Your browser is old and dusty. Try Google Chrome!

Details for ssl2595

ORF ssl2595
Accession NP_440951.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -218 -232 2.2612 0.178
NP_441061.1_2 Reverse -354 -368 1.86788 0.181
NP_441061.1_2 Forward -232 -218 -0.885388 0.242
NP_441061.1_2 Forward -226 -212 -1.08205 0.249
NP_440795.1_7 Forward -361 -354 14.6904 0.0123
NP_440795.1_7 Reverse -354 -361 14.6904 0.0123
NP_441418.1_6 Reverse -302 -321 -23.6983 0.197
NP_441418.1_6 Forward -362 -343 -28.3199 0.204
NP_441453.1_4 Reverse -353 -361 16.539 0.00633
NP_441453.1_4 Forward -362 -354 16.539 0.00633
NP_441453.1_4 Forward -98 -90 5.13263 0.179
NP_442151.1_6 Reverse -353 -367 17.3058 0.0111
NP_442151.1_6 Forward -362 -348 10.226 0.127
NP_442151.1_6 Forward -171 -157 6.3911 0.236
NP_441818.1_1 Reverse -354 -365 16.0861 0.0221
NP_440226.1_1 Reverse -353 -372 20.5506 0.00984
NP_441465.1_8 Forward -237 -219 9.36059 0.208
NP_440931.1_7 Reverse -334 -352 11.5231 0.258
NP_443002.1_5 Forward -232 -214 12.703 0.215
NP_442173.1_1 Forward -361 -353 15.4574 0.00633
NP_442173.1_1 Reverse -354 -362 15.4574 0.00633
NP_442752.1_4 Forward -362 -355 13.8055 0.0199
NP_442752.1_4 Reverse -353 -360 13.8055 0.0199
NP_443027.1_4 Forward -364 -354 13.1564 0.0521
NP_443027.1_4 Reverse -351 -361 5.87989 0.294
NP_442975.1_10 Reverse -349 -363 20.3534 0.00216
NP_440784.1_7 Forward -361 -354 15.9687 0.0123
NP_440784.1_7 Reverse -354 -361 15.9687 0.0123
NP_440061.1_9 Reverse -351 -365 11.4053 0.111
NP_440061.1_9 Forward -258 -244 7.66879 0.198
NP_441054.1_4 Forward -372 -354 10.3439 0.0619
NP_440878.1_9 Reverse -343 -362 12.0942 0.0939
NP_442062.1_3 Forward -348 -329 7.86593 0.154
NP_442062.1_3 Reverse -28 -47 -0.688862 0.249
NP_442062.1_8 Forward -362 -352 19.4496 0.000558
NP_442062.1_8 Reverse -353 -363 17.3846 0.00193
NP_440761.1_4 Forward -367 -348 -12.5869 0.257
NP_441859.1_3 Reverse -352 -371 9.83173 0.125
NP_441859.1_3 Reverse -301 -320 1.37531 0.287
NP_440304.1_4 Forward -179 -169 12.8614 0.051
NP_440304.1_4 Forward -364 -354 9.91146 0.051
NP_440304.1_4 Reverse -351 -361 1.84832 0.299
NP_442242.1_4 Forward -361 -354 14.3954 0.0124
NP_442242.1_4 Reverse -354 -361 14.3954 0.0124
NP_441581.1_6 Forward -361 -342 11.4255 0.283
NP_441208.1_9 Forward -365 -351 4.52282 0.299
NP_441594.1_6 Forward -236 -217 3.6377 0.226
NP_440273.1_2 Reverse -354 -373 7.4718 0.288
NP_440769.1_8 Reverse -273 -292 7.86593 0.248
NP_441083.1_5 Reverse -353 -363 20.3345 0.00053
NP_441083.1_5 Forward -362 -352 11.3864 0.0159
NP_441434.1_7 Forward -360 -346 4.12949 0.225
NP_440645.1_1 Forward -248 -229 9.63589 0.191
NP_441738.1_2 Forward -360 -353 15.28 0.0102
NP_441738.1_2 Reverse -355 -362 15.28 0.0102
NP_441558.1_5 Forward -364 -345 12.5858 0.0675
NP_440209.1_1 Reverse -353 -361 18.1123 0.00295
NP_440209.1_1 Forward -362 -354 18.1123 0.00295
NP_442889.1_8 Reverse -350 -364 12.8803 0.0599
NP_442889.1_8 Forward -365 -351 3.44058 0.278
NP_441713.1_1 Forward -368 -349 -4.81876 0.113
NP_440178.1_7 Reverse -352 -371 -22.6167 0.268
NP_441716.1_1 Reverse -353 -367 4.71948 0.252
NP_442111.1_4 Forward -363 -349 10.7177 0.0518
NP_441624.1_7 Forward -232 -218 9.83269 0.217
NP_441163.1_1 Reverse -345 -362 7.51126 0.242
NP_441163.1_1 Forward -240 -223 4.95467 0.282
NP_440851.1_3 Reverse -316 -335 1.67108 0.285
NP_440906.1_5 Forward -361 -354 15.8704 0.0124
NP_440906.1_5 Reverse -354 -361 15.8704 0.0124
NP_440906.1_5 Forward -97 -90 8.20058 0.19
NP_440747.1_10 Forward -365 -353 7.51213 0.00286
NP_440747.1_10 Reverse -350 -362 5.44718 0.0137
NP_441130.1_10 Reverse -351 -365 10.7177 0.112
NP_441130.1_10 Forward -364 -350 8.25939 0.139
NP_441486.1_1 Forward -365 -351 13.9626 0.00727
NP_441486.1_1 Reverse -350 -364 13.5693 0.0082
NP_441486.1_1 Forward -101 -87 -5.50694 0.242
NP_442634.1_4 Forward -400 -386 -4.81863 0.22
NP_440403.1_4 Forward -87 -68 -4.91709 0.216
NP_440403.1_4 Reverse -344 -363 -9.73531 0.284
NP_442848.1_1 Reverse -347 -361 -1.96703 0.263
NP_442848.1_1 Forward -368 -354 -3.147 0.263
NP_442848.1_9 Reverse -224 -243 6.68596 0.182
