Your browser is old and dusty. Try Google Chrome!

Details for ssl2542

ORF ssl2542
Accession NP_440529.1
Symbol hliA, scpC
Category Adaptations and atypical conditions
Definition high light-inducible polypeptide HliA, CAB/ELIP/HLIP superfamily
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -263 -277 3.44117 0.164
NP_441061.1_2 Reverse -257 -271 0.294584 0.213
NP_442761.1_5 Reverse -150 -169 5.211 0.268
NP_440795.1_7 Forward -108 -101 14.6904 0.0123
NP_440795.1_7 Reverse -101 -108 14.6904 0.0123
NP_440795.1_7 Forward -270 -263 11.3472 0.0978
NP_441418.1_6 Forward -109 -90 -29.6965 0.234
NP_441418.1_6 Reverse -262 -281 -29.9915 0.249
NP_441605.1_6 Forward -63 -44 3.73603 0.24
NP_442291.1_5 Forward -110 -94 4.28677 0.0943
NP_441453.1_4 Reverse -100 -108 16.539 0.00633
NP_441453.1_4 Forward -109 -101 16.539 0.00633
NP_441453.1_4 Reverse -262 -270 13.5891 0.0246
NP_441453.1_4 Forward -271 -263 7.29591 0.0589
NP_441623.1_1 Reverse -233 -251 6.214 0.154
NP_441960.1_4 Reverse -338 -354 11.3659 0.279
NP_442151.1_6 Forward -109 -95 7.9644 0.184
NP_441818.1_1 Forward -108 -97 9.20294 0.25
NP_441818.1_9 Reverse -358 -377 -2.55715 0.206
NP_441818.1_9 Reverse -352 -371 -8.16202 0.274
NP_440226.1_1 Forward -109 -90 16.6174 0.0215
NP_440226.1_1 Reverse -100 -119 15.7324 0.0231
NP_441630.1_3 Reverse -92 -111 -0.000545616 0.285
NP_442623.1_3 Reverse -263 -282 -10.4236 0.181
NP_442287.1_3 Reverse -92 -109 13.2144 0.296
NP_442287.1_5 Forward -348 -338 17.3846 0.218
NP_442655.1_1 Forward -114 -95 7.07928 0.12
NP_442173.1_1 Forward -108 -100 15.4574 0.00633
NP_442173.1_1 Reverse -101 -109 15.4574 0.00633
NP_442173.1_1 Reverse -263 -271 7.49257 0.171
NP_442173.1_1 Forward -270 -262 6.01761 0.2
NP_442752.1_4 Forward -109 -102 13.8055 0.0199
NP_442752.1_4 Reverse -100 -107 13.8055 0.0199
NP_443027.1_4 Reverse -98 -108 13.2547 0.0521
NP_443027.1_4 Reverse -260 -270 9.51814 0.161
NP_443027.1_4 Forward -111 -101 5.87989 0.294
NP_441812.1_3 Forward -110 -96 8.55439 0.251
NP_442975.1_10 Forward -113 -99 11.602 0.0497
NP_442975.1_10 Reverse -96 -110 4.03056 0.249
NP_442975.1_10 Forward -321 -307 2.26061 0.28
NP_440784.1_7 Forward -108 -101 15.9687 0.0123
NP_440784.1_7 Reverse -101 -108 15.9687 0.0123
NP_440784.1_7 Reverse -263 -270 12.4288 0.0475
NP_440784.1_7 Forward -270 -263 6.23397 0.241
NP_440061.1_9 Reverse -260 -274 12.8803 0.0903
NP_440110.1_7 Forward -279 -260 13.9625 0.213
NP_441054.1_1 Reverse -255 -269 13.3726 0.274
NP_441476.1_5 Forward -276 -257 -3.3438 0.235
NP_440878.1_9 Reverse -326 -345 7.47261 0.174
NP_442062.1_3 Forward -45 -26 3.14605 0.211
NP_442062.1_3 Forward -54 -35 0.687771 0.233
NP_442062.1_3 Reverse -18 -37 -1.86883 0.264
NP_442062.1_8 Reverse -100 -110 19.4496 0.000558
NP_442062.1_8 Reverse -262 -272 14.0414 0.0168
NP_442062.1_8 Forward -109 -99 10.3048 0.0493
NP_441900.1_2 Reverse -69 -87 -6.37307 0.293
NP_440839.1_4 Forward -134 -115 11.11 0.268
NP_441859.1_3 Reverse -261 -280 3.24359 0.246
NP_441802.1_1 Forward -340 -321 4.32602 0.296
NP_440304.1_4 Reverse -98 -108 10.8948 0.051
NP_440304.1_4 Forward -273 -263 6.56821 0.15
NP_440304.1_4 Forward -111 -101 1.84832 0.299
NP_442242.1_4 Forward -108 -101 14.3954 0.0124
NP_442242.1_4 Reverse -101 -108 14.3954 0.0124
NP_440044.1_8 Forward -108 -89 6.29264 0.092
NP_441781.1_7 Reverse -100 -119 -2.36049 0.289
NP_439918.1_3 Reverse -293 -312 2.3594 0.295
NP_441161.1_3 Forward -115 -97 18.407 0.0605
NP_441935.1_2 Reverse -88 -107 -3.14714 0.253
NP_441208.1_9 Forward -274 -260 8.16106 0.219
NP_441208.1_9 Forward -112 -98 5.99778 0.254
NP_442742.1_9 Forward -204 -185 -12.8819 0.269
NP_442110.1_7 Forward -271 -257 4.22782 0.205
NP_442110.1_7 Forward -109 -95 1.86788 0.222
NP_441925.1_4 Forward -185 -166 -13.8659 0.259
NP_441925.1_4 Forward -206 -187 -14.7509 0.263
NP_441925.1_4 Forward -205 -186 -14.9476 0.263
NP_440856.1_1 Reverse -252 -271 4.71934 0.157
NP_440856.1_4 Reverse -93 -112 6.78429 0.0735
NP_440856.1_4 Forward -312 -293 -5.70374 0.297
NP_441083.1_5 Reverse -100 -110 11.3864 0.0159
NP_441083.1_5 Forward -109 -99 11.2881 0.0159
NP_441083.1_5 Reverse -262 -272 -0.314959 0.265
NP_442115.2_8 Reverse -307 -326 13.3725 0.18
NP_441434.1_7 Reverse -102 -116 3.73617 0.227
NP_441738.1_2 Forward -107 -100 15.28 0.0102
NP_441738.1_2 Reverse -102 -109 15.28 0.0102
NP_441558.1_5 Reverse -98 -117 20.059 0.0059
NP_441558.1_5 Forward -118 -99 5.40766 0.251
NP_440209.1_1 Reverse -100 -108 18.1123 0.00295
NP_440209.1_1 Forward -109 -101 18.1123 0.00295
NP_440209.1_1 Reverse -262 -270 8.27922 0.0687
NP_442136.1_1 Forward -46 -27 16.9124 0.0862
NP_442136.1_1 Forward -66 -47 12.8808 0.186
NP_442889.1_8 Reverse -97 -111 10.9137 0.077
NP_442889.1_8 Forward -112 -98 3.44058 0.278
NP_442889.1_10 Forward -50 -31 10.2397 0.287
NP_440447.1_1 Reverse -257 -275 1.59244 0.299
NP_440056.1_1 Reverse -257 -276 8.94757 0.285
NP_441713.1_1 Forward -115 -96 -7.67036 0.135
NP_441713.1_1 Forward -277 -258 -17.1101 0.298
NP_440178.1_7 Forward -110 -91 -13.3736 0.136
NP_441025.1_6 Reverse -29 -48 6.22677 0.214
NP_440538.1_10 Forward -394 -375 15.5357 0.179
NP_440538.1_10 Forward -267 -248 15.3391 0.186
NP_442111.1_4 Forward -272 -258 9.5377 0.0606
NP_442111.1_4 Reverse -99 -113 6.19444 0.134
NP_440906.1_5 Forward -108 -101 15.8704 0.0124
NP_440906.1_5 Reverse -101 -108 15.8704 0.0124
NP_440906.1_5 Forward -270 -263 6.23397 0.234
NP_440906.1_5 Reverse -263 -270 6.0373 0.262
NP_440747.1_10 Reverse -97 -109 7.4138 0.00422
NP_440747.1_10 Forward -112 -100 5.44718 0.0137
NP_440747.1_10 Reverse -259 -271 -2.51763 0.0509
NP_440747.1_10 Forward -274 -262 -11.6624 0.131
NP_441130.1_7 Forward -369 -355 15.8302 0.287
NP_441130.1_10 Forward -111 -97 10.0294 0.117
NP_441854.1_10 Forward -273 -254 2.26107 0.282
NP_441486.1_1 Forward -112 -98 5.30946 0.0379
NP_441486.1_1 Reverse -97 -111 4.91614 0.0399
NP_442145.1_4 Forward -46 -27 10.4559 0.155
NP_442634.1_4 Reverse -260 -274 6.3911 0.0507
NP_442634.1_4 Forward -273 -259 3.14618 0.118
