Your browser is old and dusty. Try Google Chrome!

Details for ssl2559

ORF ssl2559
Accession NP_440517.1
Symbol
Category Soluble electron carriers
Definition ferredoxin
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -82 -68 1.27789 0.192
NP_441061.1_2 Reverse -15 -29 -1.37704 0.258
NP_440557.1_1 Forward -107 -88 -1.67217 0.276
NP_440795.1_7 Forward -22 -15 14.6904 0.0123
NP_440795.1_7 Reverse -15 -22 14.6904 0.0123
NP_441418.1_6 Reverse -14 -33 -20.2567 0.108
NP_441418.1_6 Forward -23 -4 -20.3551 0.111
NP_441418.1_6 Forward -83 -64 -22.715 0.184
NP_441418.1_6 Forward -223 -204 -30.2865 0.267
NP_442291.1_5 Forward -24 -8 8.22001 0.0565
NP_440897.1_6 Forward -23 -4 -0.689632 0.185
NP_441453.1_4 Reverse -14 -22 16.539 0.00633
NP_441453.1_4 Forward -23 -15 16.539 0.00633
NP_442877.1_3 Forward -248 -229 11.6017 0.227
NP_441960.1_4 Forward -140 -124 14.2175 0.241
NP_441818.1_1 Forward -236 -225 12.4478 0.125
NP_441630.1_3 Forward -254 -235 -0.197208 0.285
NP_440150.1_6 Reverse -11 -30 4.32602 0.245
NP_442173.1_1 Forward -22 -14 15.4574 0.00633
NP_442173.1_1 Reverse -15 -23 15.4574 0.00633
NP_442752.1_4 Forward -23 -16 13.8055 0.0199
NP_442752.1_4 Reverse -14 -21 13.8055 0.0199
NP_442752.1_4 Reverse -288 -295 7.90559 0.144
NP_442752.1_4 Reverse -81 -88 5.54565 0.194
NP_443027.1_4 Reverse -226 -236 7.45319 0.24
NP_443027.1_4 Forward -25 -15 5.87989 0.294
NP_443027.1_4 Reverse -12 -22 5.87989 0.294
NP_441745.1_3 Reverse -360 -379 13.3716 0.282
NP_441812.1_8 Forward -262 -243 19.4742 0.192
NP_442975.1_10 Reverse -10 -24 2.45727 0.274
NP_442975.1_10 Forward -27 -13 2.35894 0.276
NP_440784.1_7 Forward -22 -15 15.9687 0.0123
NP_440784.1_7 Reverse -15 -22 15.9687 0.0123
NP_442909.1_7 Forward -22 -8 9.73373 0.14
NP_442861.1_1 Forward -156 -137 12.7825 0.26
NP_442861.1_1 Reverse -136 -155 9.93088 0.295
NP_441054.1_2 Reverse -123 -142 17.3057 0.109
NP_441054.1_2 Reverse -174 -193 12.5858 0.229
NP_441054.1_2 Reverse -229 -248 10.1275 0.284
NP_442062.1_8 Forward -23 -13 19.4496 0.000558
NP_442062.1_8 Reverse -14 -24 19.4496 0.000558
NP_442974.1_8 Reverse -360 -379 17.8948 0.294
NP_441859.1_3 Forward -126 -107 4.03023 0.228
NP_442972.1_2 Reverse -344 -358 11.2087 0.288
NP_440304.1_4 Forward -25 -15 1.84832 0.299
NP_440304.1_4 Reverse -12 -22 1.84832 0.299
NP_442242.1_4 Forward -22 -15 14.3954 0.0124
NP_442242.1_4 Reverse -15 -22 14.3954 0.0124
NP_440044.1_8 Forward -22 -3 1.86774 0.161
NP_440044.1_8 Reverse -15 -34 -3.83545 0.292
NP_442602.1_3 Forward -256 -237 3.24438 0.163
NP_440365.1_4 Reverse -250 -269 9.0459 0.221
NP_442196.1_10 Forward -225 -206 11.5042 0.224
NP_442375.1_5 Forward -381 -367 12.192 0.289
NP_441083.1_5 Forward -23 -13 11.3864 0.0159
NP_441083.1_5 Reverse -14 -24 11.3864 0.0159
NP_442827.1_8 Forward -239 -220 -1.57461 0.249
NP_441434.1_3 Forward -250 -231 0.0977854 0.222
NP_441434.1_7 Forward -21 -7 5.89945 0.225
NP_441738.1_2 Forward -21 -14 15.28 0.0102
NP_441738.1_2 Reverse -16 -23 15.28 0.0102
NP_441738.1_2 Forward -244 -237 8.29857 0.176
NP_440209.1_1 Reverse -14 -22 18.1123 0.00295
NP_440209.1_1 Forward -23 -15 18.1123 0.00295
NP_440209.1_1 Forward -237 -229 2.08437 0.286
NP_442889.1_1 Reverse -116 -135 -15.4385 0.292
NP_442889.1_8 Reverse -78 -92 4.91554 0.247
NP_442889.1_8 Forward -26 -12 3.63724 0.273
NP_442889.1_8 Reverse -11 -25 3.63724 0.273
NP_440447.1_6 Forward -216 -198 1.69077 0.261
NP_441713.1_1 Forward -29 -10 -4.03212 0.113
NP_441716.1_1 Forward -23 -9 4.32615 0.256
NP_442111.1_4 Forward -24 -10 6.48943 0.123
NP_441163.1_1 Reverse -6 -23 15.2794 0.174
NP_441163.1_1 Forward -31 -14 5.74131 0.27
NP_440906.1_5 Forward -22 -15 15.8704 0.0124
NP_440906.1_5 Reverse -15 -22 15.8704 0.0124
NP_440747.1_10 Reverse -11 -23 5.44718 0.0137
NP_440747.1_10 Forward -26 -14 5.44718 0.0137
NP_441486.1_1 Reverse -11 -25 21.5341 0.00239
NP_441486.1_1 Forward -26 -12 21.5341 0.00239
NP_442634.1_2 Forward -303 -284 -0.885524 0.298
NP_440403.1_4 Reverse -5 -24 -9.14533 0.269
NP_441014.1_10 Forward -105 -86 0.883656 0.236
NP_442848.1_1 Reverse -8 -22 6.48943 0.0791
