reverse -114 -133 6.39097 0.287
NP_441099.1_5 Forward -162 -143 -2.95047 0.129
NP_442438.1_10 Reverse -135 -149 -0.885388 0.283
NP_440811.1_5 Reverse -61 -80 14.7491 0.196
NP_440147.1_4 Forward -99 -86 -0.37404 0.282
NP_441550.1_8 Reverse -141 -151 12.8609 0.0296
NP_441550.1_8 Reverse -183 -193 10.0093 0.0785
NP_441916.1_7 Reverse -33 -43 4.60159 0.169
NP_441916.1_7 Forward -35 -25 3.12662 0.227
NP_441916.1_10 Forward -140 -121 4.22769 0.223
NP_440206.1_4 Forward -163 -144 4.91521 0.255
NP_441041.1_4 Reverse -158 -177 -7.67036 0.191
NP_441041.1_4 Reverse -185 -204 -12.7836 0.274
NP_441041.1_7 Reverse -30 -42 5.76558 0.241
NP_441547.1_1 Reverse -272 -291 2.0644 0.281
NP_441725.1_5 Reverse -34 -44 2.04498 0.115
NP_441725.1_5 Forward -193 -183 -0.511621 0.26
NP_439966.1_7 Forward -160 -150 11.4843 0.0632
NP_440202.1_8 Forward -176 -157 12.2379 0.272
NP_442941.1_3 Reverse -186 -196 7.84651 0.0564
NP_440289.1_2 Reverse -30 -43 -3.81562 0.271
NP_440983.1_5 Forward -132 -113 -5.21209 0.265
NP_441514.1_6 Reverse -292 -299 14.2971 0.248
NP_442281.1_1 Reverse -28 -42 8.16044 0.0845
NP_440437.1_1 Reverse -27 -46 -4.03212 0.248
NP_440437.1_1 Forward -200 -181 -4.91709 0.271
NP_442012.1_1 Forward -103 -84 1.47442 0.215
NP_442012.1_1 Reverse -82 -101 -1.18052 0.279
NP_441087.1_5 Forward -174 -155 10.1267 0.141
NP_440498.1_5 Forward -394 -376 19.5926 0.0729
NP_442982.1_5 Reverse -23 -42 -3.54046 0.299
NP_441644.1_6 Forward -152 -142 7.84605 0.115
NP_441644.1_6 Reverse -33 -43 5.19112 0.204
NP_441644.1_6 Reverse -185 -195 4.7978 0.224
NP_441644.1_6 Forward -35 -25 4.10949 0.249
NP_441644.1_6 Forward -42 -32 4.01116 0.253
NP_443049.1_6 Reverse -148 -158 12.9096 0.224
NP_442215.1_2 Forward -128 -112 2.32015 0.117
NP_442215.1_2 Reverse -277 -293 -3.57971 0.218
NP_442029.1_1 Reverse -147 -166 -20.3551 0.297
NP_440929.1_8 Forward -194 -185 6.68623 0.0887
NP_442933.1_10 Forward -35 -26 8.1612 0.0885
NP_442933.1_10 Reverse -33 -42 4.81794 0.212
NP_442933.1_10 Forward -194 -185 4.52295 0.24
NP_442933.1_10 Forward -42 -33 4.12963 0.28
NP_442554.1_8 Reverse -34 -44 4.0116 0.2
NP_442554.1_8 Forward -41 -31 2.63497 0.265
NP_441762.1_7 Forward -43 -31 -0.944332 0.0798
NP_442142.1_4 Reverse -23 -36 12.2117 0.0464
NP_442142.1_4 Forward -141 -128 6.41022 0.168
NP_442142.1_4 Reverse -267 -280 4.93527 0.206
NP_442142.1_4 Reverse -30 -43 4.93527 0.206
NP_442292.1_1 Reverse -186 -195 -0.786921 0.287
NP_442292.1_5 Forward -46 -27 -1.37718 0.262
NP_443009.1_5 Forward -43 -32 8.80962 0.099
NP_443009.1_5 Reverse -157 -168 5.26972 0.21
NP_443009.1_5 Reverse -25 -36 4.97473 0.222