NP_443018.1_3 Forward -361 -354 14.8871 0.0123
NP_443018.1_3 Reverse -354 -361 14.8871 0.0123
NP_441316.1_7 Reverse -351 -366 -3.16669 0.273
NP_441634.1_8 Forward -364 -350 5.30946 0.114
NP_441634.1_8 Reverse -351 -365 -4.32697 0.295
NP_440376.1_1 Forward -362 -353 19.4693 0.000692
NP_440376.1_1 Reverse -353 -362 19.4693 0.000692
NP_440376.1_1 Forward -177 -168 4.0313 0.182
NP_441588.1_4 Forward -360 -350 16.4996 0.0369
NP_441588.1_4 Reverse -355 -365 8.63316 0.14
NP_442687.1_7 Reverse -352 -362 15.8113 0.0125
NP_442687.1_7 Forward -363 -353 8.92815 0.0994
NP_442687.1_7 Forward -399 -389 4.20827 0.262
NP_442530.1_2 Forward -139 -129 16.893 0.178
NP_442530.1_2 Reverse -322 -332 10.7964 0.292
NP_440642.1_10 Reverse -200 -214 6.29216 0.234
NP_440642.1_10 Reverse -172 -186 6.29216 0.234
NP_441422.1_7 Forward -244 -227 -4.68105 0.247
NP_441950.1_8 Reverse -229 -243 4.52282 0.292
NP_442658.1_1 Reverse -351 -361 15.9091 0.00966
NP_442658.1_1 Forward -364 -354 9.616 0.147
NP_441414.1_9 Reverse -353 -372 2.85105 0.0623
NP_440607.1_5 Reverse -215 -234 3.04771 0.226
NP_441478.1_5 Forward -241 -222 23.0089 0.0339
NP_442937.1_5 Reverse -348 -367 7.57094 0.248
NP_442937.1_5 Forward -202 -183 6.4893 0.278
NP_441958.1_5 Forward -363 -353 12.2714 0.00183
NP_441958.1_5 Reverse -352 -362 12.2714 0.00183
NP_441127.1_1 Reverse -224 -238 11.0127 0.237
NP_440318.1_1 Forward -239 -220 4.62101 0.239
NP_442836.1_5 Forward -368 -349 9.14423 0.135
NP_442836.1_5 Forward -245 -226 2.65439 0.252
NP_440269.1_1 Forward -238 -220 18.2104 0.173
NP_439905.1_1 Reverse -354 -367 8.47575 0.234
NP_440984.1_7 Forward -367 -353 9.93102 0.126
NP_439990.1_5 Forward -367 -354 17.9155 0.0197
NP_439990.1_5 Reverse -348 -361 10.049 0.128
NP_442911.1_2 Forward -372 -353 12.9791 0.0118
NP_441348.1_3 Forward -367 -348 8.75091 0.235
NP_441099.1_5 Forward -372 -353 -2.0655 0.117
NP_442002.1_9 Reverse -352 -359 10.7572 0.185
NP_441294.1_7 Reverse -349 -363 19.6174 0.00271
NP_441646.1_1 Reverse -346 -365 7.57094 0.158
NP_442438.1_10 Forward -367 -353 0.786239 0.213
NP_442438.1_10 Reverse -348 -362 0.294584 0.232
NP_441292.1_2 Reverse -236 -255 -2.75381 0.219
NP_441000.1_6 Forward -363 -349 -3.34366 0.221
NP_441000.1_6 Reverse -352 -366 -4.91696 0.254
NP_441000.1_6 Forward -99 -85 -5.01529 0.257
NP_440147.1_4 Reverse -351 -364 22.0454 0.00117
NP_440147.1_4 Reverse -134 -147 3.75586 0.181
NP_440147.1_4 Forward -364 -351 0.904263 0.244
NP_441550.1_8 Forward -364 -354 16.7941 0.00906
NP_441550.1_8 Reverse -351 -361 8.3377 0.124
NP_441550.1_8 Reverse -245 -255 8.14104 0.132
NP_441550.1_8 Forward -400 -390 4.69947 0.291
NP_441916.1_7 Forward -362 -352 18.4663 0.00144
NP_441916.1_7 Reverse -353 -363 10.3048 0.0261
NP_441916.1_7 Forward -98 -88 3.81494 0.202
NP_440465.1_6 Reverse -212 -231 19.9606 0.124
NP_441041.1_4 Forward -355 -336 -0.885524 0.0986
NP_441041.1_4 Forward -362 -343 -6.1954 0.164
NP_441041.1_4 Forward -232 -213 -8.35868 0.2
NP_441041.1_4 Reverse -218 -237 -10.9153 0.238
NP_441041.1_4 Reverse -212 -231 -11.2103 0.242
NP_441041.1_7 Reverse -350 -362 18.9817 0.00435
NP_441041.1_7 Forward -365 -353 12.4708 0.0611
NP_440569.1_10 Forward -53 -34 5.29938 0.24
NP_441725.1_5 Reverse -354 -364 9.02648 0.0553
NP_441725.1_5 Forward -361 -351 2.04498 0.115
NP_439966.1_7 Forward -364 -354 14.8275 0.0177
NP_439966.1_7 Reverse -351 -361 9.91099 0.0968
NP_439966.1_7 Forward -234 -224 4.69947 0.263
NP_439966.1_9 Forward -364 -355 0.884706 0.253
NP_439966.1_9 Reverse -351 -360 0.884706 0.253
NP_442941.1_3 Reverse -354 -364 10.9931 0.0116
NP_442941.1_3 Forward -361 -351 2.63497 0.14
NP_442941.1_3 Reverse -90 -100 0.275027 0.222
NP_440289.1_2 Reverse -350 -363 12.6056 0.0139
NP_440289.1_2 Forward -365 -352 4.93583 0.0636
NP_440289.1_4 Forward -366 -347 10.6192 0.233
NP_440260.1_8 Forward -236 -218 -6.4707 0.291
NP_442281.1_1 Reverse -348 -362 12.2903 0.0385
NP_442281.1_1 Forward -367 -353 6.19383 0.133
NP_440177.1_1 Reverse -219 -237 22.4386 0.0213
NP_441058.2_3 Reverse -234 -253 16.9124 0.12
NP_440437.1_1 Reverse -347 -366 13.7658 0.0278
NP_442500.1_8 Forward -313 -299 9.50354 0.285