NP_443018.1_3 Forward -22 -15 14.8871 0.0123
NP_443018.1_3 Reverse -15 -22 14.8871 0.0123
NP_443018.1_3 Reverse -229 -236 11.5438 0.0752
NP_443018.1_3 Reverse -223 -230 8.8889 0.136
NP_443018.1_3 Reverse -49 -56 8.39725 0.147
NP_443018.1_3 Forward -82 -75 7.6106 0.156
NP_441634.1_8 Reverse -226 -240 -0.295402 0.252
NP_441634.1_8 Forward -25 -11 -3.63866 0.295
NP_441634.1_8 Reverse -12 -26 -3.63866 0.295
NP_440376.1_1 Forward -23 -14 19.4693 0.000692
NP_440376.1_1 Reverse -14 -23 19.4693 0.000692
NP_440376.1_1 Reverse -123 -132 0.884706 0.259
NP_441588.1_4 Forward -21 -11 7.25653 0.178
NP_441588.1_4 Reverse -16 -26 7.25653 0.178
NP_441588.1_4 Forward -130 -120 7.05986 0.178
NP_442687.1_7 Forward -24 -14 15.8113 0.0125
NP_442687.1_7 Reverse -13 -23 15.8113 0.0125
NP_442687.1_7 Forward -224 -214 10.4031 0.0994
NP_442485.1_3 Reverse -12 -31 -2.55715 0.262
NP_442485.1_3 Reverse -203 -222 -6.09707 0.299
NP_442530.1_2 Reverse -139 -149 17.2863 0.178
NP_440042.1_2 Reverse -212 -231 4.12936 0.191
NP_441422.1_7 Forward -25 -8 -5.46769 0.247
NP_442296.1_5 Forward -306 -287 -0.000545616 0.293
NP_442658.1_1 Reverse -12 -22 15.9091 0.00966
NP_442658.1_1 Forward -25 -15 15.9091 0.00966
NP_441855.2_4 Reverse -6 -25 9.81228 0.275
NP_442782.1_2 Reverse -208 -222 6.78443 0.218
NP_442782.1_2 Reverse -179 -193 2.5562 0.275
NP_442205.1_1 Forward -154 -135 12.7816 0.295
NP_442205.1_2 Reverse -12 -31 18.0247 0.14
NP_441414.1_9 Forward -23 -4 -3.04881 0.128
NP_441414.1_9 Reverse -14 -33 -3.83545 0.143
NP_440720.1_1 Forward -68 -49 7.17762 0.195
NP_441256.1_1 Forward -240 -221 -9.047 0.271
NP_439959.1_5 Reverse -220 -239 16.3224 0.189
NP_441958.1_5 Forward -24 -14 12.2714 0.00183
NP_441958.1_5 Reverse -13 -23 12.2714 0.00183
NP_442605.1_4 Reverse -122 -141 8.35759 0.299
NP_440203.1_5 Reverse -360 -370 13.6475 0.112
NP_442816.1_5 Reverse -288 -307 11.9958 0.2
NP_440984.1_7 Forward -28 -14 11.6026 0.122
NP_442690.1_1 Forward -152 -133 -12.7836 0.249
NP_442911.1_2 Forward -33 -14 -4.52377 0.136
NP_440153.1_5 Forward -22 -8 10.6193 0.0951
NP_440602.1_2 Reverse -159 -178 6.29264 0.254
NP_442002.1_9 Forward -24 -17 10.7572 0.185
NP_442002.1_9 Reverse -13 -20 10.7572 0.185
NP_441294.1_7 Reverse -10 -24 12.9942 0.0767
NP_442438.1_10 Reverse -9 -23 5.21113 0.137
NP_441398.1_9 Reverse -358 -377 12.88 0.288
NP_441000.1_6 Forward -24 -10 12.9793 0.0396
NP_441000.1_6 Reverse -13 -27 4.22782 0.0964
NP_440147.1_4 Forward -25 -12 11.4257 0.0326
NP_440147.1_4 Reverse -12 -25 11.4257 0.0326
NP_441550.1_8 Reverse -12 -22 8.3377 0.124
NP_441550.1_8 Forward -25 -15 8.3377 0.124
NP_441550.1_8 Reverse -220 -230 5.38779 0.252
NP_441916.1_7 Forward -23 -13 18.4663 0.00144
NP_441916.1_7 Reverse -14 -24 18.4663 0.00144
NP_440465.1_10 Reverse -11 -30 10.0292 0.173
NP_441041.1_4 Reverse -222 -241 -1.7705 0.103
NP_441041.1_7 Forward -249 -237 10.2357 0.1
NP_441041.1_7 Forward -26 -14 9.65268 0.108
NP_441041.1_7 Reverse -11 -23 9.65268 0.108
NP_442396.1_5 Forward -27 -14 9.45906 0.129
NP_442396.1_5 Reverse -10 -23 8.47575 0.153
NP_441725.1_5 Forward -22 -12 2.04498 0.115
NP_441725.1_5 Reverse -15 -25 2.04498 0.115
NP_439966.1_7 Forward -239 -229 12.7626 0.0365
NP_439966.1_7 Reverse -12 -22 9.91099 0.0968
NP_439966.1_7 Forward -25 -15 9.91099 0.0968
NP_439966.1_9 Forward -25 -16 0.884706 0.253
NP_439966.1_9 Reverse -12 -21 0.884706 0.253
NP_442941.1_3 Forward -22 -12 2.63497 0.14
NP_442941.1_3 Reverse -15 -25 2.63497 0.14
NP_440289.1_2 Forward -26 -13 -3.52063 0.267
NP_440289.1_2 Reverse -11 -24 -3.52063 0.267
NP_440983.1_2 Forward -37 -18 15.6341 0.0895
NP_442281.1_1 Forward -28 -14 11.897 0.0428
NP_442281.1_1 Reverse -9 -23 4.52221 0.192
NP_442012.1_1 Forward -29 -10 11.9958 0.0721
NP_442012.1_1 Reverse -8 -27 7.57094 0.11
NP_440498.1_1 Forward -32 -14 -2.53746 0.242
NP_441644.1_6 Forward -23 -13 10.1076 0.0628
NP_441644.1_6 Reverse -14 -24 10.1076 0.0628
NP_441644.1_6 Reverse -222 -232 6.76441 0.147
NP_443049.1_6 Reverse -80 -90 12.5193 0.24
NP_440867.1_10 Reverse -213 -232 5.80098 0.262