NP_441715.1_4 Reverse -186 -196 5.28991 0.216
NP_440158.1_8 Reverse -141 -160 13.3725 0.213
NP_441468.1_1 Reverse -34 -41 4.07068 0.263
NP_441020.2_6 Reverse -156 -173 5.74204 0.291
NP_441015.1_10 Reverse -138 -157 5.50599 0.114
NP_441015.1_10 Reverse -144 -163 -10.0303 0.282
NP_441015.1_10 Reverse -124 -143 -10.817 0.288
NP_441015.1_10 Reverse -150 -169 -11.6036 0.298
NP_441015.1_10 Reverse -274 -293 -11.7019 0.3
NP_441673.1_1 Forward -194 -185 1.57302 0.0764
NP_441673.1_1 Reverse -185 -194 1.57302 0.0764
NP_441673.1_1 Reverse -33 -42 1.37636 0.114
NP_441673.1_1 Forward -42 -33 1.1797 0.163
NP_441244.1_8 Reverse -146 -165 1.37609 0.288
NP_441876.1_9 Reverse -201 -211 11.091 0.28
NP_442868.1_6 Forward -169 -159 4.69992 0.169
NP_440785.1_1 Reverse -239 -258 -0.197208 0.263
NP_442227.1_2 Forward -165 -146 12.3892 0.159
NP_442227.1_2 Forward -168 -149 5.211 0.202
NP_442227.1_2 Forward -162 -143 -0.983855 0.261
NP_442227.1_4 Reverse -19 -38 11.5033 0.285
NP_442808.1_1 Forward -169 -159 9.91099 0.0481
NP_442808.1_1 Reverse -32 -42 7.94438 0.0634
NP_442808.1_1 Reverse -87 -97 4.7978 0.19
NP_442808.1_1 Forward -159 -149 4.60114 0.195
NP_442808.1_1 Forward -170 -160 1.94622 0.281
NP_441906.1_5 Forward -169 -150 10.0284 0.246
NP_442542.1_2 Reverse -31 -44 6.31247 0.232
NP_442542.1_9 Forward -42 -28 7.27547 0.202
NP_440093.1_8 Reverse -209 -228 16.5191 0.224
NP_441518.1_3 Forward -139 -120 -3.54046 0.114
NP_441878.1_6 Forward -43 -33 9.41981 0.0266
NP_441878.1_6 Reverse -32 -42 1.65166 0.0795
NP_441878.1_6 Reverse -184 -194 1.55333 0.0937
NP_441878.1_6 Reverse -157 -167 -6.60814 0.193
NP_441878.1_6 Reverse -116 -126 -6.60814 0.193
NP_441036.1_8 Reverse -32 -42 6.46988 0.229
NP_441557.1_5 Forward -194 -185 0.688044 0.128
NP_441557.1_5 Reverse -185 -194 0.688044 0.128
NP_441557.1_5 Reverse -33 -42 0.491382 0.144
NP_441557.1_5 Forward -42 -33 0.29472 0.174
NP_441557.1_8 Reverse -262 -272 10.1076 0.298
NP_441445.1_1 Reverse -152 -171 6.88262 0.14
NP_441590.1_4 Forward -166 -147 3.53858 0.29
NP_441590.1_4 Forward -160 -141 2.26028 0.296
NP_441739.1_2 Forward -177 -161 12.6442 0.132
NP_440101.1_3 Reverse -138 -157 2.0644 0.259
NP_442183.1_1 Forward -303 -289 5.30946 0.223
NP_440676.1_7 Forward -119 -100 17.404 0.155
NP_441574.1_1 Reverse -117 -136 -2.65548 0.228
NP_441597.1_5 Forward -283 -264 18.584 0.252
NP_442888.1_6 Reverse -22 -41 13.9625 0.148
NP_442594.1_8 Reverse -141 -160 8.45592 0.206
NP_442508.1_2 Forward -325 -306 -2.75381 0.3
NP_440690.1_1 Forward -273 -254 7.86593 0.249
NP_441633.1_3 Forward -169 -156 4.93583 0.0644
NP_441633.1_3 Forward -196 -183 1.49425 0.109