NP_442634.1_4 Reverse -98 -112 -1.96703 0.149
NP_440403.1_4 Forward -372 -353 -2.0655 0.175
NP_441014.1_5 Forward -281 -263 11.3272 0.258
NP_441014.1_8 Forward -377 -358 -1.57384 0.224
NP_442848.1_5 Reverse -255 -273 10.2456 0.232
NP_441012.1_4 Reverse -258 -271 8.18076 0.272
NP_443018.1_3 Forward -108 -101 14.8871 0.0123
NP_443018.1_3 Reverse -101 -108 14.8871 0.0123
NP_443018.1_3 Forward -270 -263 13.8055 0.024
NP_443018.1_3 Reverse -263 -270 13.6088 0.0352
NP_443018.1_3 Reverse -78 -85 9.38056 0.128
NP_441634.1_8 Reverse -98 -112 5.40779 0.114
NP_441634.1_8 Reverse -251 -265 -1.8687 0.295
NP_441634.1_9 Forward -270 -251 14.7483 0.165
NP_440376.1_1 Forward -109 -100 19.4693 0.000692
NP_440376.1_1 Reverse -100 -109 19.4693 0.000692
NP_440376.1_1 Forward -271 -262 6.48957 0.0963
NP_440376.1_1 Reverse -262 -271 -0.196935 0.285
NP_441588.1_4 Reverse -102 -112 16.4996 0.0369
NP_441588.1_4 Forward -107 -97 6.76487 0.185
NP_442687.1_7 Forward -110 -100 15.8113 0.0125
NP_442687.1_7 Reverse -99 -109 9.02648 0.0994
NP_442687.1_7 Reverse -261 -271 6.46988 0.165
NP_442687.1_7 Forward -318 -308 3.91327 0.278
NP_441797.1_7 Forward -269 -251 13.3922 0.234
NP_441077.1_2 Forward -55 -36 3.00757 0.252
NP_442485.1_3 Reverse -251 -270 2.3594 0.213
NP_441846.1_10 Reverse -359 -378 -12.1936 0.19
NP_441846.1_10 Reverse -196 -215 -14.2585 0.218
NP_441846.1_10 Reverse -187 -206 -21.1417 0.256
NP_441846.1_10 Reverse -361 -380 -22.42 0.259
NP_441846.1_10 Reverse -176 -195 -22.42 0.259
NP_441846.1_10 Reverse -178 -197 -22.715 0.264
NP_441846.1_10 Reverse -354 -373 -23.6 0.294
NP_442583.1_8 Forward -108 -89 13.6675 0.161
NP_440642.1_10 Reverse -66 -80 1.17898 0.3
NP_441013.1_2 Forward -276 -258 2.47742 0.241
NP_441422.1_7 Reverse -260 -277 -9.20427 0.294
NP_441746.1_4 Forward -128 -109 19.2715 0.149
NP_440360.1_10 Reverse -264 -278 4.52282 0.227
NP_442658.1_1 Forward -273 -263 15.9091 0.00966
NP_442658.1_1 Forward -111 -101 15.9091 0.00966
NP_442658.1_1 Reverse -98 -108 14.2375 0.0237
NP_442658.1_1 Reverse -260 -270 4.89613 0.292
NP_441855.2_4 Forward -332 -313 11.5476 0.211
NP_442782.1_2 Forward -271 -257 0.0979218 0.296
NP_442496.1_5 Forward -77 -59 5.32902 0.288
NP_441414.1_9 Reverse -100 -119 1.0811 0.0762
NP_441487.1_9 Forward -110 -91 6.78429 0.125
NP_439959.1_3 Reverse -296 -315 9.3409 0.27
NP_442937.1_5 Forward -282 -263 8.55425 0.219
NP_441958.1_5 Reverse -99 -109 21.2195 0.000805
NP_441958.1_5 Forward -110 -100 12.2714 0.00183
NP_441958.1_5 Reverse -261 -271 10.1081 0.0166
NP_441958.1_5 Forward -272 -262 1.06167 0.116
NP_441958.1_5 Forward -117 -107 -0.708283 0.221
NP_442486.1_8 Reverse -86 -105 19.3698 0.159
NP_442836.1_5 Reverse -94 -113 3.93269 0.222
NP_442685.1_2 Forward -51 -41 14.533 0.235
NP_440984.1_7 Reverse -95 -109 15.7325 0.0488
NP_440984.1_7 Reverse -251 -265 7.9644 0.16
NP_439990.1_5 Reverse -257 -270 7.59077 0.19
NP_439990.1_5 Forward -282 -269 6.4108 0.239
NP_442376.1_2 Forward -276 -257 6.39097 0.148
NP_442376.1_2 Reverse -318 -337 -12.8819 0.286
NP_442690.1_1 Reverse -29 -48 1.37609 0.11
NP_442911.1_2 Forward -119 -100 -2.16383 0.0946
NP_442911.1_2 Forward -281 -262 -11.0136 0.296
NP_440153.1_5 Forward -108 -94 4.91614 0.193
NP_441591.1_10 Reverse -98 -117 6.19431 0.292
NP_442536.1_8 Forward -251 -232 10.7175 0.296
NP_443055.1_6 Forward -391 -373 9.45814 0.133
NP_440993.1_2 Reverse -95 -111 3.40179 0.259
NP_440827.1_3 Forward -276 -257 13.5691 0.222
NP_439975.1_2 Reverse -363 -381 10.2456 0.195
NP_439975.1_3 Forward -81 -68 15.4572 0.274
NP_441099.1_5 Forward -281 -262 1.0811 0.0705
NP_442002.1_9 Forward -110 -103 10.7572 0.185
NP_442013.1_7 Reverse -380 -399 6.29264 0.299
NP_441294.1_5 Reverse -285 -303 20.177 0.0123
NP_441294.1_7 Forward -113 -99 18.2736 0.00602
NP_441294.1_7 Reverse -103 -117 12.9942 0.0767
NP_441294.1_7 Forward -321 -307 9.15464 0.256
NP_441646.1_1 Forward -278 -259 -0.787193 0.272
NP_442438.1_10 Forward -276 -262 8.16106 0.0812
NP_442438.1_10 Forward -114 -100 3.24451 0.165
NP_442438.1_10 Forward -310 -296 2.16287 0.185
NP_442431.1_10 Reverse -199 -217 3.26407 0.22
NP_441000.1_6 Forward -110 -96 13.2743 0.0396
NP_441000.1_6 Reverse -99 -113 5.50613 0.0933
NP_441000.1_6 Reverse -106 -120 -1.27871 0.212
NP_441000.1_6 Forward -250 -236 -3.63866 0.225
NP_440147.1_4 Forward -111 -98 19.6855 0.00258
NP_440147.1_4 Reverse -260 -273 15.6539 0.0159
NP_440147.1_4 Reverse -98 -111 9.06573 0.0437
NP_440147.1_4 Forward -273 -260 -0.767364 0.299
NP_441550.1_8 Reverse -98 -108 15.8108 0.0132
NP_441550.1_8 Reverse -260 -270 12.6642 0.0325
NP_441550.1_8 Forward -111 -101 8.3377 0.124
NP_441550.1_8 Forward -273 -263 5.28945 0.255
NP_441916.1_7 Forward -109 -99 18.9579 0.00144
NP_441916.1_7 Reverse -100 -110 18.4663 0.00144
NP_441916.1_7 Forward -271 -261 16.893 0.00407
NP_441916.1_7 Reverse -262 -272 4.99491 0.15
NP_441916.1_10 Forward -325 -306 1.76941 0.262
NP_441041.1_4 Reverse -100 -119 -4.03212 0.128
NP_441041.1_4 Forward -271 -252 -7.76869 0.192
NP_441041.1_4 Reverse -308 -327 -9.93197 0.226
NP_441041.1_4 Forward -277 -258 -12.2919 0.262
NP_441041.1_7 Forward -112 -100 18.9817 0.00435
NP_441041.1_7 Reverse -97 -109 16.6495 0.0131
NP_441041.1_7 Forward -274 -262 8.38938 0.137
NP_442396.1_5 Forward -113 -100 8.47575 0.153
NP_442004.1_6 Forward -271 -257 6.3911 0.174
NP_442004.1_6 Reverse -262 -276 4.22782 0.222
NP_441725.1_4 Forward -207 -193 8.65209 0.195
NP_441725.1_4 Reverse -257 -271 5.40719 0.278
NP_441725.1_5 Reverse -263 -273 7.15819 0.103
NP_441725.1_5 Reverse -101 -111 2.04498 0.115
NP_441725.1_5 Forward -108 -98 1.94665 0.115
NP_439966.1_7 Reverse -98 -108 14.3359 0.0203
NP_439966.1_7 Reverse -260 -270 10.6976 0.0838
NP_439966.1_7 Forward -111 -101 9.91099 0.0968
NP_439966.1_7 Reverse -238 -248 9.321 0.117
NP_439966.1_9 Forward -251 -242 4.52295 0.253
NP_439966.1_9 Forward -111 -102 0.884706 0.253
NP_440736.1_3 Reverse -98 -117 1.47442 0.282
NP_442941.1_3 Forward -108 -98 19.2529 0.00262
NP_442941.1_3 Forward -270 -260 9.51814 0.0306