NP_441795.1_5 Reverse -174 -193 8.25926 0.245
NP_442215.1_2 Forward -25 -9 -2.30141 0.195
NP_442215.1_2 Reverse -12 -28 -2.49807 0.198
NP_442215.1_2 Forward -92 -76 -4.66135 0.237
NP_440929.1_8 Forward -23 -14 19.2726 0.000701
NP_440929.1_8 Reverse -14 -23 19.2726 0.000701
NP_442933.1_10 Forward -23 -14 17.601 0.00325
NP_442933.1_10 Reverse -14 -23 17.601 0.00325
NP_442554.1_8 Forward -22 -12 13.2547 0.0187
NP_442554.1_8 Reverse -15 -25 13.2547 0.0187
NP_442554.1_8 Reverse -124 -134 3.22496 0.235
NP_442075.1_5 Forward -384 -365 15.6917 0.296
NP_441762.1_7 Forward -24 -12 19.3118 0.00342
NP_441762.1_7 Reverse -13 -25 19.3118 0.00342
NP_442142.1_4 Forward -26 -13 7.2952 0.143
NP_442142.1_4 Reverse -11 -24 7.2952 0.143
NP_442142.1_4 Forward -86 -73 5.52525 0.188
NP_442142.1_4 Forward -163 -150 4.34528 0.223
NP_442292.1_1 Forward -22 -13 9.63616 0.0183
NP_442292.1_1 Reverse -15 -24 9.63616 0.0183
NP_442292.1_1 Forward -236 -227 5.11294 0.162
NP_442476.1_6 Reverse -15 -29 14.0609 0.0401
NP_442476.1_6 Forward -22 -8 8.84938 0.0978
NP_442381.1_8 Reverse -211 -230 -6.49039 0.16
NP_443009.1_5 Reverse -13 -24 11.6612 0.0602
NP_443009.1_5 Forward -24 -13 11.6612 0.0602
NP_442301.1_2 Reverse -283 -302 3.34192 0.296
NP_441715.1_4 Reverse -15 -25 9.41981 0.097
NP_441715.1_4 Forward -22 -12 9.41981 0.097
NP_442305.1_6 Forward -179 -169 16.4008 0.202
NP_441468.1_1 Forward -22 -15 15.8704 0.0124
NP_441468.1_1 Reverse -15 -22 15.8704 0.0124
NP_441468.1_1 Reverse -229 -236 4.07068 0.263
NP_441020.2_6 Forward -25 -8 7.80699 0.218
NP_441673.1_1 Forward -23 -14 20.8459 0.000698
NP_441673.1_1 Reverse -14 -23 20.8459 0.000698
NP_441016.2_6 Forward -246 -227 11.5033 0.215
NP_441826.1_2 Reverse -8 -22 6.3911 0.0937
NP_441826.1_5 Forward -313 -294 8.75091 0.202
NP_442868.1_6 Forward -25 -15 0.865012 0.205
NP_442868.1_6 Reverse -12 -22 0.865012 0.205
NP_442719.1_2 Forward -148 -130 -4.11147 0.208
NP_443058.1_7 Forward -84 -65 9.63589 0.206
NP_443058.1_7 Reverse -221 -240 3.6377 0.26
NP_442808.1_1 Forward -24 -14 18.4657 0.00201
NP_442808.1_1 Reverse -13 -23 18.4657 0.00201
NP_442808.1_1 Forward -84 -74 7.55106 0.0756
NP_442808.1_1 Forward -238 -228 5.28945 0.162
NP_442808.1_1 Forward -379 -369 1.35624 0.287
NP_442775.1_6 Forward -82 -63 16.7157 0.236
NP_440145.1_3 Reverse -52 -71 2.94938 0.111
NP_440145.1_3 Reverse -113 -132 0.786102 0.133
NP_441906.1_2 Forward -169 -150 3.63691 0.286
NP_442542.1_2 Reverse -220 -233 13.1956 0.114
NP_442542.1_9 Reverse -221 -235 6.29216 0.243
NP_440038.1_8 Reverse -68 -87 17.5998 0.197
NP_440346.1_1 Forward -201 -182 12.3892 0.296
NP_440346.1_6 Reverse -207 -217 15.119 0.231
NP_441114.1_3 Forward -339 -330 7.37455 0.239
NP_440162.1_2 Reverse -363 -382 6.09597 0.282
NP_440111.2_2 Forward -242 -223 0.982764 0.201
NP_442789.1_4 Forward -264 -245 -7.96535 0.299
NP_440923.1_10 Forward -303 -284 11.4058 0.298
NP_441878.1_6 Forward -24 -14 10.4031 0.0176
NP_441878.1_6 Reverse -13 -23 10.4031 0.0176
NP_441878.1_6 Reverse -213 -223 -6.70647 0.194
NP_441036.1_8 Forward -24 -14 17.7779 0.000554
NP_441036.1_8 Reverse -13 -23 17.7779 0.000554
NP_441557.1_5 Forward -23 -14 19.9609 0.000699
NP_441557.1_5 Reverse -14 -23 19.9609 0.000699
NP_441445.1_1 Forward -216 -197 11.0125 0.0895
NP_442066.2_4 Forward -308 -289 -7.37537 0.28
NP_442962.1_5 Reverse -232 -251 5.40766 0.242
NP_442183.1_1 Reverse -14 -28 11.7993 0.0675
NP_441655.1_10 Forward -144 -126 5.82068 0.219
NP_440058.1_8 Forward -68 -49 21.3373 0.0391
NP_442347.1_2 Forward -22 -13 11.1111 0.056
NP_442347.1_2 Reverse -15 -24 11.1111 0.056
NP_442347.1_2 Forward -89 -80 8.65285 0.0792
NP_442645.1_2 Reverse -6 -25 -2.65548 0.0487
NP_442645.1_2 Forward -31 -12 -21.83 0.29
NP_441037.1_4 Reverse -12 -22 14.7245 0.028
NP_441037.1_4 Forward -25 -15 14.7245 0.028
NP_442594.1_8 Forward -283 -264 3.53937 0.28
NP_441633.1_3 Forward -25 -12 10.8357 0.0286
NP_441633.1_3 Reverse -12 -25 10.8357 0.0286
NP_440136.1_2 Forward -22 -15 15.9687 0.0123
NP_440136.1_2 Reverse -15 -22 15.9687 0.0123
NP_442998.1_5 Reverse -128 -138 13.8447 0.157