NP_441633.1_3 Reverse -31 -44 -6.66722 0.265
NP_442764.1_8 Reverse -269 -288 6.58763 0.235
NP_442998.1_5 Forward -207 -197 15.2213 0.149
NP_442998.1_5 Reverse -244 -254 9.41981 0.241
NP_442998.1_10 Reverse -35 -42 6.23397 0.157
NP_440899.1_1 Reverse -138 -157 12.1159 0.148
NP_440299.1_1 Forward -198 -185 3.55864 0.241
NP_441799.1_1 Forward -46 -32 9.93039 0.082
NP_441799.1_1 Reverse -181 -195 9.34041 0.0942
NP_441007.1_10 Reverse -180 -193 0.0192843 0.254
NP_441007.1_10 Reverse -153 -166 -0.964025 0.296
NP_442333.2_5 Forward -163 -144 -11.8003 0.249
NP_441559.1_8 Reverse -83 -97 6.19444 0.0806
NP_441559.1_8 Forward -172 -158 5.60446 0.0879
NP_441559.1_8 Reverse -163 -177 -5.60527 0.267
NP_441270.1_5 Reverse -143 -162 11.0424 0.294
NP_440915.1_6 Reverse -29 -43 3.63784 0.101
NP_441179.1_9 Forward -281 -271 8.92768 0.284
NP_442069.1_10 Reverse -256 -274 14.6705 0.106
NP_442866.1_1 Reverse -138 -157 -4.22878 0.225
NP_441464.1_2 Reverse -263 -273 14.828 0.263
NP_441464.1_8 Forward -167 -153 14.2576 0.127
NP_441464.1_10 Forward -216 -202 8.75105 0.27
NP_441113.1_3 Reverse -292 -306 17.6002 0.196
NP_440695.1_5 Reverse -158 -177 1.86774 0.276
NP_442993.1_1 Reverse -33 -49 -11.3479 0.244
NP_442386.1_9 Forward -169 -160 9.83239 0.149
NP_442386.1_9 Forward -159 -150 9.63573 0.154
NP_440570.1_5 Reverse -125 -144 -3.93378 0.298
NP_441340.1_5 Forward -41 -34 3.97235 0.274
NP_441271.1_2 Reverse -256 -275 21.8289 0.126
NP_440586.1_1 Reverse -119 -138 -4.42544 0.278
NP_440586.1_8 Forward -41 -34 9.57686 0.146
NP_442959.1_7 Forward -160 -141 2.26107 0.222
NP_440027.1_3 Forward -168 -150 11.0314 0.159
NP_443051.1_1 Reverse -184 -193 -1.18024 0.297
NP_443051.1_4 Reverse -320 -339 20.354 0.0936
NP_439937.1_8 Reverse -118 -137 0.58944 0.235
NP_439937.1_9 Forward -98 -81 15.3777 0.0317
NP_439937.1_9 Forward -169 -152 -11.2699 0.248
NP_440921.1_9 Reverse -234 -253 20.5506 0.0712
NP_440574.1_3 Forward -47 -28 1.96607 0.173
NP_441789.1_7 Forward -161 -142 -1.27961 0.251
NP_441803.1_2 Reverse -21 -40 1.76941 0.226
NP_442384.1_10 Reverse -33 -46 13.4906 0.0197
NP_442384.1_10 Forward -194 -181 7.19745 0.0866
NP_442384.1_10 Reverse -185 -198 4.93583 0.142
NP_442035.1_8 Reverse -323 -337 12.1926 0.251
NP_442114.1_2 Reverse -51 -70 1.37609 0.262
NP_440364.1_6 Forward -159 -146 14.67 0.275
NP_440344.1_10 Reverse -81 -98 -2.91109 0.0757
NP_440344.1_10 Forward -104 -87 -4.38605 0.0956
NP_440282.1_2 Forward -152 -133 5.40766 0.295
NP_440531.1_6 Forward -296 -277 1.27776 0.178
NP_440531.1_6 Forward -50 -31 -3.3438 0.265
NP_442123.1_3 Reverse -321 -340 11.7992 0.22
NP_440562.1_3 Forward -151 -134 3.57876 0.223