NP_442941.1_3 Reverse -101 -111 2.63497 0.14
NP_440289.1_2 Reverse -97 -110 6.01747 0.0605
NP_440289.1_2 Forward -112 -99 5.82081 0.0605
NP_440983.1_5 Reverse -262 -281 -7.86702 0.294
NP_442281.1_1 Reverse -95 -109 16.8135 0.00698
NP_442281.1_1 Forward -276 -262 14.8469 0.0155
NP_442281.1_1 Reverse -257 -271 8.75042 0.0764
NP_442281.1_1 Forward -114 -100 4.32555 0.199
NP_441334.1_7 Forward -273 -254 -12.5869 0.162
NP_442575.1_8 Reverse -362 -381 2.0644 0.196
NP_442256.1_2 Forward -111 -93 -8.73231 0.235
NP_440647.1_9 Forward -111 -93 4.9357 0.23
NP_442012.1_1 Reverse -256 -275 4.81767 0.16
NP_442012.1_2 Reverse -98 -117 2.94938 0.239
NP_441087.1_6 Forward -378 -360 -4.2098 0.297
NP_440498.1_1 Forward -118 -100 8.96727 0.0786
NP_441644.1_6 Forward -109 -99 19.0557 0.000803
NP_441644.1_6 Forward -271 -261 15.0242 0.00766
NP_441644.1_6 Reverse -100 -110 10.1076 0.0628
NP_441644.1_6 Reverse -107 -117 5.87944 0.174
NP_441644.1_6 Reverse -262 -272 4.50281 0.235
NP_440867.1_10 Reverse -247 -266 6.68596 0.252
NP_440867.1_10 Forward -266 -247 3.53937 0.283
NP_442215.1_1 Forward -90 -71 5.60432 0.235
NP_442215.1_2 Forward -111 -95 0.845183 0.147
NP_442215.1_2 Reverse -306 -322 -6.82463 0.28
NP_442029.1_1 Reverse -358 -377 -12.4886 0.247
NP_440253.1_2 Forward -109 -91 9.45892 0.0482
NP_440929.1_8 Forward -109 -100 19.2726 0.000701
NP_440929.1_8 Reverse -100 -109 19.2726 0.000701
NP_441346.1_7 Reverse -331 -350 9.53756 0.284
NP_442933.1_10 Forward -109 -100 17.601 0.00325
NP_442933.1_10 Reverse -100 -109 17.601 0.00325
NP_442933.1_10 Forward -271 -262 14.2577 0.0126
NP_442933.1_10 Reverse -262 -271 7.76787 0.11
NP_441751.2_8 Forward -270 -256 5.21113 0.0448
NP_441751.2_8 Reverse -101 -115 -3.34366 0.141
NP_441751.2_8 Forward -108 -94 -4.52363 0.174
NP_441751.2_8 Reverse -263 -277 -5.50694 0.214
NP_442926.1_3 Reverse -251 -270 8.75091 0.17
NP_442926.1_3 Reverse -263 -282 4.81767 0.248
NP_442926.1_3 Forward -282 -263 3.6377 0.279
NP_442554.1_8 Forward -108 -98 17.2863 0.00543
NP_442554.1_8 Forward -270 -260 16.2046 0.0065
NP_442554.1_8 Reverse -101 -111 13.2547 0.0187
NP_442554.1_8 Forward -85 -75 8.33817 0.0754
NP_442554.1_8 Reverse -263 -273 6.27322 0.123
NP_441762.1_7 Reverse -99 -111 10.2654 0.0142
NP_441762.1_7 Forward -110 -98 2.30059 0.0676
NP_441762.1_7 Forward -272 -260 -6.2542 0.284
NP_442142.1_4 Reverse -97 -110 14.1783 0.0311
NP_442142.1_4 Forward -112 -99 13.195 0.0381
NP_442142.1_4 Forward -274 -261 5.62358 0.187
NP_442142.1_4 Reverse -259 -272 4.44361 0.222
NP_442292.1_1 Forward -108 -99 17.5026 0.00435
NP_442292.1_1 Reverse -101 -110 9.63616 0.0183
NP_442292.1_1 Forward -270 -261 7.76787 0.0615
NP_442292.1_5 Reverse -304 -323 -1.57384 0.265
NP_441899.1_1 Forward -265 -247 15.2604 0.162
NP_441264.1_9 Forward -91 -77 15.9292 0.12
NP_442381.1_8 Forward -112 -93 -11.4069 0.263
NP_441711.1_4 Reverse -247 -266 2.26107 0.294
NP_441711.1_4 Reverse -299 -318 2.16274 0.297
NP_443009.1_5 Reverse -99 -110 19.626 0.00102
NP_443009.1_5 Reverse -261 -272 14.0211 0.0249
NP_443009.1_5 Forward -110 -99 7.82632 0.118
NP_442406.1_9 Forward -346 -327 0.0977854 0.291
NP_441715.1_4 Forward -108 -98 16.7946 0.0106
NP_441715.1_4 Reverse -101 -111 9.41981 0.097
NP_441715.1_4 Forward -270 -260 7.35486 0.108
NP_441448.1_1 Reverse -352 -371 12.6841 0.165
NP_441448.1_1 Forward -355 -336 8.35759 0.206
NP_441198.1_8 Forward -273 -263 12.3924 0.135
NP_441468.1_1 Forward -108 -101 15.8704 0.0124
NP_441468.1_1 Reverse -101 -108 15.8704 0.0124
NP_441468.1_1 Forward -270 -263 13.8055 0.0242
NP_441468.1_1 Reverse -263 -270 6.0373 0.223
NP_441020.2_6 Forward -111 -94 9.97027 0.156
NP_441020.2_6 Forward -251 -234 9.08529 0.18
NP_441015.1_10 Reverse -355 -374 1.27776 0.16
NP_441015.1_10 Forward -270 -251 -2.65548 0.18
NP_441015.1_10 Reverse -257 -276 -6.49039 0.249
NP_441015.1_10 Forward -276 -257 -10.0303 0.282
NP_441673.1_1 Forward -109 -100 20.8459 0.000698
NP_441673.1_1 Reverse -100 -109 20.8459 0.000698
NP_441673.1_1 Forward -271 -262 1.37636 0.114
NP_441673.1_1 Reverse -262 -271 1.1797 0.163
NP_441731.1_3 Reverse -254 -273 9.83255 0.159
NP_441016.2_6 Forward -211 -192 9.43841 0.222
NP_441826.1_2 Reverse -256 -270 -1.8687 0.257
NP_441826.1_2 Forward -277 -263 -4.13031 0.292
NP_441330.1_1 Reverse -95 -114 -1.37718 0.0791
NP_441330.1_1 Reverse -257 -276 -5.70374 0.129
NP_442811.1_2 Forward -285 -266 -1.18052 0.256
NP_441764.1_4 Reverse -26 -43 9.21776 0.295
NP_442868.1_6 Reverse -98 -108 10.4031 0.038
NP_442868.1_6 Forward -111 -101 0.865012 0.205
NP_442868.1_6 Reverse -260 -270 0.766681 0.209
NP_441056.1_1 Forward -109 -90 -5.9004 0.265
NP_441056.1_1 Forward -271 -252 -6.78538 0.271
NP_442227.1_2 Forward -371 -352 -2.85214 0.283
NP_440789.1_1 Forward -45 -26 21.3364 0.0189
NP_440789.1_1 Forward -65 -46 20.0581 0.0447
NP_440789.1_8 Forward -347 -328 22.0256 0.0544
NP_442808.1_1 Forward -110 -100 18.4657 0.00201
NP_442808.1_1 Forward -197 -187 11.4843 0.0481
NP_442808.1_1 Reverse -99 -109 8.73102 0.0481
NP_442808.1_1 Forward -196 -186 6.0761 0.131
NP_441101.1_10 Reverse -78 -97 -2.16383 0.228
NP_441101.1_10 Reverse -258 -277 -6.49039 0.29
NP_440145.1_3 Forward -119 -100 -3.63879 0.206
NP_442542.1_2 Reverse -352 -365 4.8375 0.293
NP_442542.1_9 Reverse -93 -107 11.602 0.111
NP_442542.1_9 Forward -324 -310 5.50552 0.261
NP_442050.1_5 Reverse -98 -108 15.9091 0.0091
NP_442342.1_9 Forward -273 -257 2.91013 0.278
NP_440558.1_2 Reverse -253 -272 8.84924 0.108
NP_440558.1_2 Forward -274 -255 2.94938 0.164
NP_440923.1_1 Forward -46 -28 18.7012 0.0488
NP_440923.1_1 Forward -66 -48 11.6214 0.272
NP_441878.1_6 Forward -272 -262 11.4848 0.0176
NP_441878.1_6 Reverse -99 -109 10.5014 0.0176
NP_441878.1_6 Forward -110 -100 10.4031 0.0176
NP_441878.1_6 Reverse -255 -265 0.275027 0.146
NP_441878.1_6 Reverse -261 -271 -0.314959 0.174
NP_441878.1_6 Reverse -353 -363 -6.60814 0.193
NP_441878.1_6 Forward -266 -256 -7.98478 0.285
NP_441036.1_8 Forward -110 -100 17.7779 0.000554