NP_442998.1_5 Forward -249 -239 12.7631 0.159
NP_442998.1_10 Forward -21 -14 15.5754 0.0102
NP_442998.1_10 Reverse -16 -23 15.5754 0.0102
NP_440899.1_8 Forward -148 -129 -11.0136 0.295
NP_440299.1_1 Reverse -10 -23 14.08 0.0259
NP_440299.1_1 Forward -27 -14 8.08184 0.098
NP_441799.1_1 Forward -27 -13 20.8451 0.00422
NP_441799.1_1 Reverse -10 -24 19.8618 0.00596
NP_442504.1_3 Reverse -381 -400 6.88262 0.254
NP_441007.1_10 Forward -28 -15 1.59258 0.203
NP_440256.1_1 Forward -26 -7 0.58944 0.0818
NP_440256.1_1 Forward -370 -351 -8.65367 0.264
NP_440256.1_1 Reverse -11 -30 -9.53865 0.281
NP_440087.1_1 Forward -32 -13 -9.44032 0.297
NP_441559.1_8 Reverse -9 -23 0.196253 0.169
NP_441559.1_8 Reverse -233 -247 -6.49025 0.279
NP_441559.1_8 Forward -28 -14 -7.08024 0.283
NP_441179.1_1 Forward -26 -7 1.57275 0.267
NP_441704.1_8 Forward -242 -223 11.405 0.141
NP_441464.1_8 Reverse -14 -28 5.21113 0.26
NP_441464.1_8 Forward -23 -9 4.52282 0.269
NP_442386.1_9 Reverse -13 -22 15.7322 0.0144
NP_442386.1_9 Forward -24 -15 15.7322 0.0144
NP_442386.1_9 Forward -238 -229 6.48915 0.219
NP_442386.1_9 Forward -133 -124 6.48915 0.219
NP_441340.1_5 Forward -22 -15 15.6737 0.0124
NP_441340.1_5 Reverse -15 -22 15.6737 0.0124
NP_441340.1_5 Forward -230 -223 4.07068 0.239
NP_441947.1_4 Reverse -3 -22 12.2908 0.234
NP_441947.1_4 Reverse -277 -296 10.1275 0.3
NP_442791.1_5 Reverse -6 -25 -0.000545616 0.21
NP_442791.1_5 Forward -31 -12 -9.83364 0.279
NP_440168.1_4 Reverse -203 -222 -7.17871 0.273
NP_440168.1_9 Forward -248 -229 -4.6221 0.296
NP_440586.1_8 Forward -22 -15 13.2151 0.026
NP_440586.1_8 Reverse -15 -22 13.2151 0.026
NP_440586.1_8 Reverse -229 -236 10.9535 0.119
NP_440586.1_8 Reverse -49 -56 7.21693 0.27
NP_442251.1_6 Forward -22 -15 15.2804 0.0124
NP_442251.1_6 Reverse -15 -22 15.2804 0.0124
NP_440684.1_9 Forward -29 -15 11.6026 0.173
NP_440684.1_9 Reverse -8 -22 8.65272 0.225
NP_441262.1_3 Reverse -14 -21 14.7888 0.0223
NP_441262.1_3 Forward -23 -16 14.7888 0.0223
NP_441262.1_3 Reverse -228 -235 5.34899 0.181
NP_443051.1_1 Reverse -13 -22 10.4228 0.00754
NP_443051.1_1 Forward -24 -15 10.4228 0.00754
NP_439984.1_3 Forward -139 -125 13.077 0.239
NP_439937.1_9 Reverse -13 -30 -8.22161 0.176
NP_439937.1_9 Forward -24 -7 -8.41828 0.176
NP_441657.1_5 Forward -371 -352 1.76941 0.178
NP_440439.1_1 Reverse -11 -24 10.8357 0.0339
NP_440439.1_1 Forward -26 -13 10.8357 0.0339
NP_439943.1_7 Forward -287 -268 5.80098 0.242
NP_440372.1_2 Forward -22 -15 16.3621 0.0124
NP_440372.1_2 Reverse -15 -22 16.3621 0.0124
NP_440372.1_2 Forward -230 -223 4.07068 0.262
NP_440316.1_10 Reverse -73 -83 14.238 0.199
NP_439977.1_5 Forward -243 -224 -0.0988766 0.217
NP_440139.1_1 Forward -229 -210 0.883656 0.279
NP_441572.1_7 Forward -29 -10 -2.36049 0.193
NP_442384.1_10 Forward -23 -10 16.3422 0.00854
NP_442384.1_10 Reverse -14 -27 15.4572 0.00986
NP_441018.1_7 Reverse -109 -128 7.66927 0.268
NP_441018.1_7 Reverse -327 -346 6.09597 0.299
NP_442790.1_4 Forward -32 -13 -15.1435 0.288
NP_442262.1_10 Forward -22 -15 14.1988 0.0123
NP_442262.1_10 Reverse -15 -22 14.1988 0.0123
NP_442262.1_10 Reverse -229 -236 11.7405 0.0841
NP_442262.1_10 Reverse -223 -230 11.4455 0.102
NP_442262.1_10 Reverse -49 -56 10.7572 0.124
NP_442262.1_10 Forward -82 -75 8.8889 0.219
NP_442244.1_3 Reverse -119 -138 4.42435 0.259
NP_440163.1_10 Reverse -71 -81 9.61647 0.229
NP_440344.1_10 Forward -30 -13 5.84037 0.0195
NP_440344.1_10 Reverse -7 -24 -3.20608 0.0802
NP_440344.1_10 Forward -90 -73 -10.7776 0.19
NP_440531.1_6 Forward -31 -12 10.4225 0.0681
NP_440531.1_6 Reverse -6 -25 0.294447 0.195
NP_440531.1_6 Reverse -206 -225 -3.3438 0.265
NP_441060.1_1 Forward -42 -23 11.4993 0.294
NP_442910.1_1 Forward -30 -11 -2.75381 0.254
NP_442910.1_1 Reverse -7 -26 -3.3438 0.254
NP_441965.1_3 Forward -33 -14 1.0811 0.224
NP_441965.1_10 Reverse -11 -27 10.3833 0.107
NP_440297.1_9 Forward -236 -226 0.0783647 0.282
NP_440297.1_9 Forward -22 -12 -0.118297 0.282
NP_440297.1_9 Reverse -15 -25 -0.118297 0.282