NP_441644.1_6 Reverse -353 -363 17.3841 0.00127
NP_441644.1_6 Forward -362 -352 10.1076 0.0628
NP_441644.1_6 Forward -256 -246 9.81266 0.0678
NP_441644.1_6 Forward -355 -345 7.84605 0.115
NP_441644.1_6 Reverse -168 -178 3.12618 0.297
NP_442215.1_2 Forward -364 -348 6.64671 0.0702
NP_442215.1_2 Reverse -351 -367 4.58176 0.0832
NP_442215.1_2 Reverse -344 -360 -4.26803 0.23
NP_442029.1_1 Forward -364 -345 -19.8634 0.297
NP_440253.1_2 Reverse -353 -371 9.36059 0.0491
NP_440253.1_2 Forward -362 -344 4.73903 0.1
NP_440929.1_8 Forward -362 -353 19.2726 0.000701
NP_440929.1_8 Reverse -353 -362 19.2726 0.000701
NP_442933.1_10 Forward -362 -353 17.601 0.00325
NP_442933.1_10 Reverse -353 -362 17.601 0.00325
NP_442933.1_10 Reverse -89 -98 4.12963 0.28
NP_441751.2_8 Reverse -354 -368 9.93102 0.0307
NP_441751.2_8 Reverse -145 -159 -5.70361 0.231
NP_442554.1_8 Reverse -354 -364 18.0729 0.00543
NP_442554.1_8 Forward -361 -351 13.2547 0.0187
NP_441762.1_7 Reverse -352 -364 11.8387 0.0142
NP_441762.1_7 Forward -363 -351 10.1671 0.0142
NP_441762.1_7 Forward -243 -231 -5.76255 0.238
NP_442142.1_4 Forward -365 -352 14.7683 0.0302
NP_442142.1_4 Reverse -350 -363 12.605 0.0434
NP_442142.1_4 Forward -101 -88 6.31189 0.169
NP_442292.1_1 Reverse -354 -363 18.486 0.00229
NP_442292.1_1 Forward -361 -352 9.63616 0.0183
NP_442292.1_5 Forward -366 -347 8.94757 0.138
NP_440919.1_7 Reverse -129 -147 13.5491 0.147
NP_442143.1_8 Reverse -345 -364 10.6184 0.235
NP_442476.1_6 Reverse -354 -368 6.19444 0.13
NP_442381.1_1 Forward -240 -221 23.9168 0.00648
NP_443009.1_2 Reverse -91 -110 -5.11376 0.283
NP_443009.1_5 Forward -363 -352 18.3477 0.00265
NP_443009.1_5 Forward -178 -167 5.07306 0.218
NP_443009.1_5 Forward -99 -88 4.67974 0.234
NP_441865.1_3 Forward -275 -257 14.5721 0.235
NP_441715.1_4 Forward -361 -351 9.41981 0.097
NP_441715.1_4 Reverse -354 -364 7.84651 0.107
NP_441715.1_4 Reverse -137 -147 4.40493 0.281
NP_440357.1_3 Reverse -351 -370 2.26107 0.264
NP_440015.1_9 Reverse -353 -371 2.67408 0.203
NP_440970.1_1 Reverse -205 -219 15.9292 0.292
NP_440379.1_5 Forward -236 -217 -1.7705 0.192
NP_441468.1_1 Forward -361 -354 15.8704 0.0124
NP_441468.1_1 Reverse -354 -361 15.8704 0.0124
NP_441618.1_6 Forward -355 -336 10.8159 0.3
NP_441020.2_6 Forward -364 -347 7.90532 0.215
NP_441020.2_6 Reverse -67 -84 6.92201 0.249
NP_441015.1_10 Reverse -341 -360 -7.27704 0.265
NP_441673.1_1 Forward -362 -353 20.8459 0.000698
NP_441673.1_1 Reverse -353 -362 20.8459 0.000698
NP_440265.1_4 Forward -247 -228 16.9551 0.287
NP_441826.1_2 Reverse -347 -361 3.04785 0.115
NP_441826.1_2 Forward -368 -354 -3.147 0.283
NP_441764.1_8 Reverse -31 -41 13.7033 0.284
NP_441764.1_8 Forward -296 -286 11.1193 0.287
NP_442868.1_6 Forward -364 -354 17.4829 0.012
NP_442868.1_6 Reverse -351 -361 0.865012 0.205
NP_441612.1_2 Reverse -353 -363 8.54929 0.21
NP_442427.1_8 Forward -371 -352 9.53756 0.18
NP_442808.1_1 Reverse -352 -362 18.4657 0.00201
NP_442808.1_1 Forward -363 -353 8.63269 0.0481
NP_440145.1_3 Forward -372 -353 -1.86883 0.156
NP_440145.1_3 Reverse -343 -362 -2.75381 0.178
NP_442820.1_7 Forward -258 -245 21.7504 0.104
NP_442050.1_5 Forward -364 -354 15.6142 0.01
NP_442342.1_9 Forward -234 -218 9.49831 0.161
NP_442342.1_9 Forward -364 -348 5.17175 0.241
NP_440385.1_8 Reverse -35 -54 10.3605 0.247
NP_441114.1_3 Reverse -151 -160 7.96454 0.231
NP_440558.1_2 Forward -236 -217 3.93269 0.153
NP_440558.1_2 Forward -269 -250 -6.49039 0.275
NP_441878.1_6 Forward -363 -353 10.4031 0.0176
NP_441878.1_6 Reverse -352 -362 10.4031 0.0176
NP_441036.1_8 Reverse -352 -362 17.7779 0.000554
NP_441036.1_8 Forward -363 -353 8.33817 0.174
NP_441557.1_5 Forward -362 -353 19.9609 0.000699
NP_441557.1_5 Reverse -353 -362 19.9609 0.000699
NP_441557.1_5 Forward -98 -89 -0.786921 0.239
NP_441445.1_1 Forward -371 -352 12.7825 0.0633
NP_442066.2_9 Forward -366 -353 17.6205 0.0254
NP_441433.1_8 Reverse -243 -262 -4.72043 0.294
NP_440084.1_8 Reverse -286 -300 10.6112 0.266
NP_441458.1_10 Reverse -344 -363 6.78429 0.196
NP_442183.1_1 Reverse -353 -367 10.0294 0.0903