NP_440297.1_9 Reverse -34 -44 9.02648 0.0943
NP_441592.1_4 Forward -167 -148 -1.57384 0.254
NP_440990.1_10 Reverse -146 -165 16.0274 0.261
NP_440999.1_9 Forward -171 -157 3.73617 0.124
NP_440999.1_9 Forward -289 -275 2.85119 0.142
NP_440999.1_9 Forward -130 -116 -0.590395 0.212
NP_440888.1_2 Reverse -185 -199 9.14375 0.137
NP_440888.1_2 Forward -97 -83 5.01387 0.298
NP_440491.1_1 Reverse -140 -159 7.4043 0.268
NP_442225.1_10 Reverse -361 -380 5.60352 0.287
NP_442033.1_10 Forward -170 -151 -0.4922 0.119
NP_441543.1_2 Forward -41 -32 6.78456 0.138
NP_441543.1_2 Reverse -27 -36 4.62128 0.227
NP_441543.1_2 Reverse -186 -195 4.32629 0.26
NP_442845.1_2 Reverse -143 -157 18.6825 0.0608
NP_441304.1_10 Forward -370 -361 12.8811 0.276
NP_441469.1_8 Reverse -32 -41 5.21127 0.283
NP_442315.1_2 Reverse -288 -300 11.8387 0.291
NP_443064.1_6 Reverse -185 -195 13.5365 0.0796
NP_442286.1_7 Forward -95 -76 13.3716 0.271
NP_441462.1_2 Forward -194 -184 1.25834 0.0964
NP_441462.1_2 Reverse -33 -43 0.668351 0.135
NP_441462.1_2 Forward -167 -157 -0.904945 0.265
NP_441462.1_4 Forward -169 -150 -4.42544 0.247
NP_441621.1_3 Reverse -277 -295 12.7038 0.237
NP_441929.1_3 Forward -178 -159 9.3409 0.205
NP_443062.1_1 Forward -35 -17 3.57305 0.293
NP_443062.1_6 Reverse -25 -44 1.17943 0.278
NP_443062.1_6 Forward -202 -183 1.0811 0.28
NP_440519.1_3 Forward -108 -89 13.7658 0.137
NP_442204.1_5 Forward -45 -26 3.73603 0.186
NP_440516.1_8 Forward -42 -33 5.80125 0.112
NP_440516.1_8 Reverse -143 -152 -0.68859 0.297
NP_442428.1_4 Reverse -184 -203 8.65258 0.17
NP_442428.1_5 Reverse -34 -41 4.46401 0.267
NP_442428.1_5 Forward -193 -186 3.67736 0.298
NP_440783.1_5 Reverse -144 -163 -5.70374 0.284
NP_441052.1_2 Reverse -185 -195 7.35486 0.0742
NP_442219.1_8 Reverse -181 -200 10.3897 0.205
NP_442219.1_8 Forward -46 -27 7.58731 0.267
NP_442219.1_9 Reverse -186 -195 5.3096 0.177
NP_440436.1_4 Forward -41 -32 11.9957 0.0435
NP_441884.1_9 Reverse -140 -159 -13.7669 0.138
NP_441004.1_1 Reverse -143 -162 -7.27704 0.197
NP_441004.1_1 Reverse -123 -142 -17.6018 0.292
NP_442366.1_3 Forward -43 -25 2.67408 0.125
NP_442366.1_3 Forward -36 -18 -3.71743 0.255
NP_441115.1_4 Forward -43 -25 9.45814 0.213
NP_442206.1_1 Forward -167 -148 -11.4069 0.219
NP_443054.1_2 Reverse -208 -222 4.42448 0.24
NP_443054.1_2 Forward -44 -30 4.22782 0.24
NP_440508.1_2 Reverse -304 -323 18.991 0.234
NP_441851.1_10 Reverse -157 -167 5.09324 0.227
NP_441851.1_10 Reverse -32 -42 4.79825 0.247
NP_441851.1_10 Forward -195 -185 3.91327 0.296
NP_442026.1_7 Forward -281 -262 16.7157 0.119
NP_442515.1_1 Forward -195 -181 4.71948 0.107