NP_441036.1_8 Reverse -99 -109 15.713 0.00724
NP_441557.1_5 Forward -109 -100 19.9609 0.000699
NP_441557.1_5 Reverse -100 -109 19.9609 0.000699
NP_441557.1_5 Reverse -262 -271 8.84951 0.0343
NP_441557.1_5 Forward -271 -262 0.786375 0.106
NP_441590.1_4 Reverse -258 -277 10.3234 0.249
NP_442267.1_7 Reverse -293 -312 7.86593 0.0681
NP_442066.2_4 Reverse -262 -281 -1.86883 0.207
NP_442066.2_4 Reverse -308 -327 -9.34199 0.298
NP_442066.2_9 Reverse -96 -109 10.2457 0.154
NP_440101.1_3 Forward -276 -257 12.3892 0.0879
NP_440101.1_3 Reverse -352 -371 0.884433 0.289
NP_440101.1_10 Reverse -256 -275 5.50599 0.208
NP_440101.1_10 Forward -277 -258 1.57275 0.288
NP_441407.1_5 Reverse -90 -109 7.07928 0.178
NP_441574.1_1 Reverse -262 -281 -0.000545616 0.198
NP_442347.1_2 Reverse -101 -110 11.1111 0.056
NP_442347.1_2 Forward -115 -106 3.44131 0.284
NP_442347.1_2 Forward -108 -99 3.34298 0.284
NP_442645.1_2 Reverse -92 -111 -11.8986 0.144
NP_442645.1_2 Reverse -254 -273 -17.9951 0.267
NP_441037.1_4 Forward -111 -101 14.7245 0.028
NP_441037.1_4 Forward -273 -263 8.58464 0.237
NP_441037.1_4 Reverse -98 -108 7.22024 0.237
NP_442594.1_8 Reverse -358 -377 7.57094 0.213
NP_442594.1_8 Reverse -185 -204 5.01433 0.254
NP_442594.1_8 Reverse -359 -378 2.65439 0.294
NP_441633.1_3 Reverse -98 -111 3.65753 0.0699
NP_441633.1_3 Forward -111 -98 3.36254 0.0699
NP_441633.1_3 Reverse -260 -273 -3.52063 0.177
NP_441633.1_3 Reverse -238 -251 -5.09393 0.223
NP_442764.1_8 Reverse -246 -265 14.2574 0.098
NP_440136.1_2 Forward -108 -101 15.9687 0.0123
NP_440136.1_2 Reverse -101 -108 15.9687 0.0123
NP_440136.1_2 Forward -270 -263 6.52896 0.116
NP_440136.1_2 Reverse -263 -270 6.13563 0.193
NP_442590.1_9 Forward -354 -335 7.27595 0.25
NP_442590.1_10 Forward -116 -97 10.8159 0.175
NP_442590.1_10 Reverse -250 -269 7.37428 0.229
NP_442998.1_2 Forward -206 -187 4.32522 0.268
NP_442998.1_2 Forward -371 -352 4.12856 0.278
NP_442998.1_5 Forward -393 -383 13.5497 0.158
NP_442998.1_5 Reverse -214 -224 11.4848 0.184
NP_442998.1_5 Forward -81 -71 8.1415 0.271
NP_442998.1_10 Forward -107 -100 15.5754 0.0102
NP_442998.1_10 Reverse -102 -109 15.5754 0.0102
NP_442998.1_10 Forward -269 -262 6.23397 0.157
NP_440899.1_1 Forward -277 -258 12.2135 0.148
NP_440899.1_2 Reverse -89 -108 8.35677 0.2
NP_440299.1_1 Reverse -258 -271 9.95012 0.0631
NP_440299.1_1 Forward -113 -100 8.18017 0.0964
NP_440299.1_1 Forward -275 -262 5.62358 0.169
NP_441799.1_1 Reverse -96 -110 15.0436 0.0206
NP_441799.1_1 Forward -113 -99 14.5519 0.0228
NP_442802.1_3 Forward -349 -330 16.7157 0.223
NP_441007.1_10 Reverse -95 -108 2.67422 0.183
NP_441007.1_10 Forward -276 -263 1.69091 0.203
NP_442201.1_10 Reverse -89 -108 -14.9469 0.295
NP_440256.1_1 Forward -112 -93 12.3892 0.0121
NP_440256.1_1 Reverse -97 -116 0.982764 0.0791
NP_440256.1_1 Reverse -156 -175 -3.54046 0.135
NP_440709.1_1 Forward -57 -38 7.86512 0.109
NP_440709.1_1 Forward -37 -18 5.80018 0.163
NP_441559.1_8 Forward -114 -100 0.88457 0.16
NP_441559.1_8 Reverse -257 -271 -7.08024 0.283
NP_441559.1_8 Reverse -95 -109 -7.2769 0.289
NP_440915.1_3 Forward -337 -318 14.3558 0.214
NP_440915.1_6 Forward -275 -261 21.7307 0.00377
NP_440915.1_6 Forward -113 -99 12.586 0.0208
NP_440915.1_6 Reverse -96 -110 1.76955 0.131
NP_440915.1_6 Reverse -258 -272 -0.885388 0.212
NP_442158.1_4 Reverse -312 -322 12.4681 0.252
NP_442785.1_7 Reverse -98 -112 9.93102 0.237
NP_441464.1_1 Reverse -258 -277 7.37428 0.262
NP_441464.1_8 Reverse -100 -114 3.93283 0.283
NP_441464.1_10 Reverse -184 -198 7.86607 0.287
NP_440695.1_5 Forward -271 -252 0.294447 0.284
NP_441939.1_3 Forward -108 -89 8.06259 0.184
NP_441199.1_6 Reverse -258 -277 -1.08219 0.285
NP_441199.1_7 Reverse -25 -44 5.11266 0.231
NP_441494.1_4 Forward -253 -235 13.5888 0.289
NP_441494.1_6 Forward -276 -263 12.704 0.225
NP_441494.1_6 Reverse -257 -270 6.80412 0.272
NP_442993.1_1 Reverse -100 -116 2.02515 0.0502
NP_442993.1_1 Forward -109 -93 -9.47957 0.186
NP_442386.1_9 Forward -110 -101 15.7322 0.0144
NP_442386.1_9 Reverse -99 -108 6.39082 0.219
NP_442386.1_9 Forward -272 -263 5.30919 0.257
NP_442386.1_9 Forward -196 -187 5.30919 0.257
NP_442386.1_9 Reverse -76 -85 5.21086 0.262
NP_442386.1_9 Reverse -261 -270 4.91586 0.276
NP_440570.1_5 Reverse -246 -265 9.53756 0.159
NP_440570.1_5 Forward -275 -256 5.11266 0.204
NP_440570.1_5 Reverse -258 -277 -2.16383 0.277
NP_441750.1_1 Reverse -354 -373 -3.83545 0.204
NP_441750.1_1 Forward -338 -319 -8.26035 0.286
NP_441340.1_5 Forward -108 -101 15.6737 0.0124
NP_441340.1_5 Reverse -101 -108 15.6737 0.0124
NP_441340.1_5 Reverse -263 -270 13.5105 0.0314
NP_441340.1_5 Forward -270 -263 6.23397 0.132
NP_442186.1_9 Forward -326 -307 4.42435 0.276
NP_442791.1_5 Forward -117 -98 -11.7019 0.29
NP_440168.1_9 Forward -273 -254 -4.6221 0.296
NP_440161.1_3 Reverse -98 -117 7.47261 0.299
NP_440161.1_10 Forward -374 -355 13.6556 0.295
NP_440586.1_1 Reverse -252 -271 -5.70374 0.288
NP_440586.1_8 Forward -108 -101 13.2151 0.026
NP_440586.1_8 Reverse -101 -108 13.2151 0.026
NP_440586.1_8 Reverse -263 -270 11.3468 0.0736
NP_440586.1_8 Forward -270 -263 9.47853 0.146
NP_440586.1_8 Forward -323 -316 9.18354 0.171
NP_440586.1_8 Reverse -108 -115 8.88855 0.205
NP_442251.1_6 Forward -108 -101 15.2804 0.0124
NP_442251.1_6 Reverse -101 -108 15.2804 0.0124
NP_440192.1_5 Forward -278 -259 6.39097 0.224
NP_441262.1_3 Reverse -100 -107 14.7888 0.0223
NP_441262.1_3 Forward -109 -102 14.7888 0.0223
NP_440027.1_8 Forward -112 -93 6.78348 0.27
NP_443051.1_1 Reverse -99 -108 19.5676 0.00335
NP_443051.1_1 Forward -110 -101 10.4228 0.00754
NP_443051.1_1 Reverse -261 -270 9.73449 0.0265
NP_443051.1_1 Forward -272 -263 -0.983583 0.269
NP_439937.1_9 Forward -207 -190 0.0381458 0.107
NP_439937.1_9 Reverse -99 -116 -7.04165 0.157
NP_440408.1_7 Reverse -262 -281 9.73422 0.255
NP_440408.1_7 Forward -271 -252 7.37428 0.29
NP_440408.1_10 Forward -348 -329 10.1275 0.176
NP_440439.1_1 Reverse -259 -272 10.934 0.0339
NP_440439.1_1 Reverse -97 -110 10.934 0.0339