NP_442632.1_1 Reverse -12 -31 11.7983 0.251
NP_442347.1_2 Reverse -354 -363 12.4878 0.056
NP_442347.1_2 Forward -361 -352 11.1111 0.056
NP_442645.1_2 Forward -370 -351 -11.3086 0.144
NP_442645.1_2 Reverse -338 -357 -15.1435 0.19
NP_442645.1_2 Reverse -239 -258 -15.4385 0.2
NP_442888.1_6 Forward -373 -354 11.5042 0.148
NP_441037.1_4 Reverse -351 -361 14.7245 0.028
NP_441037.1_4 Forward -364 -354 9.55921 0.21
NP_441633.1_3 Reverse -351 -364 13.1956 0.018
NP_441633.1_3 Forward -364 -351 1.39592 0.109
NP_440136.1_2 Forward -361 -354 15.9687 0.0123
NP_440136.1_2 Reverse -354 -361 15.9687 0.0123
NP_442590.1_10 Forward -248 -229 4.22769 0.278
NP_442590.1_10 Forward -239 -220 4.22769 0.278
NP_442998.1_5 Forward -314 -304 13.7464 0.157
NP_442998.1_10 Forward -360 -353 15.5754 0.0102
NP_442998.1_10 Reverse -355 -362 15.5754 0.0102
NP_440899.1_1 Reverse -230 -249 5.57728 0.3
NP_440299.1_1 Reverse -349 -362 11.9167 0.0427
NP_440299.1_1 Forward -366 -353 3.85363 0.228
NP_441799.1_1 Forward -366 -352 15.1419 0.0203
NP_441799.1_1 Reverse -349 -363 5.70218 0.197
NP_441007.1_10 Forward -367 -354 12.704 0.0499
NP_442333.2_5 Forward -237 -218 -6.58872 0.227
NP_440256.1_1 Forward -101 -82 -4.13045 0.147
NP_440256.1_1 Forward -365 -346 -6.58872 0.215
NP_440256.1_1 Forward -180 -161 -9.14533 0.275
NP_441559.1_8 Reverse -348 -362 3.14618 0.143
NP_441559.1_8 Reverse -300 -314 -5.50694 0.264
NP_441559.1_8 Forward -237 -223 -6.68692 0.279
NP_440915.1_6 Reverse -349 -363 6.29277 0.0828
NP_440915.1_6 Forward -366 -352 4.42448 0.0953
NP_442158.1_4 Reverse -199 -209 14.533 0.176
NP_442158.1_4 Reverse -308 -318 12.1731 0.257
NP_441464.1_8 Reverse -353 -367 7.66941 0.206
NP_441464.1_10 Reverse -104 -118 8.35772 0.284
NP_440695.1_6 Reverse -326 -340 10.2174 0.269
NP_442993.1_1 Forward -362 -346 2.02515 0.0502
NP_442993.1_1 Reverse -353 -369 -9.67623 0.19
NP_442386.1_9 Reverse -352 -361 15.7322 0.0144
NP_442386.1_9 Forward -363 -354 13.8639 0.0289
NP_442386.1_9 Forward -233 -224 7.07914 0.219
NP_441340.1_5 Forward -361 -354 15.6737 0.0124
NP_441340.1_5 Reverse -354 -361 15.6737 0.0124
NP_442950.1_1 Forward -301 -282 0.982764 0.206
NP_440586.1_8 Forward -361 -354 13.2151 0.026
NP_440586.1_8 Reverse -354 -361 13.2151 0.026
NP_442251.1_6 Forward -361 -354 15.2804 0.0124
NP_442251.1_6 Reverse -354 -361 15.2804 0.0124
NP_441262.1_3 Reverse -353 -360 14.7888 0.0223
NP_441262.1_3 Forward -362 -355 14.7888 0.0223
NP_440027.1_3 Reverse -343 -361 1.69003 0.299
NP_443051.1_1 Reverse -352 -361 10.4228 0.00754
NP_443051.1_1 Forward -363 -354 10.4228 0.00754
NP_439937.1_9 Reverse -352 -369 -6.64833 0.157
NP_440439.1_1 Forward -365 -352 1.39592 0.156
NP_440372.1_2 Forward -361 -354 16.3621 0.0124
NP_440372.1_2 Reverse -354 -361 16.3621 0.0124
NP_440378.1_6 Forward -116 -97 17.404 0.171
NP_440819.1_5 Forward -315 -307 17.424 0.185
NP_441803.1_2 Forward -367 -348 6.4893 0.152
NP_441803.1_2 Reverse -225 -244 -1.08219 0.294
NP_439977.1_5 Forward -368 -349 3.04771 0.163
NP_439977.1_5 Reverse -347 -366 0.786102 0.201
NP_442384.1_10 Forward -256 -243 12.5073 0.0274
NP_442384.1_10 Forward -362 -349 8.37742 0.0656
NP_442384.1_10 Forward -232 -219 2.37923 0.228
NP_442384.1_10 Reverse -353 -366 2.08423 0.237
NP_442384.1_10 Forward -355 -342 0.412608 0.291
NP_440364.1_2 Forward -232 -213 16.7589 0.189
NP_442262.1_10 Forward -361 -354 14.1988 0.0123
NP_442262.1_10 Reverse -354 -361 14.1988 0.0123
NP_441689.1_5 Forward -364 -354 5.87944 0.197
NP_440344.1_10 Reverse -346 -363 11.3469 0.0063
NP_440344.1_10 Forward -369 -352 -0.452814 0.0426
NP_440531.1_6 Forward -370 -351 5.70265 0.112
NP_441060.1_4 Forward -214 -196 2.96908 0.252
NP_440562.1_3 Reverse -354 -371 4.6604 0.19
NP_441640.1_8 Forward -361 -342 1.76941 0.168
NP_440297.1_9 Forward -361 -351 -0.118297 0.282
NP_440297.1_9 Reverse -354 -364 -0.216628 0.282
NP_440297.1_9 Forward -231 -221 -0.609952 0.292
NP_441896.1_3 Forward -371 -352 1.96607 0.209
NP_441896.1_3 Reverse -344 -363 1.27776 0.218
NP_441896.1_3 Forward -30 -11 -2.95047 0.294
NP_441896.1_5 Reverse -107 -114 12.2322 0.273