NP_442515.1_1 Forward -168 -154 2.45787 0.135
NP_442515.1_1 Reverse -184 -198 0.786239 0.18
NP_441046.1_2 Forward -205 -186 6.29264 0.221
NP_442843.1_1 Reverse -150 -169 15.2408 0.0882
NP_439960.1_10 Reverse -269 -287 2.28076 0.181
NP_440474.1_2 Reverse -26 -45 16.8141 0.275
NP_440474.1_8 Forward -128 -114 10.3237 0.14
NP_440726.1_5 Forward -178 -159 18.584 0.0999
NP_442450.1_5 Forward -44 -34 6.56821 0.167
NP_440588.1_2 Forward -51 -32 -4.81876 0.23
NP_440195.1_4 Forward -206 -187 8.35759 0.213
NP_441003.1_9 Forward -161 -142 8.16093 0.224
NP_441570.1_1 Reverse -143 -161 7.4923 0.0166
NP_440078.1_10 Reverse -158 -177 15.6341 0.123
NP_441078.1_4 Reverse -33 -42 7.66954 0.052
NP_441078.1_4 Reverse -88 -97 5.3096 0.113
NP_441078.1_4 Reverse -185 -194 0.589713 0.174
NP_441078.1_4 Forward -42 -33 0.491382 0.188
NP_441078.1_4 Forward -194 -185 0.393051 0.205
NP_441078.1_4 Forward -97 -88 -0.983583 0.213
NP_441078.1_4 Forward -167 -158 -1.6719 0.266
NP_442348.1_2 Forward -367 -358 6.98123 0.293
NP_440707.1_9 Forward -275 -256 5.01433 0.255
NP_442443.1_1 Forward -104 -85 -2.26216 0.254
NP_441091.1_5 Forward -162 -143 8.94757 0.19
NP_440526.1_3 Forward -41 -30 0.451529 0.281
NP_441432.1_8 Reverse -184 -193 2.55633 0.298
NP_441732.1_2 Forward -198 -182 -15.1828 0.145
NP_441030.1_7 Reverse -21 -40 17.109 0.228
NP_442003.1_9 Forward -220 -201 4.42435 0.263
NP_440760.1_1 Reverse -185 -204 -12.6852 0.0945
NP_440760.1_1 Forward -194 -175 -21.7317 0.243
NP_442797.1_6 Reverse -257 -276 8.41895 0.265
NP_440199.1_10 Forward -45 -35 8.04317 0.231
NP_442353.1_4 Reverse -27 -46 3.83357 0.21
NP_440713.1_4 Forward -162 -143 2.0644 0.273
NP_440713.1_4 Reverse -145 -164 1.47442 0.286
NP_442489.1_7 Reverse -33 -42 8.35786 0.0225
NP_442489.1_7 Forward -35 -26 5.21127 0.077
NP_442489.1_7 Forward -194 -185 0.884706 0.145
NP_442489.1_7 Reverse -185 -194 0.884706 0.145
NP_442489.1_7 Forward -42 -33 0.491382 0.178
NP_442489.1_7 Reverse -158 -167 -1.57357 0.213
NP_442489.1_7 Forward -97 -88 -1.96689 0.28
NP_442079.1_3 Reverse -133 -152 19.469 0.126
NP_440559.1_1 Reverse -34 -43 4.32629 0.288
NP_441659.2_8 Forward -42 -32 6.56821 0.0714
NP_441659.2_8 Forward -194 -184 0.176696 0.271
NP_441659.2_8 Reverse -33 -43 0.0783647 0.277
NP_441022.1_1 Reverse -59 -68 11.834 0.273
NP_442346.1_5 Forward -43 -33 15.418 0.00627
NP_442346.1_5 Reverse -184 -194 5.09324 0.262
NP_440831.1_3 Forward -161 -142 4.63975 0.298
NP_441629.1_3 Forward -151 -132 -1.8696 0.268
NP_441923.1_6 Forward -278 -264 15.6342 0.168
NP_440486.1_6 Reverse -263 -282 7.27595 0.274
NP_440459.1_2 Reverse -24 -41 7.217 0.299