NP_442280.1_10 Reverse -359 -377 5.74663 0.283
NP_441592.1_4 Forward -23 -4 -4.03212 0.293
NP_441896.1_3 Forward -32 -13 -0.590531 0.241
NP_441896.1_3 Forward -66 -47 -1.7705 0.268
NP_441896.1_5 Reverse -184 -191 15.3787 0.268
NP_441679.1_6 Forward -270 -251 1.67108 0.243
NP_440999.1_9 Forward -27 -13 -0.000409212 0.195
NP_440888.1_2 Forward -23 -9 8.3571 0.163
NP_440888.1_2 Reverse -14 -28 5.50552 0.276
NP_440491.1_1 Forward -265 -246 11.4975 0.17
NP_440491.1_1 Reverse -113 -132 8.7687 0.228
NP_442948.1_2 Reverse -13 -32 8.65258 0.19
NP_441759.1_7 Reverse -147 -166 16.9124 0.0655
NP_441543.1_2 Forward -22 -13 18.486 0.00236
NP_441543.1_2 Reverse -15 -24 18.486 0.00236
NP_442845.1_2 Reverse -117 -131 5.21113 0.24
NP_442845.1_2 Forward -29 -15 4.22782 0.264
NP_441178.1_6 Forward -240 -221 2.06362 0.276
NP_441469.1_8 Reverse -13 -22 16.126 0.00797
NP_441469.1_8 Forward -24 -15 16.126 0.00797
NP_442315.1_1 Forward -218 -200 3.65739 0.287
NP_442337.1_8 Forward -332 -313 -1.96717 0.293
NP_442578.1_7 Forward -22 -15 14.5921 0.026
NP_442578.1_7 Reverse -15 -22 14.5921 0.026
NP_442578.1_7 Reverse -229 -236 5.15232 0.291
NP_440710.1_1 Forward -231 -213 -7.55234 0.24
NP_440220.1_4 Reverse -138 -157 -0.29631 0.261
NP_440220.1_4 Reverse -35 -54 -0.689632 0.262
NP_441462.1_2 Forward -23 -13 11.5831 0.00406
NP_441462.1_2 Reverse -14 -24 11.5831 0.00406
NP_441621.1_7 Forward -25 -11 -3.73699 0.193
NP_441621.1_7 Reverse -12 -26 -3.73699 0.193
NP_443062.1_1 Reverse -358 -376 3.96308 0.279
NP_443062.1_6 Reverse -32 -51 11.1109 0.105
NP_443062.1_6 Reverse -6 -25 9.93088 0.119
NP_443062.1_6 Forward -31 -12 7.47261 0.168
NP_441410.1_4 Forward -92 -73 8.4551 0.297
NP_442204.1_5 Forward -33 -14 8.45592 0.117
NP_441560.1_3 Reverse -279 -297 15.0638 0.159
NP_441560.1_3 Forward -385 -367 6.11567 0.28
NP_442487.1_5 Forward -248 -229 1.96529 0.3
NP_440516.1_2 Forward -29 -11 23.1269 0.0106
NP_440516.1_2 Reverse -8 -26 13.9821 0.0538
NP_440516.1_6 Forward -83 -69 21.73 0.0713
NP_440516.1_8 Forward -23 -14 16.9127 0.00442
NP_440516.1_8 Reverse -14 -23 16.9127 0.00442
NP_440516.1_8 Reverse -74 -83 -0.491928 0.262
NP_440516.1_8 Forward -231 -222 -0.590259 0.283
NP_442428.1_5 Forward -22 -15 15.8704 0.0124
NP_442428.1_5 Reverse -15 -22 15.8704 0.0124
NP_442428.1_5 Reverse -229 -236 4.46401 0.267
NP_440673.1_2 Reverse -4 -23 15.1696 0.0942
NP_440673.1_2 Forward -33 -14 13.9015 0.103
NP_440673.1_3 Forward -21 -14 12.4288 0.0426
NP_440673.1_3 Reverse -16 -23 12.4288 0.0426
NP_440673.1_3 Reverse -224 -231 10.4622 0.139
NP_440673.1_3 Forward -81 -74 8.98723 0.203
NP_441052.1_2 Forward -23 -13 10.5014 0.0285
NP_441052.1_2 Reverse -14 -24 10.5014 0.0285
NP_442219.1_9 Forward -22 -13 8.35786 0.0681
NP_442219.1_9 Reverse -15 -24 8.35786 0.0681
NP_440436.1_4 Forward -22 -13 18.1905 0.00233
NP_440436.1_4 Reverse -15 -24 18.1905 0.00233
NP_441884.1_8 Forward -24 -5 -2.0655 0.138
NP_441884.1_9 Reverse -11 -30 -15.5368 0.138
NP_441884.1_9 Forward -265 -246 -21.1417 0.229
NP_441884.1_9 Forward -26 -7 -23.6 0.284
NP_441884.1_9 Forward -249 -230 -25.1733 0.29
NP_441719.1_4 Forward -22 -15 16.3621 0.0124
NP_441719.1_4 Reverse -15 -22 16.3621 0.0124
NP_441719.1_4 Reverse -229 -236 3.77569 0.285
NP_441004.1_1 Forward -280 -261 -17.3068 0.29
NP_442366.1_3 Reverse -115 -133 -0.275845 0.188
NP_442366.1_3 Forward -157 -139 -5.48739 0.288
NP_442366.1_5 Reverse -11 -21 15.2208 0.0375
NP_442366.1_5 Forward -26 -16 15.2208 0.0375
NP_442366.1_5 Reverse -78 -88 11.2876 0.197
NP_442873.1_5 Forward -241 -222 7.66846 0.276
NP_442206.1_10 Reverse -14 -29 2.92983 0.196
NP_443054.1_2 Reverse -72 -86 1.96621 0.245
NP_443054.1_2 Forward -25 -11 1.96621 0.245
NP_443054.1_2 Reverse -12 -26 1.96621 0.245
NP_441851.1_10 Forward -24 -14 16.008 0.00552
NP_441851.1_10 Reverse -13 -23 16.008 0.00552
NP_440347.1_3 Forward -204 -185 17.5024 0.0178
NP_442515.1_1 Reverse -13 -27 -4.32697 0.298
NP_442515.1_1 Forward -202 -188 -4.7203 0.298
NP_441046.1_2 Forward -153 -134 -1.47551 0.29
NP_442689.1_8 Reverse -134 -151 -8.81095 0.298
NP_441349.1_10 Forward -33 -14 2.75272 0.0731