NP_440894.1_10 Forward -367 -348 3.24438 0.276
NP_440894.1_10 Reverse -348 -367 3.14605 0.278
NP_440999.1_9 Reverse -349 -363 14.0609 0.0277
NP_440999.1_9 Forward -366 -352 1.76955 0.158
NP_440888.1_2 Reverse -353 -367 16.5185 0.00647
NP_440888.1_2 Forward -362 -348 10.422 0.0946
NP_442033.1_10 Reverse -341 -360 -11.6036 0.255
NP_442033.1_10 Forward -364 -345 -11.7019 0.257
NP_441949.1_2 Reverse -333 -352 3.04771 0.261
NP_440575.1_1 Forward -334 -315 -2.55791 0.294
NP_441543.1_2 Forward -361 -352 18.486 0.00236
NP_441543.1_2 Reverse -354 -363 16.9127 0.00359
NP_441543.1_2 Reverse -90 -99 5.89959 0.169
NP_442845.1_2 Forward -368 -354 12.1926 0.114
NP_441918.1_7 Forward -356 -337 -3.24547 0.297
NP_441469.1_8 Reverse -352 -361 16.126 0.00797
NP_441469.1_8 Forward -363 -354 6.48957 0.227
NP_443064.1_6 Reverse -353 -363 12.5669 0.0796
NP_443064.1_6 Reverse -389 -399 10.8217 0.13
NP_442578.1_7 Forward -361 -354 14.5921 0.026
NP_442578.1_7 Reverse -354 -361 14.5921 0.026
NP_440220.1_4 Forward -234 -215 1.86696 0.236
NP_441462.1_2 Forward -362 -352 11.5831 0.00406
NP_441462.1_2 Reverse -353 -363 11.5831 0.00406
NP_441621.1_7 Forward -364 -350 -3.34366 0.188
NP_441621.1_7 Reverse -351 -365 -3.34366 0.188
NP_443062.1_1 Reverse -353 -371 3.37804 0.3
NP_443062.1_6 Forward -106 -87 3.93269 0.225
NP_443062.1_6 Forward -370 -351 3.73603 0.229
NP_443062.1_6 Reverse -345 -364 1.96607 0.264
NP_441601.1_4 Reverse -216 -235 -5.99873 0.295
NP_441601.1_7 Reverse -225 -244 8.45592 0.269
NP_442204.1_5 Reverse -343 -362 6.68596 0.142
NP_441560.1_10 Reverse -345 -364 5.70265 0.292
NP_440516.1_2 Reverse -347 -365 1.88744 0.184
NP_440516.1_8 Forward -362 -353 16.9127 0.00442
NP_440516.1_8 Reverse -353 -362 16.9127 0.00442
NP_442428.1_5 Forward -361 -354 15.8704 0.0124
NP_442428.1_5 Reverse -354 -361 15.8704 0.0124
NP_442120.1_10 Reverse -162 -181 -7.76869 0.222
NP_440673.1_3 Forward -360 -353 12.4288 0.0426
NP_440673.1_3 Reverse -355 -362 12.4288 0.0426
NP_441714.1_3 Forward -369 -351 14.768 0.169
NP_441714.1_3 Forward -270 -252 13.9813 0.202
NP_441052.1_2 Reverse -353 -363 19.9412 0.00106
NP_441052.1_2 Forward -362 -352 10.5014 0.0285
NP_442219.1_9 Reverse -354 -363 17.7976 0.00718
NP_442219.1_9 Forward -361 -352 8.35786 0.0681
NP_440436.1_4 Forward -361 -352 18.1905 0.00233
NP_440436.1_4 Reverse -354 -363 17.2072 0.00233
NP_440436.1_4 Reverse -90 -99 4.32588 0.272
NP_440436.1_4 Forward -97 -88 4.12922 0.288
NP_441884.1_9 Reverse -350 -369 -14.4552 0.138
NP_442864.1_2 Forward -265 -246 10.3242 0.272
NP_440314.1_9 Reverse -354 -373 -0.885524 0.117
NP_441086.1_3 Forward -345 -326 14.1136 0.114
NP_441719.1_4 Forward -361 -354 16.3621 0.0124
NP_441719.1_4 Reverse -354 -361 16.3621 0.0124
NP_441733.1_10 Forward -365 -352 19.6855 0.0151
NP_441004.1_1 Reverse -218 -237 -7.86702 0.2
NP_441004.1_1 Reverse -341 -360 -18.0934 0.297
NP_441004.1_3 Forward -352 -333 4.22769 0.235
NP_442366.1_3 Forward -363 -345 7.78729 0.0724
NP_442366.1_3 Reverse -88 -106 -4.20908 0.266
NP_442366.1_5 Reverse -350 -360 12.7626 0.108
NP_441115.1_4 Reverse -352 -370 11.7197 0.129
NP_441115.1_4 Forward -363 -345 7.68819 0.278
NP_442694.1_9 Reverse -200 -219 8.16093 0.277
NP_440094.1_9 Forward -178 -159 -5.31042 0.293
NP_443054.1_2 Forward -364 -350 11.3077 0.0761
NP_443054.1_2 Forward -81 -67 3.8345 0.24
NP_443054.1_2 Reverse -351 -365 3.34284 0.24
NP_441851.1_9 Forward -230 -211 8.65258 0.261
NP_441851.1_10 Reverse -352 -362 16.008 0.00552
NP_441851.1_10 Forward -363 -353 15.8113 0.00552
NP_441668.1_4 Reverse -126 -145 11.9958 0.0819
NP_441668.1_4 Reverse -208 -227 4.03102 0.183
NP_442515.1_1 Reverse -352 -366 4.52282 0.107
NP_441982.1_6 Reverse -252 -261 10.48 0.296
NP_440463.1_8 Reverse -69 -88 7.59671 0.264
NP_441046.1_2 Forward -373 -354 10.2259 0.212
NP_441046.1_2 Forward -247 -228 2.55606 0.24
NP_442689.1_8 Forward -343 -326 -6.15601 0.28
NP_441349.1_10 Reverse -343 -362 -5.80207 0.212
NP_441409.1_6 Forward -368 -349 -15.4385 0.295
NP_440432.1_9 Reverse -354 -369 -2.67504 0.175
NP_442843.1_1 Forward -319 -300 -11.8986 0.295
NP_440474.1_8 Reverse -354 -368 6.29216 0.228