NP_440010.1_4 Forward -162 -143 -2.45958 0.284
NP_441943.1_8 Forward -135 -116 -5.60541 0.261
NP_442137.1_6 Forward -283 -264 18.6823 0.0318
NP_442551.1_4 Reverse -182 -197 -2.18338 0.256
NP_442603.1_7 Reverse -143 -157 15.7319 0.0414
NP_442603.1_7 Reverse -185 -199 9.93039 0.137
NP_442603.1_7 Forward -285 -271 5.80051 0.273
NP_441888.1_7 Forward -102 -88 5.1128 0.225
NP_441888.1_7 Forward -163 -149 1.17956 0.263
NP_441888.1_9 Forward -288 -269 14.6533 0.267
NP_440170.1_2 Reverse -27 -46 17.8957 0.0539
NP_441044.1_4 Reverse -355 -373 0.314141 0.296
NP_442073.1_6 Forward -94 -75 -0.4922 0.269
NP_442140.1_3 Forward -41 -31 10.8948 0.0893
NP_441490.1_6 Forward -324 -310 20.0635 0.206
NP_440590.1_4 Forward -96 -83 3.06754 0.0772
NP_440590.1_4 Forward -41 -28 1.00259 0.136
NP_440590.1_4 Reverse -27 -40 -1.75067 0.228
NP_442497.1_10 Forward -193 -184 0.589713 0.153
NP_442497.1_10 Reverse -34 -43 0.393051 0.175
NP_440821.1_4 Reverse -183 -193 0.275027 0.19
NP_440821.1_4 Forward -44 -34 0.176696 0.198
NP_440821.1_4 Forward -196 -186 -0.806614 0.296
NP_441239.1_9 Reverse -31 -43 6.1355 0.2
NP_441239.1_9 Forward -44 -32 5.05386 0.231
NP_441951.1_6 Reverse -261 -280 22.5172 0.0321
NP_441951.1_9 Forward -296 -277 1.67108 0.254
NP_441727.1_3 Forward -337 -318 7.07928 0.236
NP_440624.1_5 Forward -76 -58 10.174 0.222
NP_440624.1_5 Forward -118 -100 6.79974 0.298
NP_441892.1_1 Reverse -17 -34 5.05372 0.105
NP_440665.1_1 Reverse -123 -142 -7.67036 0.224
NP_440665.1_1 Forward -282 -263 -10.7186 0.244
NP_440665.1_1 Forward -285 -266 -13.5702 0.257
NP_442216.1_4 Reverse -360 -368 8.1805 0.255
NP_441526.1_6 Reverse -147 -166 5.89931 0.265
NP_440949.1_7 Forward -166 -147 9.53674 0.261
NP_440354.1_7 Forward -48 -30 12.1139 0.224
NP_440546.1_4 Forward -42 -32 8.20381 0.199
NP_440546.1_4 Reverse -149 -159 7.42815 0.241
NP_442041.1_5 Reverse -118 -137 3.44104 0.244
NP_440462.1_4 Reverse -142 -156 17.2075 0.124
NP_440868.1_4 Forward -133 -121 -0.452677 0.269
NP_442499.1_1 Forward -193 -174 10.0292 0.203
NP_441474.1_1 Forward -162 -143 3.53858 0.233
NP_441474.1_1 Forward -159 -140 2.6536 0.247
NP_441474.1_1 Reverse -263 -282 1.37531 0.247
NP_441474.1_1 Forward -169 -150 -0.29631 0.255
NP_440812.1_10 Forward -274 -261 15.7522 0.259
NP_441084.1_6 Reverse -24 -38 11.4772 0.201
NP_441084.1_6 Forward -44 -30 11.3802 0.205
NP_442039.1_7 Forward -212 -202 11.1898 0.257
NP_441811.1_1 Reverse -196 -215 3.83436 0.299
NP_440160.1_5 Forward -243 -233 14.8275 0.284
NP_442053.1_1 Reverse -185 -194 5.40793 0.187
NP_440505.1_3 Reverse -86 -96 7.64985 0.151
NP_440914.1_1 Reverse -20 -30 6.66328 0.269