NP_440439.1_1 Forward -112 -99 1.10092 0.162
NP_440372.1_2 Forward -108 -101 16.3621 0.0124
NP_440372.1_2 Reverse -101 -108 16.3621 0.0124
NP_440372.1_2 Forward -270 -263 6.62729 0.151
NP_440372.1_2 Reverse -263 -270 6.52896 0.188
NP_441789.1_7 Forward -173 -154 -4.81951 0.288
NP_441803.1_2 Reverse -257 -276 6.88262 0.147
NP_439977.1_5 Reverse -256 -275 3.83436 0.157
NP_440139.1_1 Reverse -94 -113 7.96345 0.12
NP_441572.1_7 Forward -277 -258 4.81767 0.0925
NP_441572.1_7 Reverse -94 -113 -3.04881 0.206
NP_440267.1_2 Reverse -95 -109 20.6484 0.00946
NP_440267.1_2 Forward -121 -107 6.98048 0.215
NP_442384.1_10 Forward -271 -258 17.6205 0.00585
NP_442384.1_10 Reverse -100 -113 7.39411 0.0822
NP_442384.1_10 Forward -109 -96 2.57589 0.22
NP_441877.1_9 Reverse -36 -53 7.02034 0.277
NP_441877.1_9 Forward -66 -49 3.97208 0.284
NP_441877.1_9 Reverse -26 -43 1.51381 0.297
NP_441018.1_7 Reverse -252 -271 6.78429 0.282
NP_442262.1_10 Forward -108 -101 14.1988 0.0123
NP_442262.1_10 Reverse -101 -108 14.1988 0.0123
NP_442262.1_10 Forward -270 -263 13.0188 0.0314
NP_442262.1_10 Reverse -263 -270 11.6422 0.092
NP_442262.1_10 Reverse -78 -85 9.47889 0.187
NP_442262.1_10 Forward -331 -324 7.21728 0.281
NP_441689.1_5 Reverse -98 -108 8.3377 0.132
NP_442244.1_3 Reverse -311 -330 2.94938 0.293
NP_440344.1_10 Forward -116 -99 1.51381 0.0304
NP_440344.1_10 Reverse -93 -110 -8.61428 0.13
NP_440344.1_10 Reverse -179 -196 -13.8258 0.296
NP_440531.1_6 Reverse -346 -365 2.16274 0.161
NP_440531.1_6 Reverse -92 -111 -0.197208 0.205
NP_442123.1_3 Reverse -315 -334 16.3224 0.0904
NP_442123.1_3 Forward -109 -90 15.1424 0.125
NP_441060.1_3 Forward -280 -261 9.14423 0.227
NP_441335.1_8 Forward -348 -329 11.2092 0.204
NP_442693.1_6 Reverse -256 -275 0.786102 0.278
NP_440297.1_4 Reverse -294 -313 22.3206 0.0403
NP_440297.1_9 Reverse -263 -273 1.25834 0.282
NP_440297.1_9 Reverse -78 -88 -0.0199663 0.282
NP_440297.1_9 Reverse -101 -111 -0.118297 0.282
NP_440297.1_9 Forward -108 -98 -0.216628 0.282
NP_440297.1_9 Forward -270 -260 -0.511621 0.289
NP_442280.1_10 Reverse -67 -85 9.15564 0.236
NP_441592.1_4 Forward -271 -252 -1.57384 0.254
NP_441896.1_1 Forward -65 -46 18.5831 0.0528
NP_441896.1_3 Forward -118 -99 -3.14714 0.297
NP_440894.1_10 Forward -200 -181 8.45592 0.176
NP_440999.1_9 Forward -113 -99 1.96621 0.156
NP_440999.1_9 Forward -275 -261 0.982901 0.172
NP_440888.1_2 Forward -109 -95 15.5352 0.0102
NP_440888.1_2 Reverse -100 -114 9.6354 0.12
NP_440888.1_2 Reverse -308 -322 5.80051 0.262
NP_440491.1_1 Forward -320 -301 16.5653 0.0616
NP_439969.1_3 Forward -114 -95 4.71934 0.214
NP_442277.1_4 Reverse -91 -110 10.2251 0.0949
NP_442277.1_4 Reverse -253 -272 6.09517 0.167
NP_442871.1_4 Forward -381 -362 -1.37794 0.195
NP_440575.1_1 Forward -388 -369 2.45694 0.256
NP_441543.1_2 Reverse -101 -110 18.486 0.00236
NP_441543.1_2 Forward -108 -99 15.9293 0.00518
NP_441543.1_2 Forward -270 -261 6.39124 0.153
NP_441543.1_2 Reverse -263 -272 4.0313 0.293
NP_442845.1_2 Forward -277 -263 8.75105 0.187
NP_442845.1_2 Reverse -256 -270 6.88276 0.201
NP_441551.1_5 Forward -275 -259 8.61263 0.237
NP_441918.1_7 Reverse -31 -50 0.0977854 0.297
NP_441469.1_8 Forward -110 -101 16.126 0.00797
NP_441469.1_8 Forward -92 -83 13.3727 0.073
NP_441469.1_8 Reverse -99 -108 6.5879 0.227
NP_441469.1_8 Reverse -261 -270 5.3096 0.277
NP_442315.1_5 Reverse -371 -381 18.0729 0.195
NP_443064.1_6 Forward -109 -99 10.8217 0.13
NP_442578.1_7 Forward -108 -101 14.5921 0.026
NP_442578.1_7 Reverse -101 -108 14.5921 0.026
NP_440710.1_1 Forward -371 -353 -7.45401 0.238
NP_441462.1_2 Forward -109 -99 20.2362 0.000805
NP_441462.1_2 Reverse -100 -110 11.5831 0.00406
NP_441462.1_2 Reverse -262 -272 9.32148 0.0234
NP_441462.1_2 Forward -271 -261 0.766681 0.125
NP_441621.1_7 Forward -273 -259 -4.62196 0.238
NP_441621.1_7 Forward -111 -97 -5.60527 0.256
NP_443062.1_1 Forward -109 -91 10.4961 0.116
NP_443062.1_1 Forward -271 -253 8.83844 0.145
NP_443062.1_1 Reverse -100 -118 7.86337 0.166
NP_443062.1_1 Reverse -323 -341 3.57305 0.293
NP_443062.1_6 Forward -117 -98 5.99764 0.191
NP_441601.1_4 Reverse -343 -362 -5.9004 0.295
NP_441410.1_3 Reverse -91 -110 6.4893 0.23
NP_442204.1_1 Reverse -258 -269 11.2684 0.0565
NP_442204.1_1 Forward -336 -325 9.79344 0.0736
NP_442204.1_1 Reverse -96 -107 2.02529 0.266
NP_442204.1_2 Reverse -90 -109 8.35759 0.255
NP_442780.1_1 Reverse -50 -69 12.8808 0.149
NP_442872.1_1 Reverse -231 -250 -8.35868 0.241
NP_440516.1_2 Forward -115 -97 5.13236 0.132
NP_440516.1_8 Forward -109 -100 16.9127 0.00442
NP_440516.1_8 Reverse -100 -109 16.9127 0.00442
NP_440516.1_8 Reverse -308 -317 3.7363 0.127
NP_440516.1_8 Reverse -262 -271 -0.393597 0.255
NP_442428.1_4 Forward -318 -299 2.85105 0.247
NP_442428.1_5 Forward -108 -101 15.8704 0.0124
NP_442428.1_5 Reverse -101 -108 15.8704 0.0124
NP_442428.1_5 Forward -270 -263 14.1988 0.0242
NP_442428.1_5 Reverse -263 -270 6.0373 0.212
NP_442120.1_10 Forward -277 -258 -15.5368 0.294
NP_440673.1_2 Reverse -320 -339 10.292 0.217
NP_440673.1_2 Forward -80 -61 8.341 0.273
NP_440673.1_3 Reverse -264 -271 13.2155 0.0426
NP_440673.1_3 Forward -107 -100 12.4288 0.0426
NP_440673.1_3 Reverse -102 -109 12.4288 0.0426
NP_440673.1_4 Forward -120 -101 16.1257 0.143
NP_440718.1_2 Reverse -110 -129 12.4875 0.247
NP_440865.1_9 Forward -277 -258 1.86774 0.117
NP_440865.1_9 Reverse -256 -275 -5.9004 0.218
NP_441052.1_2 Reverse -100 -110 10.5014 0.0285
NP_441052.1_2 Forward -109 -99 10.4031 0.0285
NP_441052.1_2 Reverse -354 -364 0.766681 0.256
NP_442219.1_9 Reverse -227 -236 9.24284 0.0623
NP_442219.1_9 Reverse -101 -110 8.35786 0.0681
NP_442219.1_9 Forward -108 -99 8.25953 0.0681
NP_440436.1_4 Reverse -101 -110 18.1905 0.00233
NP_440436.1_4 Reverse -263 -272 11.7007 0.0483
NP_440436.1_4 Forward -108 -99 9.24241 0.0871
NP_441884.1_8 Reverse -261 -280 -6.78538 0.238
NP_441884.1_9 Forward -112 -93 -22.715 0.284
NP_441884.1_9 Forward -320 -301 -23.305 0.284
NP_440314.1_9 Forward -203 -184 -8.06369 0.245