NP_440431.1_5 Forward -192 -173 6.58763 0.299
NP_442450.1_5 Reverse -351 -361 7.55152 0.13
NP_440588.1_2 Reverse -344 -363 -0.590531 0.151
NP_440483.1_4 Forward -100 -81 2.26107 0.288
NP_442243.1_1 Reverse -311 -329 -1.9482 0.283
NP_442038.1_1 Reverse -276 -295 6.29264 0.192
NP_441078.1_4 Forward -362 -353 19.6659 0.0007
NP_441078.1_4 Reverse -353 -362 19.6659 0.0007
NP_441078.1_4 Reverse -89 -98 -1.47524 0.266
NP_442729.1_8 Forward -366 -353 10.049 0.125
NP_440526.1_3 Reverse -354 -365 20.0193 0.0113
NP_440526.1_3 Forward -361 -350 2.02482 0.267
NP_441432.1_8 Forward -363 -354 16.8143 0.00595
NP_441432.1_8 Reverse -352 -361 8.25953 0.0755
NP_441432.1_8 Reverse -223 -232 2.75299 0.287
NP_442320.1_8 Forward -368 -354 6.88276 0.0227
NP_442320.1_8 Reverse -347 -361 -1.67204 0.0821
NP_441732.1_2 Reverse -349 -365 2.91013 0.0145
NP_442003.1_4 Forward -361 -342 12.0942 0.272
NP_440760.1_1 Reverse -353 -372 -13.7669 0.112
NP_440760.1_1 Forward -362 -343 -23.01 0.278
NP_440131.1_2 Reverse -211 -230 8.94757 0.279
NP_440199.1_10 Forward -365 -355 7.35486 0.231
NP_441328.2_8 Reverse -351 -370 16.0265 0.268
NP_442353.1_4 Reverse -347 -366 9.04509 0.141
NP_442353.1_4 Forward -262 -243 -0.492971 0.29
NP_442751.1_2 Forward -243 -224 3.44025 0.266
NP_440713.1_4 Reverse -379 -398 3.44104 0.244
NP_442489.1_7 Forward -362 -353 20.1576 0.000695
NP_442489.1_7 Reverse -353 -362 20.1576 0.000695
NP_442489.1_7 Reverse -168 -177 -1.57357 0.213
NP_442489.1_7 Forward -177 -168 -1.6719 0.235
NP_440559.1_1 Reverse -354 -363 17.4043 0.00658
NP_440559.1_1 Forward -361 -352 8.75118 0.0586
NP_441659.2_8 Reverse -353 -363 18.1713 0.00133
NP_441659.2_8 Forward -362 -352 11.9764 0.0147
NP_441659.2_8 Reverse -89 -99 3.02829 0.177
NP_442913.1_10 Reverse -344 -363 -0.0988766 0.157
NP_442346.1_5 Forward -363 -353 16.6963 0.00248
NP_442346.1_5 Reverse -352 -362 9.02648 0.118
NP_442346.1_5 Forward -112 -102 6.96153 0.187
NP_440352.1_5 Forward -216 -197 11.4877 0.257
NP_441856.1_3 Reverse -350 -369 0.196116 0.216
NP_440831.1_5 Reverse -232 -251 16.0787 0.299
NP_440459.1_2 Forward -235 -218 7.90532 0.276
NP_440459.1_2 Reverse -344 -361 7.80699 0.278
NP_440010.1_4 Forward -249 -230 -0.591301 0.26
NP_440010.1_4 Reverse -336 -355 -2.45958 0.284
NP_440010.1_10 Forward -238 -219 11.9958 0.192
NP_440847.1_3 Forward -264 -250 13.9619 0.207
NP_442603.1_7 Reverse -353 -367 9.34041 0.149
NP_441888.1_7 Reverse -348 -362 2.45787 0.225
NP_441948.1_4 Reverse -346 -364 0.21581 0.136
NP_441047.1_1 Forward -234 -215 4.916 0.189
NP_441047.1_2 Reverse -218 -237 -3.63879 0.298
NP_441833.1_4 Forward -361 -354 15.9687 0.0124
NP_441833.1_4 Reverse -354 -361 15.9687 0.0124
NP_442162.1_9 Forward -361 -354 16.2637 0.0124
NP_442162.1_9 Reverse -354 -361 16.2637 0.0124
NP_440671.1_4 Reverse -347 -361 7.66941 0.21
NP_440671.1_4 Reverse -156 -170 6.88276 0.233
NP_442943.1_1 Forward -309 -294 3.39273 0.276
NP_442140.1_3 Forward -361 -351 16.2046 0.0255
NP_442140.1_3 Reverse -354 -364 13.5497 0.0542
NP_441609.1_1 Reverse -129 -148 7.17762 0.17
NP_440951.1_5 Forward -152 -134 24.2086 0.0246
NP_440875.1_9 Reverse -355 -365 8.66404 0.233
NP_440875.1_9 Forward -360 -350 8.46937 0.233
NP_441813.1_5 Reverse -351 -361 9.91146 0.021
NP_441813.1_5 Forward -364 -354 8.73149 0.0367
NP_440590.1_4 Forward -361 -348 21.8488 0.00377
NP_440590.1_4 Reverse -354 -367 13.294 0.013
NP_440590.1_4 Reverse -224 -237 2.77255 0.0813
NP_440590.1_4 Forward -241 -228 -4.60227 0.263
NP_440567.1_1 Reverse -354 -368 9.43936 0.0442
NP_442497.1_10 Forward -361 -352 10.4228 0.0087
NP_442497.1_10 Reverse -354 -363 10.4228 0.0087
NP_440821.1_4 Forward -364 -354 17.9746 0.00497
NP_440821.1_4 Reverse -351 -361 10.2065 0.0163
NP_441239.1_9 Reverse -351 -363 12.3303 0.0477
NP_441239.1_9 Forward -364 -352 9.67541 0.0987
NP_440156.1_4 Reverse -303 -313 14.2375 0.176
NP_440706.1_1 Forward -366 -347 6.39097 0.0818
NP_442044.1_1 Reverse -218 -237 -13.5702 0.277
NP_442270.1_9 Reverse -342 -361 9.3409 0.0824
NP_442629.1_1 Forward -355 -341 19.6658 0.251
NP_440354.1_7 Reverse -241 -259 9.0656 0.231