NP_440914.1_1 Reverse -185 -195 6.17532 0.293
NP_441011.1_8 Forward -193 -184 8.06287 0.16
NP_442533.1_1 Reverse -140 -159 -4.91709 0.153
NP_442533.1_1 Reverse -152 -171 -13.3736 0.237
NP_442533.1_1 Reverse -146 -165 -16.4218 0.268
NP_442533.1_6 Forward -42 -33 7.66954 0.0897
NP_442533.1_6 Reverse -33 -42 6.68623 0.105
NP_442533.1_6 Reverse -185 -194 5.3096 0.145
NP_442533.1_6 Reverse -117 -126 2.35967 0.259
NP_441089.1_8 Forward -169 -150 12.3883 0.278
NP_442541.1_4 Reverse -201 -219 18.2096 0.107
NP_442322.1_4 Forward -170 -153 -2.61678 0.234
NP_442322.1_4 Forward -171 -154 -8.8116 0.286
NP_441482.1_7 Forward -200 -186 -11.0135 0.229
NP_439944.1_9 Reverse -186 -196 6.96153 0.162
NP_439944.1_9 Reverse -34 -44 5.19158 0.27
NP_441028.1_6 Forward -284 -274 5.78111 0.243
NP_441028.1_6 Reverse -200 -210 5.78111 0.243
NP_440115.1_6 Reverse -182 -192 5.87989 0.214
NP_441680.1_4 Reverse -28 -47 -2.65548 0.27
NP_441972.1_5 Reverse -186 -205 -8.35868 0.263
NP_441106.1_1 Reverse -32 -41 11.7011 0.0311
NP_441286.1_1 Forward -195 -183 4.95553 0.027
NP_441286.1_1 Reverse -32 -44 -5.07423 0.188
NP_440670.1_8 Reverse -33 -42 6.98123 0.0882
NP_441705.1_3 Reverse -279 -298 -2.0655 0.281
NP_440886.1_7 Forward -159 -149 12.2709 0.0805
NP_440886.1_7 Forward -168 -158 11.5826 0.0805
NP_440886.1_7 Forward -43 -33 3.8145 0.265
NP_440828.1_1 Forward -95 -76 -1.8696 0.294
NP_442072.1_9 Forward -43 -25 -5.29072 0.0617
NP_442072.1_9 Reverse -184 -202 -23.3836 0.292
NP_442264.1_2 Forward -52 -35 15.0835 0.127
NP_442264.1_2 Reverse -139 -156 6.92201 0.25
NP_441021.1_8 Reverse -28 -46 10.6389 0.123
NP_441988.1_10 Forward -40 -28 19.1152 0.226
NP_442794.1_1 Forward -156 -144 6.43049 0.18
NP_442794.1_1 Forward -198 -186 5.15219 0.231
NP_440387.1_1 Forward -194 -178 -5.74299 0.249
NP_440387.1_1 Reverse -185 -201 -6.03799 0.262
NP_440855.1_5 Forward -134 -115 5.30853 0.285
NP_441431.1_3 Forward -279 -260 2.45773 0.283
NP_441488.1_8 Forward -143 -129 7.57046 0.241
NP_441993.1_1 Reverse -151 -170 4.18821 0.223
NP_440114.1_10 Reverse -33 -47 9.34103 0.177
NP_441510.2_9 Reverse -141 -160 8.35759 0.165
NP_440287.1_6 Forward -44 -25 1.37609 0.276
NP_442087.1_2 Reverse -158 -177 12.8246 0.276
NP_440293.1_3 Forward -31 -12 -6.88371 0.294
NP_439911.1_7 Forward -368 -349 15.6341 0.147
NP_442940.1_2 Forward -150 -131 -0.590531 0.296
NP_442509.1_9 Forward -194 -184 16.8925 0.00739
NP_442509.1_9 Forward -349 -339 7.64939 0.21
NP_442509.1_9 Reverse -33 -43 7.55106 0.214
NP_441885.1_5 Reverse -185 -195 1.94665 0.0935
NP_442341.1_7 Forward -98 -84 7.76774 0.0994
NP_442341.1_7 Forward -43 -29 7.47274 0.105