NP_441349.1_10 Reverse -4 -23 0.294447 0.089
NP_440432.1_9 Forward -159 -144 -1.79006 0.167
NP_442843.1_1 Reverse -229 -248 -9.53865 0.266
NP_441124.1_5 Reverse -139 -149 12.4352 0.221
NP_442450.1_5 Reverse -12 -22 7.55152 0.13
NP_442450.1_5 Forward -25 -15 7.55152 0.13
NP_440588.1_2 Forward -32 -13 15.9291 0.012
NP_440588.1_2 Reverse -5 -24 10.5209 0.038
NP_440588.1_5 Forward -374 -360 15.0959 0.22
NP_441570.1_1 Forward -23 -5 -5.09406 0.075
NP_441570.1_1 Reverse -222 -240 -8.33898 0.109
NP_441078.1_4 Forward -23 -14 19.6659 0.0007
NP_441078.1_4 Reverse -14 -23 19.6659 0.0007
NP_442348.1_2 Reverse -237 -246 14.5527 0.147
NP_442348.1_2 Forward -40 -31 10.7178 0.259
NP_442443.1_1 Forward -312 -293 7.96426 0.13
NP_441432.1_8 Reverse -13 -22 8.25953 0.0755
NP_441432.1_8 Forward -24 -15 8.25953 0.0755
NP_441432.1_8 Forward -232 -223 5.21127 0.185
NP_441432.1_8 Reverse -73 -82 3.7363 0.243
NP_442320.1_8 Forward -29 -15 -2.55701 0.0913
NP_441732.1_2 Reverse -10 -26 -7.41462 0.0849
NP_441732.1_2 Forward -27 -11 -7.51295 0.0859
NP_440629.1_6 Reverse -8 -27 12.3102 0.289
NP_442003.1_9 Forward -392 -373 5.70265 0.235
NP_440578.1_4 Reverse -2 -21 10.8159 0.247
NP_440713.1_4 Forward -241 -222 1.47442 0.286
NP_442489.1_2 Forward -293 -274 2.45773 0.262
NP_442489.1_7 Forward -23 -14 20.1576 0.000695
NP_442489.1_7 Reverse -14 -23 20.1576 0.000695
NP_440559.1_1 Reverse -15 -24 8.75118 0.0586
NP_440559.1_1 Forward -22 -13 8.75118 0.0586
NP_441659.2_8 Forward -23 -13 11.9764 0.0147
NP_441659.2_8 Reverse -14 -24 11.9764 0.0147
NP_439912.1_2 Reverse -366 -385 13.5691 0.215
NP_442346.1_5 Forward -24 -14 9.02648 0.118
NP_442346.1_5 Reverse -13 -23 9.02648 0.118
NP_440545.1_3 Reverse -10 -27 6.33202 0.0564
NP_440545.1_3 Forward -27 -10 -3.40274 0.203
NP_440831.1_3 Forward -240 -221 7.45499 0.251
NP_440010.1_10 Reverse -216 -235 5.01433 0.238
NP_442603.1_7 Reverse -222 -236 6.29216 0.249
NP_442603.1_7 Forward -237 -223 5.80051 0.273
NP_442603.1_7 Forward -231 -217 5.70218 0.277
NP_441888.1_7 Reverse -9 -23 3.8345 0.225
NP_441888.1_7 Forward -28 -14 3.73617 0.225
NP_441948.1_4 Reverse -7 -25 11.4255 0.0519
NP_441833.1_4 Forward -22 -15 15.9687 0.0124
NP_441833.1_4 Reverse -15 -22 15.9687 0.0124
NP_441329.1_6 Reverse -86 -105 8.16414 0.155
NP_442162.1_9 Forward -22 -15 16.2637 0.0124
NP_442162.1_9 Reverse -15 -22 16.2637 0.0124
NP_442162.1_9 Reverse -223 -230 9.28223 0.0694
NP_442199.1_7 Reverse -135 -154 3.53858 0.245
NP_442199.1_7 Reverse -205 -224 -0.197979 0.289
NP_442140.1_3 Forward -22 -12 16.2046 0.0255
NP_442140.1_3 Reverse -15 -25 16.2046 0.0255
NP_442140.1_3 Reverse -229 -239 5.78156 0.197
NP_442140.1_3 Reverse -49 -59 3.51995 0.294
NP_441671.1_6 Forward -366 -347 8.65258 0.179
NP_441813.1_5 Reverse -12 -22 9.91146 0.021
NP_441813.1_5 Forward -25 -15 9.91146 0.021
NP_441813.1_5 Forward -239 -229 -0.0199663 0.227
NP_442254.1_1 Reverse -2 -21 -5.40875 0.282
NP_442089.1_6 Forward -107 -88 4.12936 0.262
NP_440590.1_4 Reverse -15 -28 3.36254 0.0746
NP_440590.1_4 Forward -22 -9 3.26421 0.0749
NP_440567.1_1 Reverse -15 -29 15.2409 0.0178
NP_440567.1_1 Forward -22 -8 9.43936 0.0442
NP_442497.1_10 Forward -22 -13 10.4228 0.0087
NP_442497.1_10 Reverse -15 -24 10.4228 0.0087
NP_440821.1_4 Reverse -12 -22 10.2065 0.0163
NP_440821.1_4 Forward -25 -15 10.2065 0.0163
NP_441239.1_9 Reverse -12 -24 14.887 0.0247
NP_441239.1_9 Forward -25 -13 14.887 0.0247
NP_441239.1_9 Forward -85 -73 4.8572 0.239
NP_441892.1_1 Reverse -72 -89 -4.38605 0.26
NP_442193.1_1 Reverse -238 -256 7.19731 0.295
NP_441508.1_4 Forward -378 -364 13.094 0.297
NP_441017.1_6 Reverse -224 -238 11.4053 0.268
NP_441017.1_8 Reverse -234 -249 13.4512 0.174
NP_440900.1_5 Forward -28 -9 16.5025 0.201
NP_440949.1_5 Reverse -277 -296 20.354 0.221
NP_440546.1_4 Forward -23 -13 11.8882 0.0679
NP_440546.1_4 Reverse -14 -24 11.8882 0.0679
NP_441656.1_7 Reverse -298 -317 19.2737 0.155
NP_440462.1_6 Forward -25 -15 9.02648 0.0498
NP_440462.1_6 Reverse -12 -22 9.02648 0.0498
NP_440868.1_4 Forward -27 -15 20.2952 0.00865