NP_441617.1_6 Reverse -114 -133 -3.24547 0.265
NP_440546.1_4 Forward -362 -352 11.8882 0.0679
NP_440546.1_4 Reverse -353 -363 10.046 0.109
NP_440546.1_10 Reverse -236 -255 21.828 0.089
NP_442041.1_5 Forward -232 -213 -0.688862 0.278
NP_440462.1_6 Forward -364 -354 10.3048 0.0396
NP_440462.1_6 Reverse -351 -361 9.02648 0.0498
NP_442340.1_3 Forward -243 -224 -4.52377 0.217
NP_442340.1_3 Reverse -220 -239 -6.1954 0.223
NP_440868.1_4 Forward -366 -354 9.47875 0.0482
NP_440868.1_4 Reverse -349 -361 1.7106 0.174
NP_441582.1_5 Forward -364 -345 7.96345 0.164
NP_440341.1_7 Reverse -114 -128 11.5043 0.244
NP_441848.1_4 Reverse -316 -332 9.65149 0.275
NP_441848.1_4 Reverse -328 -344 7.07321 0.297
NP_441084.1_6 Forward -113 -99 14.5798 0.0972
NP_442358.1_1 Forward -250 -232 14.2771 0.246
NP_442039.1_4 Forward -361 -354 15.1821 0.0124
NP_442039.1_4 Reverse -354 -361 15.1821 0.0124
NP_440825.1_7 Forward -361 -351 12.4217 0.155
NP_442837.1_3 Forward -361 -354 15.7721 0.0124
NP_442837.1_3 Reverse -354 -361 15.7721 0.0124
NP_440160.1_9 Reverse -217 -236 10.5209 0.231
NP_439994.1_3 Reverse -352 -371 14.877 0.101
NP_442053.1_1 Forward -362 -353 18.3876 0.0007
NP_442053.1_1 Reverse -353 -362 18.3876 0.0007
NP_440505.1_3 Forward -364 -354 16.598 0.00683
NP_440505.1_3 Reverse -351 -361 6.76487 0.169
NP_440505.1_3 Reverse -166 -176 6.07655 0.197
NP_440505.1_3 Forward -100 -90 5.09324 0.246
NP_441252.1_6 Reverse -133 -140 14.3954 0.168
NP_440914.1_1 Reverse -353 -363 17.5935 0.000537
NP_440914.1_1 Forward -256 -246 11.3477 0.097
NP_440914.1_1 Forward -362 -352 8.6151 0.186
NP_441011.1_8 Forward -361 -352 16.9127 0.00602
NP_441011.1_8 Reverse -354 -363 8.25953 0.144
NP_442533.1_6 Forward -362 -353 17.2076 0.00137
NP_442533.1_6 Reverse -353 -362 17.2076 0.00137
NP_442533.1_6 Forward -232 -223 3.24465 0.219
NP_442533.1_6 Forward -197 -188 3.24465 0.219
NP_442533.1_6 Reverse -136 -145 1.37636 0.3
NP_442229.1_1 Forward -364 -350 18.4851 0.0734
NP_442535.1_9 Reverse -344 -362 -3.12744 0.262
NP_441219.1_1 Reverse -215 -234 -3.04881 0.281
NP_441482.1_7 Reverse -347 -361 -8.35854 0.193
NP_439944.1_9 Reverse -354 -364 19.1546 0.00329
NP_439944.1_9 Reverse -90 -100 14.3364 0.0419
NP_442202.1_10 Reverse -222 -236 3.63784 0.278
NP_440116.1_8 Forward -361 -342 2.16274 0.0891
NP_441527.1_4 Forward -311 -292 -13.0351 0.298
NP_440115.1_6 Forward -365 -355 9.81313 0.115
NP_441972.1_5 Reverse -354 -373 -8.85033 0.272
NP_441106.1_1 Reverse -352 -361 18.191 0.0028
NP_441106.1_1 Forward -363 -354 9.63616 0.0311
NP_439903.1_6 Forward -335 -316 9.24175 0.124
NP_441286.1_1 Reverse -352 -364 12.1337 0.0104
NP_441286.1_1 Forward -363 -351 6.03717 0.0258
NP_440670.1_8 Forward -362 -353 18.3876 0.000699
NP_440670.1_8 Reverse -353 -362 18.3876 0.000699
NP_441930.1_3 Reverse -34 -53 4.69487 0.266
NP_440886.1_7 Reverse -352 -362 17.7774 0.0011
NP_440886.1_7 Forward -363 -353 7.94438 0.0805
NP_440886.1_7 Reverse -88 -98 4.50281 0.232
NP_440886.1_7 Reverse -232 -242 4.30615 0.243
NP_442614.1_2 Reverse -353 -367 14.4542 0.0984
NP_439995.1_5 Forward -372 -353 3.83436 0.291
NP_442072.1_9 Reverse -352 -370 -10.6989 0.0789
NP_442072.1_9 Forward -363 -345 -15.2222 0.174
NP_440907.2_8 Forward -361 -351 14.2375 0.0312
NP_440907.2_8 Reverse -354 -364 10.8943 0.0969
NP_441021.1_1 Reverse -354 -373 -5.9004 0.177
NP_441021.1_8 Reverse -348 -366 2.77242 0.239
NP_441463.1_3 Reverse -158 -177 -2.0655 0.149
NP_441626.1_2 Forward -361 -354 15.7721 0.0124
NP_441626.1_2 Reverse -354 -361 15.7721 0.0124
NP_442211.1_3 Forward -238 -219 9.22274 0.257
NP_442912.1_5 Reverse -251 -270 13.9625 0.279
NP_442365.1_7 Forward -230 -211 -5.31042 0.265
NP_442794.1_1 Reverse -349 -361 2.89058 0.286
NP_442615.1_1 Reverse -344 -362 10.7372 0.0199
NP_442615.1_1 Forward -371 -353 1.39578 0.0853
NP_441962.1_4 Reverse -219 -238 -7.86702 0.195
NP_441962.1_4 Forward -367 -348 -9.73531 0.22
NP_441962.1_4 Reverse -348 -367 -10.1286 0.224
NP_441962.1_4 Forward -232 -213 -13.6686 0.277
NP_440387.1_1 Forward -362 -346 6.25339 0.0282
NP_440387.1_1 Reverse -353 -369 -3.38305 0.158
NP_440387.1_1 Reverse -168 -184 -6.62797 0.298