NP_442907.1_2 Reverse -62 -80 9.55725 0.24
NP_441719.1_4 Forward -108 -101 16.3621 0.0124
NP_441719.1_4 Reverse -101 -108 16.3621 0.0124
NP_441719.1_4 Forward -270 -263 6.62729 0.151
NP_441719.1_4 Reverse -263 -270 6.52896 0.188
NP_441733.1_10 Reverse -97 -110 8.27909 0.14
NP_441733.1_10 Forward -252 -239 4.14919 0.273
NP_441004.1_1 Forward -277 -258 1.17943 0.111
NP_441004.1_1 Reverse -354 -373 -11.9969 0.243
NP_441004.1_1 Reverse -302 -321 -13.1769 0.255
NP_441004.1_1 Reverse -188 -207 -14.8485 0.271
NP_441004.1_1 Forward -251 -232 -18.0934 0.297
NP_442813.1_4 Reverse -178 -197 -4.81876 0.299
NP_442366.1_3 Forward -110 -92 2.37909 0.131
NP_442366.1_3 Reverse -307 -325 -2.63579 0.231
NP_442366.1_3 Forward -272 -254 -5.09406 0.281
NP_442366.1_5 Forward -112 -102 12.7626 0.108
NP_440296.1_10 Forward -89 -70 -5.50708 0.225
NP_440296.1_10 Forward -274 -255 -13.5702 0.269
NP_441115.1_4 Reverse -99 -117 16.2429 0.0301
NP_441115.1_4 Reverse -261 -279 9.6548 0.206
NP_442206.1_1 Reverse -335 -354 -12.7836 0.235
NP_440328.1_4 Reverse -101 -120 0.884433 0.237
NP_443054.1_2 Reverse -98 -112 18.4858 0.0243
NP_443054.1_2 Forward -197 -183 5.70279 0.225
NP_441851.1_10 Forward -110 -100 16.008 0.00552
NP_441851.1_10 Reverse -99 -109 8.53483 0.114
NP_441851.1_10 Forward -272 -262 6.76487 0.156
NP_440593.1_3 Reverse -251 -270 -0.787193 0.209
NP_440593.1_3 Reverse -257 -276 -3.04881 0.231
NP_441982.1_6 Forward -56 -47 11.9124 0.288
NP_440463.1_7 Reverse -255 -269 14.5526 0.296
NP_440165.1_5 Forward -110 -91 -8.26035 0.297
NP_440338.1_4 Forward -58 -39 4.42355 0.298
NP_442689.1_8 Reverse -33 -50 -6.15601 0.28
NP_441349.1_10 Forward -119 -100 -2.36049 0.118
NP_441409.1_6 Forward -115 -96 -5.31042 0.102
NP_442314.1_3 Forward -281 -267 15.9292 0.187
NP_440432.1_9 Forward -108 -93 14.9262 0.0135
NP_439960.1_2 Reverse -86 -105 16.8141 0.112
NP_439960.1_10 Reverse -246 -264 5.42735 0.15
NP_440474.1_8 Reverse -101 -115 7.17714 0.207
NP_440474.1_8 Forward -108 -94 6.29216 0.228
NP_441477.1_5 Forward -360 -341 8.65258 0.272
NP_442450.1_5 Forward -111 -101 7.55152 0.13
NP_440588.1_2 Reverse -253 -272 4.916 0.0752
NP_440588.1_2 Forward -118 -99 -1.57384 0.155
NP_441031.1_1 Forward -49 -30 13.3784 0.126
NP_439950.1_1 Reverse -172 -181 12.2911 0.287
NP_441003.1_9 Reverse -247 -266 14.3558 0.213
NP_441003.1_9 Forward -275 -256 4.52268 0.277
NP_443047.1_7 Reverse -241 -260 9.43923 0.188
NP_440483.1_1 Reverse -181 -200 -1.67217 0.208
NP_441570.1_1 Forward -109 -91 -11.0923 0.187
NP_441078.1_4 Forward -109 -100 19.6659 0.0007
NP_441078.1_4 Reverse -100 -109 19.6659 0.0007
NP_441078.1_4 Forward -271 -262 7.66954 0.052
NP_441078.1_4 Reverse -262 -271 0.491382 0.188
NP_442729.1_5 Reverse -373 -383 8.4365 0.248
NP_441663.1_8 Forward -338 -319 -3.83545 0.298
NP_442443.1_1 Forward -352 -333 11.8975 0.0863
NP_442443.1_1 Reverse -329 -348 11.7008 0.0865
NP_442443.1_1 Forward -340 -321 3.14605 0.177
NP_442443.1_1 Forward -279 -260 -4.32711 0.271
NP_440526.1_3 Reverse -263 -274 9.10461 0.0988
NP_440526.1_3 Reverse -101 -112 2.02482 0.267
NP_440526.1_3 Forward -108 -97 1.92649 0.267
NP_441432.1_8 Reverse -99 -108 16.8143 0.00595
NP_441432.1_8 Reverse -261 -270 8.94785 0.0755
NP_441432.1_8 Forward -110 -101 8.25953 0.0755
NP_442320.1_8 Forward -115 -101 -0.983719 0.0817
NP_442320.1_8 Reverse -94 -108 -3.93365 0.136
NP_441732.1_2 Reverse -258 -274 -16.4611 0.167
NP_440629.1_1 Forward -53 -35 13.0972 0.0706
NP_442815.1_2 Forward -270 -252 2.77242 0.291
NP_440760.1_1 Reverse -262 -281 -21.83 0.245
NP_442797.1_6 Forward -107 -88 8.03112 0.269
NP_441131.1_9 Reverse -299 -318 15.3391 0.164
NP_440713.1_4 Forward -281 -262 9.53756 0.143
NP_442489.1_7 Forward -109 -100 20.1576 0.000695
NP_442489.1_7 Reverse -100 -109 20.1576 0.000695
NP_442489.1_7 Forward -271 -262 8.1612 0.0294
NP_442489.1_7 Reverse -262 -271 0.491382 0.178
NP_442489.1_7 Reverse -308 -317 -1.86856 0.259
NP_440565.1_7 Forward -281 -262 2.45773 0.246
NP_440559.1_1 Reverse -101 -110 8.75118 0.0586
NP_440559.1_1 Forward -108 -99 8.65285 0.0586
NP_440559.1_1 Forward -316 -307 8.1612 0.0618
NP_440559.1_1 Reverse -263 -272 7.76787 0.0918
NP_441659.2_6 Reverse -30 -49 21.7297 0.0377
NP_441659.2_8 Forward -109 -99 20.9245 0.000805
NP_441659.2_8 Reverse -100 -110 11.9764 0.0147
NP_441659.2_8 Forward -271 -261 8.92815 0.0381
NP_441659.2_8 Reverse -262 -272 7.64985 0.0576
NP_441022.1_1 Forward -29 -20 10.8747 0.284
NP_442913.1_9 Reverse -101 -120 6.4893 0.294
NP_442913.1_10 Reverse -91 -110 7.07928 0.0563
NP_441040.1_2 Reverse -306 -325 -10.7186 0.248
NP_439956.1_7 Forward -277 -258 3.24438 0.257
NP_442008.1_2 Forward -274 -255 5.50599 0.226
NP_442008.1_2 Reverse -320 -339 5.40766 0.226
NP_440779.1_5 Forward -109 -92 -5.95935 0.157
NP_442346.1_5 Reverse -99 -109 16.303 0.00248
NP_442346.1_5 Forward -272 -262 15.0247 0.00889
NP_442346.1_5 Reverse -261 -271 14.6313 0.0115
NP_442346.1_5 Forward -110 -100 9.02648 0.118
NP_440545.1_3 Forward -275 -258 13.8052 0.0166
NP_440545.1_3 Reverse -258 -275 6.62702 0.0551
NP_440545.1_3 Reverse -78 -95 -5.56602 0.253
NP_440831.1_3 Forward -280 -261 5.90175 0.28
NP_441629.1_1 Forward -117 -98 26.6471 0.00328
NP_440459.1_2 Forward -118 -101 12.9202 0.133
NP_441653.1_2 Forward -282 -263 4.88249 0.252
NP_440010.1_3 Reverse -303 -322 -5.70374 0.25
NP_440010.1_4 Forward -281 -262 -1.8696 0.273
NP_442137.1_1 Reverse -292 -311 8.45592 0.222
NP_440847.1_3 Reverse -70 -84 13.6669 0.209
NP_441888.1_7 Reverse -257 -271 5.1128 0.225
NP_441948.1_4 Reverse -93 -111 4.9357 0.0857
NP_441948.1_4 Forward -116 -98 0.314141 0.136
NP_441833.1_4 Forward -108 -101 15.9687 0.0124
NP_441833.1_4 Reverse -101 -108 15.9687 0.0124
NP_441833.1_4 Forward -270 -263 6.23397 0.163
NP_441833.1_4 Reverse -263 -270 6.13563 0.198
NP_442162.1_9 Forward -108 -101 16.2637 0.0124
NP_442162.1_9 Reverse -101 -108 16.2637 0.0124
NP_442162.1_9 Forward -270 -263 6.62729 0.142
NP_442162.1_9 Reverse -263 -270 6.43063 0.208
NP_440671.1_1 Reverse -26 -45 8.14085 0.205