NP_442341.1_7 Reverse -87 -101 4.91614 0.175
NP_442341.1_7 Reverse -184 -198 4.71948 0.181
NP_442341.1_9 Forward -160 -146 4.8172 0.291
NP_440119.1_1 Reverse -261 -277 2.91013 0.192
NP_442395.2_4 Reverse -87 -106 5.70185 0.155
NP_440423.1_6 Reverse -135 -154 -14.1602 0.224
NP_443000.1_7 Forward -196 -186 4.79825 0.169
NP_441842.1_1 Forward -95 -82 10.7368 0.291
NP_440679.1_5 Forward -282 -263 13.8641 0.154
NP_440679.1_5 Reverse -267 -286 5.89931 0.292
NP_440679.1_10 Reverse -142 -161 -16.1268 0.251
NP_443010.1_10 Forward -240 -223 4.8001 0.219
NP_441359.1_5 Forward -45 -26 7.17762 0.186
NP_440175.1_4 Reverse -141 -160 -7.67036 0.171
NP_440175.1_4 Reverse -277 -296 -14.5535 0.277
NP_440149.1_8 Reverse -143 -162 -7.37537 0.283
NP_442127.1_1 Reverse -8 -26 11.9164 0.213
NP_440216.1_1 Forward -42 -28 -11.3085 0.178
NP_440216.1_9 Forward -17 -8 5.89959 0.289
NP_440172.1_1 Reverse -33 -43 4.0116 0.208
NP_440172.1_1 Reverse -185 -195 2.63497 0.274
NP_442015.1_10 Forward -198 -185 5.13249 0.15
NP_442015.1_10 Forward -156 -143 3.85419 0.178
NP_442015.1_10 Reverse -29 -42 -0.472371 0.268
NP_441226.1_7 Forward -157 -150 8.29857 0.205
NP_440117.1_2 Forward -25 -7 13.7855 0.295
NP_441111.1_7 Forward -193 -185 -0.570565 0.233
NP_441111.1_7 Reverse -186 -194 -0.570565 0.233
NP_443052.1_8 Reverse -175 -194 -10.6203 0.212
NP_443052.1_10 Reverse -112 -131 17.0634 0.242
NP_440072.1_5 Reverse -150 -168 8.08229 0.234
NP_440072.1_5 Reverse -149 -167 -2.83245 0.271
NP_442403.1_9 Reverse -117 -136 2.85105 0.285
NP_440591.1_9 Reverse -142 -160 3.65739 0.296
NP_442154.1_1 Reverse -150 -168 1.59244 0.0831
NP_442154.1_1 Forward -278 -260 -7.94566 0.151
NP_442154.1_1 Reverse -141 -159 -14.1405 0.217
NP_440261.1_5 Reverse -34 -47 3.36254 0.0628
NP_440261.1_5 Forward -193 -180 -2.73398 0.0924
NP_440261.1_5 Forward -151 -138 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGTTTGTCAACGATCATTTGCAGGACTCTGAAGGGGCATTATTGTTGGTGTTACAAACCCGCATTGACGAAGCAGACGCCTTAATTAGCAAACATTTGGAGCTTCCCCTAATAGCCTTGACCACCATGGTGGAGCAGGTGCTAGATAATTCTGCCCTGTTGACAGAAATTGTGCGTCAAGCGGATTTTCGCTGGGGACAAATCTATGGTGAACGCCCCCATTTTGAAATTCCCGGCAACCCCCCCCATCCCGATGACCCCTACACCATGACGTCGGTCACAGCCCAGCTTGAAACTTTACTTCGGGTATTGCCGCCGAAAAGTCCAGAAGTCAAGACTTTTGATAGTCTTAGATTGAGGGCCATCGTCGATGGTCTTTGTTAGTCAAGGAAAAACACTTC

CDS

ATGGAAAAAATTTGGGTCAATGAACAACTAGATCCCGCAGGCATTGTCTATGCTTGCATTGCTTGTCTGGACGAAGACGCCGCCCAGGATTGCCATCGTTCTTGGCAAGACAATCTGACTCCTGCCCAAAAAGCAGAGGGATGGACAGCGCAACTCCGCATGGTTAATTCCTGGGATGATGTCCCCGTTAATGCCCTTAAGTTAAGTTTTTAG

Protein

MEKIWVNEQLDPAGIVYACIACLDEDAAQDCHRSWQDNLTPAQKAEGWTAQLRMVNSWDDVPVNALKLSF