NP_440868.1_4 Reverse -10 -22 18.3285 0.0124
NP_440868.1_4 Forward -241 -229 9.47875 0.0482
NP_442479.1_9 Reverse -131 -150 1.27776 0.191
NP_441582.1_5 Forward -25 -6 15.0432 0.115
NP_441582.1_5 Reverse -12 -31 8.25844 0.164
NP_439942.1_2 Reverse -61 -80 12.5992 0.269
NP_440696.1_3 Forward -23 -5 3.65739 0.206
NP_440696.1_3 Reverse -218 -236 3.06741 0.211
NP_442039.1_4 Forward -22 -15 15.1821 0.0124
NP_442039.1_4 Reverse -15 -22 15.1821 0.0124
NP_441811.1_1 Reverse -213 -232 4.71934 0.282
NP_440825.1_7 Reverse -15 -25 12.4217 0.155
NP_440825.1_7 Forward -22 -12 12.4217 0.155
NP_442837.1_3 Forward -22 -15 15.7721 0.0124
NP_442837.1_3 Reverse -15 -22 15.7721 0.0124
NP_442837.1_3 Forward -89 -82 6.52896 0.2
NP_442053.1_1 Forward -23 -14 18.3876 0.0007
NP_442053.1_1 Reverse -14 -23 18.3876 0.0007
NP_442053.1_1 Reverse -222 -231 3.83464 0.285
NP_440505.1_3 Forward -25 -15 6.76487 0.169
NP_440505.1_3 Reverse -12 -22 6.76487 0.169
NP_440505.1_7 Reverse -364 -383 -1.37718 0.273
NP_442360.1_5 Forward -254 -244 14.1397 0.242
NP_441102.1_1 Forward -293 -274 5.01433 0.256
NP_441536.1_10 Forward -286 -267 12.8808 0.265
NP_442255.1_5 Reverse -79 -98 11.0125 0.227
NP_440308.1_4 Forward -189 -170 10.6184 0.152
NP_442532.1_7 Reverse -14 -28 4.52282 0.171
NP_440914.1_1 Forward -23 -13 8.6151 0.186
NP_440914.1_1 Reverse -14 -24 8.6151 0.186
NP_441011.1_8 Forward -22 -13 16.9127 0.00602
NP_441011.1_8 Reverse -15 -24 16.9127 0.00602
NP_442533.1_6 Forward -23 -14 17.2076 0.00137
NP_442533.1_6 Reverse -14 -23 17.2076 0.00137
NP_442533.1_6 Forward -132 -123 3.24465 0.219
NP_442232.1_3 Reverse -6 -25 -14.1602 0.288
NP_442229.1_1 Forward -25 -11 11.307 0.18
NP_442229.1_1 Reverse -12 -26 11.307 0.18
NP_441482.1_7 Reverse -8 -22 -10.5218 0.209
NP_442269.1_10 Forward -76 -57 5.40766 0.238
NP_441527.1_4 Reverse -87 -106 -11.7937 0.284
NP_439965.1_1 Reverse -5 -24 -5.9004 0.211
NP_441602.1_3 Forward -313 -294 -5.80207 0.298
NP_442673.1_7 Forward -37 -18 11.6018 0.278
NP_441972.1_5 Reverse -63 -82 -2.65548 0.187
NP_441106.1_1 Reverse -13 -22 18.191 0.0028
NP_441106.1_1 Forward -24 -15 18.191 0.0028
NP_439903.1_6 Reverse -354 -373 -0.689632 0.284
NP_441286.1_1 Forward -24 -12 -3.50094 0.145
NP_441286.1_1 Reverse -13 -25 -3.50094 0.145
NP_441286.1_1 Forward -232 -220 -5.17256 0.192
NP_442674.1_2 Reverse -138 -157 10.1275 0.208
NP_440670.1_8 Forward -23 -14 18.3876 0.000699
NP_440670.1_8 Reverse -14 -23 18.3876 0.000699
NP_441930.1_2 Reverse -73 -83 11.1898 0.298
NP_440886.1_7 Forward -24 -14 17.7774 0.0011
NP_440886.1_7 Reverse -13 -23 17.7774 0.0011
NP_440886.1_7 Forward -17 -7 8.43603 0.0805
NP_440886.1_7 Forward -84 -74 6.37109 0.13
NP_442717.1_3 Forward -204 -185 11.0125 0.0501
NP_440513.1_4 Forward -231 -212 7.66927 0.295
NP_441427.1_1 Reverse -176 -195 13.0775 0.104
NP_441753.1_10 Reverse -65 -84 4.81767 0.193
NP_440907.2_8 Forward -22 -12 14.2375 0.0312
NP_440907.2_8 Reverse -15 -25 14.2375 0.0312
NP_442264.1_2 Reverse -218 -235 11.6419 0.181
NP_441021.1_8 Reverse -9 -27 17.8171 0.0605
NP_441021.1_8 Forward -28 -10 2.77242 0.239
NP_441463.1_3 Forward -81 -62 -9.53865 0.28
NP_441626.1_2 Forward -22 -15 15.7721 0.0124
NP_441626.1_2 Reverse -15 -22 15.7721 0.0124
NP_442365.1_7 Forward -27 -8 0.392778 0.177
NP_442794.1_1 Forward -235 -223 8.39711 0.109
NP_442615.1_1 Reverse -5 -23 -1.06249 0.124
NP_442615.1_1 Forward -32 -14 -3.32411 0.159
NP_440387.1_1 Forward -23 -7 14.3165 0.00649
NP_440387.1_1 Reverse -14 -30 5.76173 0.031
NP_441431.1_2 Reverse -11 -25 17.3052 0.0296
NP_441431.1_2 Forward -26 -12 17.3052 0.0296
NP_441993.1_1 Forward -77 -58 3.70092 0.23
NP_440114.1_10 Reverse -14 -28 12.6843 0.0754
NP_440114.1_10 Forward -23 -9 11.996 0.0955
NP_440114.1_10 Reverse -74 -88 6.78443 0.258
NP_440114.1_10 Forward -231 -217 5.99778 0.289
NP_440935.1_5 Reverse -354 -373 22.4752 0.0775
NP_442437.1_8 Forward -82 -63 5.11266 0.256
NP_441510.2_7 Reverse -68 -82 14.7486 0.28
NP_441720.1_2 Forward -27 -8 5.30853 0.217
NP_440766.1_4 Forward -235 -221 9.34103 0.0871