NP_440671.1_2 Reverse -326 -340 15.2409 0.193
NP_440671.1_4 Forward -277 -263 9.04604 0.187
NP_440671.1_4 Forward -115 -101 5.30946 0.286
NP_442943.1_1 Forward -48 -33 3.48843 0.267
NP_442045.1_5 Reverse -341 -360 -2.36049 0.294
NP_442045.1_5 Reverse -253 -272 -3.04881 0.296
NP_442073.1_6 Forward -280 -261 -2.65548 0.291
NP_442199.1_5 Reverse -92 -111 10.7175 0.0574
NP_442140.1_3 Reverse -101 -111 16.2046 0.0255
NP_442140.1_3 Reverse -263 -273 10.6981 0.0902
NP_442140.1_3 Reverse -78 -88 8.92815 0.117
NP_442140.1_3 Forward -108 -98 4.69992 0.238
NP_442140.1_3 Forward -270 -260 3.71661 0.283
NP_442723.1_1 Forward -387 -368 5.01354 0.276
NP_441671.1_10 Reverse -251 -270 1.96607 0.257
NP_440875.1_9 Forward -269 -259 16.3536 0.0172
NP_440875.1_9 Forward -107 -97 15.867 0.0233
NP_440875.1_9 Reverse -102 -112 8.46937 0.233
NP_440875.1_9 Reverse -259 -269 7.00932 0.287
NP_441813.1_5 Reverse -98 -108 18.1713 0.00743
NP_441813.1_5 Forward -111 -101 9.91146 0.021
NP_441813.1_5 Reverse -260 -270 8.33817 0.047
NP_441227.1_7 Reverse -101 -120 12.5707 0.275
NP_442089.1_1 Forward -112 -93 2.16274 0.226
NP_440590.1_4 Reverse -101 -114 12.0157 0.0166
NP_440590.1_4 Forward -316 -303 6.50913 0.0575
NP_440590.1_4 Forward -108 -95 2.87088 0.0788
NP_440590.1_4 Forward -270 -257 -5.29059 0.277
NP_440567.1_1 Reverse -101 -115 10.7177 0.033
NP_440567.1_1 Reverse -263 -277 6.98109 0.0795
NP_440567.1_1 Forward -108 -94 0.0979218 0.256
NP_442497.1_10 Forward -108 -99 17.601 0.00813
NP_442497.1_10 Reverse -101 -110 10.4228 0.0087
NP_442497.1_10 Reverse -263 -272 8.1612 0.0625
NP_442497.1_10 Forward -270 -261 7.86621 0.0695
NP_440821.1_4 Forward -111 -101 10.2065 0.0163
NP_440821.1_4 Reverse -98 -108 2.24165 0.131
NP_440821.1_4 Forward -273 -263 1.06167 0.142
NP_440227.1_6 Forward -62 -48 15.0039 0.263
NP_441239.1_9 Reverse -98 -110 15.5753 0.0186
NP_441239.1_9 Reverse -260 -272 13.0187 0.0389
NP_441239.1_9 Forward -273 -261 12.4287 0.0477
NP_441239.1_9 Forward -111 -99 12.3303 0.0477
NP_441239.1_9 Forward -268 -256 3.97222 0.269
NP_441239.1_9 Reverse -75 -87 3.48056 0.285
NP_441951.1_9 Forward -377 -358 -1.27885 0.289
NP_441009.1_4 Reverse -262 -281 13.6675 0.202
NP_441892.1_1 Forward -280 -263 18.0334 0.0226
NP_441892.1_1 Forward -258 -241 -0.551145 0.187
NP_441892.1_1 Reverse -91 -108 -0.551145 0.187
NP_441892.1_1 Forward -333 -316 -4.38605 0.26
NP_441892.1_1 Reverse -253 -270 -4.87771 0.269
NP_440604.1_6 Reverse -262 -281 -4.91709 0.262
NP_442193.1_8 Forward -274 -255 13.5683 0.212
NP_441508.1_1 Reverse -29 -48 16.0358 0.101
NP_441508.1_1 Reverse -39 -58 14.2097 0.143
NP_441508.1_1 Forward -53 -34 11.5187 0.239
NP_442643.1_5 Forward -314 -295 -4.91709 0.293
NP_442629.1_5 Reverse -365 -379 16.5192 0.222
NP_440863.1_2 Forward -57 -41 20.9195 0.103
NP_441541.1_1 Reverse -47 -65 3.24871 0.186
NP_441541.1_1 Reverse -27 -45 -1.71687 0.242
NP_440833.1_6 Forward -392 -378 15.5352 0.14
NP_440354.1_7 Reverse -302 -320 8.08229 0.251
NP_440354.1_7 Reverse -94 -112 7.09898 0.278
NP_442138.1_9 Forward -330 -311 10.6184 0.209
NP_442052.1_8 Forward -273 -263 12.8614 0.253
NP_440546.1_4 Forward -271 -261 13.7304 0.0459
NP_440546.1_4 Forward -109 -99 13.5365 0.0459
NP_440546.1_4 Reverse -262 -272 12.8578 0.0572
NP_440546.1_4 Reverse -100 -110 11.8882 0.0679
NP_441230.1_5 Reverse -257 -276 7.57094 0.166
NP_440462.1_6 Reverse -98 -108 18.7612 0.00454
NP_440462.1_6 Forward -111 -101 9.02648 0.0498
NP_440462.1_6 Reverse -260 -270 8.92815 0.0537
NP_441184.1_3 Forward -279 -260 2.3594 0.293
NP_440868.1_4 Forward -113 -101 8.79043 0.0582
NP_440868.1_4 Reverse -96 -108 7.80712 0.0637
NP_440341.1_1 Reverse -366 -385 8.84924 0.192
NP_440812.1_10 Reverse -330 -343 11.6223 0.259
NP_441848.1_4 Forward -48 -32 8.79206 0.288
NP_441084.1_6 Reverse -98 -112 14.192 0.106
NP_441084.1_6 Forward -326 -312 10.7015 0.231
NP_439942.1_7 Reverse -172 -191 -4.32711 0.248
NP_440696.1_3 Forward -275 -257 -0.7675 0.249
NP_440696.1_3 Reverse -305 -323 -4.01242 0.294
NP_442882.1_8 Forward -251 -232 8.25926 0.249
NP_440843.1_8 Forward -277 -258 11.9958 0.297
NP_442039.1_4 Forward -108 -101 15.1821 0.0124
NP_442039.1_4 Reverse -101 -108 15.1821 0.0124
NP_442039.1_4 Forward -270 -263 6.3323 0.289
NP_441811.1_4 Reverse -98 -117 0.884433 0.29
NP_441811.1_8 Forward -277 -263 9.2427 0.227
NP_440008.1_9 Reverse -256 -275 7.86593 0.283
NP_441926.1_3 Forward -109 -93 6.35172 0.17
NP_440825.1_7 Reverse -101 -111 12.4217 0.155
NP_442837.1_3 Forward -108 -101 15.7721 0.0124
NP_442837.1_3 Reverse -101 -108 15.7721 0.0124
NP_442837.1_3 Forward -270 -263 6.0373 0.25
NP_442837.1_3 Reverse -263 -270 5.93897 0.265
NP_440160.1_1 Reverse -44 -63 10.5334 0.244
NP_440160.1_9 Forward -271 -252 13.3725 0.204
NP_442053.1_1 Forward -109 -100 18.3876 0.0007
NP_442053.1_1 Reverse -100 -109 18.3876 0.0007
NP_440505.1_3 Reverse -98 -108 17.188 0.00332
NP_440505.1_3 Reverse -260 -270 7.84651 0.147
NP_440505.1_3 Forward -111 -101 6.76487 0.169
NP_440351.1_8 Forward -343 -325 5.91901 0.264
NP_441102.1_1 Forward -108 -89 3.04771 0.299
NP_441102.1_2 Forward -78 -59 11.2092 0.225
NP_441252.1_6 Reverse -213 -220 11.6422 0.288
NP_441408.2_7 Forward -273 -254 -3.93378 0.279
NP_440914.1_1 Forward -109 -99 16.3248 0.00196
NP_440914.1_1 Forward -271 -261 13.885 0.022
NP_440914.1_1 Forward -317 -307 9.88379 0.167
NP_440914.1_1 Reverse -100 -110 8.6151 0.186
NP_441011.1_8 Reverse -101 -110 16.9127 0.00602
NP_441011.1_8 Forward -108 -99 16.6177 0.00602
NP_441011.1_8 Forward -270 -261 13.0777 0.0366
NP_441011.1_8 Reverse -263 -272 5.99792 0.208
NP_442533.1_1 Reverse -354 -373 -15.5368 0.256
NP_442533.1_1 Reverse -365 -384 -17.0118 0.279
NP_442533.1_6 Forward -109 -100 17.2076 0.00137
NP_442533.1_6 Reverse -100 -109 17.2076 0.00137
NP_442533.1_6 Reverse -262 -271 15.4377 0.00613
NP_442533.1_6 Forward -271 -262 6.48957 0.109
NP_442533.1_6 Forward -265 -256 4.52295 0.179
NP_442533.1_6 Reverse -274 -283 2.06468 0.275
NP_442533.1_6 Reverse -107 -116 1.96635 0.28