NP_441431.1_2 Reverse -350 -364 11.2087 0.145
NP_441431.1_2 Forward -365 -351 9.43874 0.186
NP_441836.1_2 Reverse -241 -260 -3.04881 0.233
NP_440634.1_1 Forward -364 -345 12.9791 0.26
NP_442084.1_6 Reverse -308 -326 7.59063 0.221
NP_441174.1_2 Forward -245 -231 13.8643 0.185
NP_440114.1_10 Reverse -353 -367 7.27608 0.239
NP_440293.1_3 Reverse -216 -235 -5.21209 0.274
NP_440766.1_4 Forward -366 -352 7.86607 0.0871
NP_440766.1_4 Reverse -219 -233 3.24451 0.151
NP_440766.1_5 Reverse -278 -290 6.50989 0.299
NP_439988.1_3 Reverse -219 -233 3.93283 0.298
NP_441237.1_9 Reverse -354 -364 14.9263 0.0242
NP_442930.1_1 Forward -333 -323 11.4843 0.258
NP_439910.1_2 Forward -370 -353 -3.20608 0.0362
NP_439910.1_2 Reverse -345 -362 -13.4325 0.162
NP_440457.1_1 Reverse -219 -231 5.15219 0.145
NP_442297.1_4 Reverse -349 -368 12.4324 0.274
NP_442509.1_9 Forward -362 -352 16.2041 0.00739
NP_442509.1_9 Reverse -353 -363 8.14104 0.192
NP_440554.1_4 Forward -361 -351 7.35486 0.103
NP_440554.1_4 Reverse -354 -364 6.37155 0.123
NP_441885.1_5 Reverse -353 -363 20.9245 0.000538
NP_441885.1_5 Forward -362 -352 11.4848 0.00668
NP_441885.1_5 Reverse -89 -99 0.373358 0.164
NP_442341.1_7 Forward -363 -349 19.7641 0.00702
NP_442341.1_7 Reverse -352 -366 16.6175 0.0172
NP_442341.1_7 Forward -124 -110 1.67122 0.282
NP_442341.1_9 Reverse -351 -365 7.3738 0.2
NP_442341.1_9 Reverse -215 -229 4.71887 0.294
NP_441173.1_9 Reverse -332 -340 10.6388 0.261
NP_441173.1_9 Reverse -118 -126 10.2454 0.261
NP_443000.1_7 Forward -364 -354 10.4031 0.0345
NP_443000.1_7 Reverse -351 -361 1.94665 0.226
NP_443000.1_7 Reverse -387 -397 1.65166 0.235
NP_441842.1_1 Reverse -355 -368 11.5234 0.252
NP_440275.1_3 Forward -364 -354 17.6796 0.0102
NP_440275.1_3 Reverse -351 -361 8.33817 0.0602
NP_440091.1_1 Forward -366 -354 10.7571 0.0429
NP_440091.1_1 Reverse -349 -361 3.18557 0.166
NP_443010.1_10 Reverse -350 -367 14.1736 0.0612
NP_442451.1_2 Reverse -345 -364 -9.73531 0.259
NP_439962.1_4 Reverse -228 -247 -6.68705 0.283
NP_441105.1_3 Reverse -103 -122 -8.55534 0.274
NP_441105.1_3 Reverse -157 -176 -9.93197 0.298
NP_440216.1_1 Forward -362 -348 -1.37704 0.0312
NP_440216.1_1 Reverse -353 -367 -9.63684 0.145
NP_440216.1_1 Forward -98 -84 -11.2101 0.169
NP_440216.1_9 Forward -209 -200 15.536 0.128
NP_440216.1_9 Forward -318 -309 5.89959 0.289
NP_440172.1_1 Reverse -353 -363 15.0247 0.00945
NP_440172.1_1 Forward -362 -352 8.73149 0.0586
NP_440172.1_1 Reverse -168 -178 1.84832 0.294
NP_440172.1_1 Reverse -136 -146 1.74999 0.299
NP_442015.1_10 Reverse -349 -362 11.6223 0.0372
NP_442015.1_10 Reverse -219 -232 0.412608 0.227
NP_441226.1_7 Forward -361 -354 14.4934 0.0123
NP_441226.1_7 Reverse -354 -361 14.4934 0.0123
NP_441111.1_7 Forward -361 -353 18.7023 0.00294
NP_441111.1_7 Reverse -354 -362 18.7023 0.00294
NP_441766.1_2 Forward -362 -353 17.5026 0.00297
NP_441766.1_2 Reverse -353 -362 17.5026 0.00297
NP_440416.1_9 Reverse -216 -235 -6.58872 0.0913
NP_443052.1_8 Forward -252 -233 -11.0136 0.221
NP_443052.1_9 Forward -237 -218 0.294447 0.2
NP_441135.1_4 Reverse -346 -365 2.85105 0.284
NP_440261.1_5 Reverse -354 -367 6.50913 0.0332
NP_440261.1_5 Forward -361 -348 -12.2721 0.277
NP_440988.1_10 Reverse -216 -230 7.80321 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGCTGAACGCTTTGGATATTAACTCTGAAAATTTAGTGGCGATCGCCGATGATCAAGGCTTTGTTAAAATTATTTCCTTAACCACGGGAAAAATCGTCGAAGAACATAAAATTTCTACTACAGGTATTAACGCTGTCATTTTCACCGATGACCAGACAGTGGTTGCCGCCGATGCCACTGGCATGATTTACCAAGGAAAATTGGCCGGCTCCAATTAGGTAAGGCAACTGCCGTCTCAATGTGCAATGCGGTCTAGTGCTTGCCCAAAATTATTTTGGGAAACTCCCAAGCCATGATTAATGACGATAGCTGGCCAAGAAGGGAAACCTCCCTCCGTTATGATTTAGAATTCTTAGGTAACTTTTATGTATCTGTTGCTGAGAAAGGAGTGTGTAACCA

CDS

GTGGCTAAGTATGTGCTTTGGGGAACCTATTGTGACAACGTGGAAGAAAAAAGAGCCCCCCACCGTCAAGCACACCTAGATGGACTGAAGGTCCAAAAGGAAAGTGGTGTGTTGGTTACCATTGGACCTACCAAAGATTTACGGCAGGTTTTTGCAATTTACGACGCGCCAGACCAGGACACGGTGGAAAAGTTGGTGCAAGGAGATCCTTACTGGCAAAACGGCATCTGGACAGAGTATGAAGTCAAAGAGTGGATTCAGGCTTTTTAA

Protein

MAKYVLWGTYCDNVEEKRAPHRQAHLDGLKVQKESGVLVTIGPTKDLRQVFAIYDAPDQDTVEKLVQGDPYWQNGIWTEYEVKEWIQAF