NP_440766.1_4 Reverse -224 -238 4.32615 0.131
NP_441237.1_9 Forward -56 -46 10.8948 0.214
NP_440457.1_1 Reverse -224 -236 3.18557 0.202
NP_440457.1_1 Reverse -10 -22 2.69391 0.205
NP_440798.1_2 Forward -387 -373 14.9452 0.252
NP_440798.1_6 Forward -22 -9 14.2773 0.0423
NP_440798.1_6 Reverse -15 -28 5.52582 0.14
NP_441984.1_3 Forward -227 -209 8.27895 0.232
NP_442509.1_9 Forward -23 -13 16.2041 0.00739
NP_442509.1_9 Reverse -14 -24 16.2041 0.00739
NP_442509.1_9 Reverse -288 -298 6.46942 0.268
NP_442509.1_9 Forward -231 -221 6.37109 0.274
NP_440554.1_4 Forward -22 -12 7.35486 0.103
NP_440554.1_4 Reverse -15 -25 7.35486 0.103
NP_442862.1_3 Forward -149 -132 11.6419 0.202
NP_442862.1_3 Reverse -134 -151 5.54538 0.271
NP_441885.1_5 Forward -23 -13 11.4848 0.00668
NP_441885.1_5 Reverse -14 -24 11.4848 0.00668
NP_440628.1_3 Forward -366 -352 17.1092 0.256
NP_442310.1_5 Reverse -64 -83 9.0459 0.237
NP_442341.1_7 Reverse -13 -27 15.6342 0.0218
NP_442341.1_7 Forward -24 -10 9.63603 0.0726
NP_442341.1_9 Forward -25 -11 6.68548 0.217
NP_442341.1_9 Reverse -12 -26 6.68548 0.217
NP_441173.1_9 Reverse -136 -144 12.1137 0.21
NP_443000.1_7 Forward -25 -15 1.94665 0.226
NP_443000.1_7 Reverse -12 -22 1.94665 0.226
NP_440507.2_3 Reverse -247 -266 10.815 0.2
NP_443059.1_10 Forward -239 -220 -0.00131823 0.275
NP_442513.1_5 Reverse -220 -239 8.4551 0.272
NP_441842.1_1 Reverse -16 -29 10.6384 0.292
NP_441842.1_10 Forward -30 -16 12.7826 0.0918
NP_441842.1_10 Reverse -7 -21 6.09611 0.299
NP_440275.1_3 Forward -25 -15 8.33817 0.0602
NP_440275.1_3 Reverse -12 -22 8.33817 0.0602
NP_440091.1_1 Reverse -10 -22 10.1671 0.0498
NP_440091.1_1 Forward -27 -15 0.727295 0.233
NP_442275.1_1 Reverse -14 -33 2.3594 0.284
NP_440679.1_10 Forward -81 -62 -16.3235 0.258
NP_439962.1_4 Reverse -291 -310 13.4708 0.106
NP_440149.1_8 Reverse -14 -33 -3.3438 0.187
NP_440149.1_8 Forward -288 -269 -5.11376 0.219
NP_440216.1_1 Forward -23 -9 7.9644 0.00737
NP_440216.1_1 Reverse -14 -28 -1.18038 0.0301
NP_440172.1_1 Forward -23 -13 8.73149 0.0586
NP_440172.1_1 Reverse -14 -24 8.73149 0.0586
NP_440172.1_3 Reverse -164 -183 9.53756 0.287
NP_441064.1_7 Reverse -15 -34 18.9882 0.0689
NP_442015.1_10 Reverse -10 -23 10.8357 0.0391
NP_442015.1_10 Forward -27 -14 10.7374 0.0391
NP_442015.1_10 Reverse -224 -237 -0.275709 0.259
NP_441226.1_7 Forward -22 -15 14.4934 0.0123
NP_441226.1_7 Reverse -15 -22 14.4934 0.0123
NP_441226.1_7 Forward -131 -124 8.29857 0.205
NP_441111.1_7 Forward -22 -14 18.7023 0.00294
NP_441111.1_7 Reverse -15 -23 18.7023 0.00294
NP_441766.1_1 Forward -326 -307 17.8957 0.229
NP_441766.1_2 Forward -23 -14 17.5026 0.00297
NP_441766.1_2 Reverse -14 -23 17.5026 0.00297
NP_440416.1_9 Reverse -7 -26 -17.0118 0.229
NP_440416.1_9 Reverse -221 -240 -17.7001 0.245
NP_443052.1_8 Forward -33 -14 -12.4886 0.256
NP_443052.1_9 Reverse -294 -313 1.96607 0.179
NP_442154.1_1 Reverse -220 -238 -15.7138 0.224
NP_442154.1_1 Forward -218 -200 -17.6804 0.262
NP_442154.1_1 Reverse -364 -382 -17.6804 0.262
NP_442226.1_8 Forward -148 -138 17.3846 0.164
NP_440261.1_5 Reverse -15 -28 -2.53732 0.0924
NP_440261.1_5 Forward -298 -285 -10.8955 0.221
NP_440261.1_5 Forward -22 -9 -12.0754 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGAAGCTTGGGATTTACTCAACCGGCAAAACCAAGGCATTGATTTAGCTCTGTGTGACATTGAAATGCCCAATATGGATGGGTTTAGTCTGCTGCAACTGGTGCGGGCTCACCGAGTTTGGCATAGCTTAACGGTAGTGATGCTCACCTCTAGGGAAAATCCCCTCCATCGCAATCGGGCCAAAGCTCTTGGGGCTGATGGTTACCTCACCAAACCATTCCAACCCAATCAATTGTTAAGCACCATCGATCAATTTTTGGCAGAATCTGCCCAACGCTAATCACTCCTAAAAAGCATTTCCTTTCAGTTTTTTGATCCCCCATTGCCGTGATGTTTGCTTAGGTTCCATCGGACAATTATCGGTATTGTTCTATGTCGGCGATCGCCGACCTTGAAAATT

CDS

ATGAATAATTGCGTAATTTCTTTTCCTCAAACTAAATTTTTGCCCCTATCACTAGAATTTAACGCTTGTCTAGCGGAATATTTAACCCCAGACAATTCGCCAATTTTATTCGGTTGTCGCACAGGATTATGTGGTACCTGTCTAGTGAAAGTCGTGGGGGAAATCCTCTCCCCAGAGGCCGAGGAAAGGGAAATTTTGGCTATTCTGGCTCCTGATGATGTTCAGGCTAGATTGGCTTGTCAAATTAAGTTAACAGGAGATATTGCCATTAGAGCTTATCAAAGTGATGAAATTTGA

Protein

MNNCVISFPQTKFLPLSLEFNACLAEYLTPDNSPILFGCRTGLCGTCLVKVVGEILSPEAEEREILAILAPDDVQARLACQIKLTGDIAIRAYQSDEI