NP_442541.1_10 Reverse -256 -270 5.21053 0.248
NP_440263.1_6 Forward -120 -101 15.0441 0.134
NP_442232.1_3 Forward -279 -260 12.8808 0.052
NP_442322.1_4 Forward -198 -181 -3.60008 0.249
NP_442322.1_4 Forward -377 -360 -7.92662 0.286
NP_442229.1_1 Reverse -98 -112 9.43874 0.184
NP_441482.1_7 Reverse -256 -270 6.58777 0.0271
NP_441482.1_7 Forward -277 -263 -8.94853 0.193
NP_441482.1_7 Reverse -94 -108 -12.1934 0.29
NP_439944.1_9 Forward -108 -98 9.12481 0.1
NP_439944.1_9 Forward -270 -260 6.66654 0.172
NP_439944.1_9 Reverse -263 -273 6.17489 0.192
NP_440116.1_8 Forward -108 -89 -1.96717 0.122
NP_440116.1_8 Reverse -101 -120 -2.85214 0.141
NP_440115.1_6 Forward -274 -264 8.23984 0.135
NP_440115.1_6 Reverse -97 -107 4.89658 0.28
NP_440115.1_6 Reverse -259 -269 4.60159 0.293
NP_441602.1_3 Reverse -257 -276 2.65439 0.195
NP_441972.1_5 Forward -282 -263 -6.78538 0.235
NP_441972.1_5 Reverse -241 -260 -9.53865 0.288
NP_441106.1_1 Reverse -99 -108 18.486 0.0028
NP_441106.1_1 Forward -110 -101 18.191 0.0028
NP_441106.1_1 Reverse -261 -270 8.65285 0.0522
NP_441106.1_1 Forward -272 -263 5.70292 0.131
NP_441106.1_3 Forward -47 -28 22.9106 0.00548
NP_441106.1_3 Forward -67 -48 11.5042 0.217
NP_441825.1_4 Reverse -185 -195 14.0414 0.249
NP_441869.1_2 Reverse -93 -112 9.63589 0.274
NP_439903.1_6 Reverse -259 -278 3.63691 0.207
NP_442588.1_6 Reverse -196 -215 -1.27885 0.268
NP_442588.1_6 Reverse -271 -290 -2.36049 0.294
NP_441286.1_1 Reverse -99 -111 -3.40261 0.145
NP_441286.1_1 Forward -110 -98 -3.59927 0.145
NP_441286.1_1 Reverse -261 -273 -4.28759 0.154
NP_440670.1_8 Forward -109 -100 18.3876 0.000699
NP_440670.1_8 Reverse -100 -109 18.3876 0.000699
NP_440670.1_8 Forward -317 -308 6.48957 0.118
NP_440670.1_8 Reverse -308 -317 3.63797 0.239
NP_441479.1_1 Forward -112 -93 9.63589 0.216
NP_439955.1_10 Forward -206 -187 11.405 0.282
NP_440886.1_7 Forward -110 -100 17.7774 0.0011
NP_440886.1_7 Reverse -99 -109 8.04271 0.0805
NP_440886.1_7 Reverse -106 -116 6.27276 0.134
NP_442717.1_6 Forward -350 -331 11.1109 0.207
NP_442072.1_9 Reverse -99 -117 -12.5672 0.0852
NP_442072.1_9 Forward -117 -99 -14.3372 0.142
NP_442072.1_9 Forward -110 -92 -20.9253 0.204
NP_442072.1_9 Forward -318 -300 -22.6953 0.253
NP_442072.1_9 Reverse -307 -325 -23.187 0.284
NP_440513.1_6 Reverse -90 -109 14.3549 0.189
NP_439899.1_1 Reverse -25 -43 8.76215 0.18
NP_440907.2_8 Reverse -101 -111 14.2375 0.0312
NP_440907.2_8 Forward -108 -98 9.616 0.103
NP_440907.2_8 Reverse -263 -273 6.96107 0.138
NP_441021.1_1 Reverse -263 -282 -8.45701 0.195
NP_441021.1_8 Reverse -95 -113 2.47742 0.246
NP_441463.1_3 Reverse -90 -109 -9.83364 0.286
NP_441463.1_3 Forward -119 -100 -10.3253 0.293
NP_441463.1_5 Forward -110 -96 12.4876 0.188
NP_442056.1_1 Forward -121 -103 13.3922 0.295
NP_441626.1_2 Forward -108 -101 15.7721 0.0124
NP_441626.1_2 Reverse -101 -108 15.7721 0.0124
NP_441626.1_2 Forward -270 -263 6.52896 0.137
NP_441626.1_2 Reverse -263 -270 5.93897 0.231
NP_442362.1_1 Reverse -240 -259 6.09597 0.288
NP_442794.1_5 Forward -274 -260 12.1926 0.275
NP_442615.1_1 Forward -118 -100 12.9988 0.0124
NP_442615.1_1 Reverse -91 -109 -1.45582 0.128
NP_442615.1_1 Reverse -306 -324 -6.66736 0.256
NP_442467.1_4 Forward -109 -90 11.2092 0.159
NP_441962.1_4 Forward -276 -257 -6.68705 0.18
NP_441962.1_4 Forward -270 -251 -7.96535 0.195
NP_441962.1_4 Reverse -331 -350 -13.5702 0.275
NP_440387.1_1 Reverse -100 -116 -0.43312 0.138
NP_441431.1_2 Reverse -97 -111 14.4536 0.0655
NP_441431.1_2 Reverse -259 -273 12.192 0.126
NP_441431.1_2 Forward -274 -260 8.94708 0.2
NP_441431.1_2 Reverse -83 -97 7.3738 0.244
NP_441431.1_2 Forward -112 -98 5.80051 0.288
NP_441065.1_3 Reverse -33 -52 14.5524 0.239
NP_441488.1_8 Reverse -257 -271 8.75042 0.178
NP_441836.1_2 Reverse -256 -275 -1.18052 0.217
NP_441993.1_1 Forward -277 -258 13.2517 0.0868
NP_441993.1_1 Reverse -256 -275 6.81956 0.177
NP_441993.1_1 Reverse -262 -281 3.99329 0.227
NP_441993.1_1 Reverse -354 -373 1.36194 0.28
NP_440814.1_4 Forward -118 -99 -10.9153 0.224
NP_440467.1_3 Reverse -251 -270 12.5258 0.237
NP_440114.1_10 Forward -109 -95 19.3708 0.00349
NP_440114.1_10 Reverse -100 -114 12.291 0.0866
NP_442437.1_8 Forward -282 -263 6.4893 0.242
NP_442698.1_10 Forward -269 -250 1.37609 0.297
NP_442323.1_7 Reverse -257 -276 4.91521 0.21
NP_441206.1_2 Reverse -202 -221 16.1257 0.157
NP_440287.1_5 Reverse -338 -357 12.0933 0.239
NP_440287.1_5 Forward -211 -192 10.9134 0.286
NP_440287.1_6 Forward -118 -99 8.16093 0.151
NP_441272.1_7 Reverse -187 -197 13.353 0.257
NP_440293.1_3 Reverse -254 -273 -0.983855 0.239
NP_440293.1_3 Reverse -186 -205 -5.21209 0.274
NP_440293.1_3 Forward -279 -260 -5.99873 0.285
NP_440293.1_10 Forward -274 -255 -2.85214 0.275
NP_439988.1_3 Forward -270 -256 8.06273 0.266
NP_439988.1_3 Reverse -244 -258 7.9644 0.272
NP_439988.1_3 Reverse -263 -277 3.44117 0.299
NP_442635.1_3 Reverse -254 -273 9.43923 0.194
NP_442635.1_5 Forward -81 -68 19.7838 0.184
NP_439910.1_2 Forward -117 -100 -2.81276 0.0305
NP_440457.1_1 Forward -90 -78 6.03717 0.132
NP_440457.1_1 Forward -275 -263 4.36554 0.165
NP_440457.1_1 Forward -113 -101 0.825626 0.25
NP_440457.1_1 Reverse -370 -382 -0.354346 0.262
NP_440457.1_1 Reverse -96 -108 -0.551008 0.268
NP_440798.1_6 Reverse -101 -114 4.8375 0.143
NP_440798.1_6 Forward -108 -95 3.26421 0.151
NP_441984.1_6 Forward -315 -303 13.412 0.274
NP_441332.1_6 Forward -197 -187 12.034 0.236
NP_441332.1_6 Forward -196 -186 11.9372 0.239
NP_441436.1_6 Reverse -308 -327 6.19431 0.29
NP_441436.1_8 Forward -347 -328 14.7491 0.215
NP_442509.1_5 Reverse -232 -249 17.1476 0.16
NP_442509.1_9 Reverse -100 -110 16.2041 0.00739
NP_442509.1_9 Forward -109 -99 8.04271 0.192
NP_442514.1_5 Forward -385 -366 2.55527 0.167
NP_442514.1_5 Forward -210 -191 -2.26292 0.216
NP_442514.1_6 Forward -281 -262 3.53937 0.28
NP_440554.1_4 Forward -108 -98 17.9746 0.0131
NP_440554.1_4 Forward -270 -260 8.23984 0.0804
NP_440554.1_4 Reverse -101 -111 7.35486 0.103
NP_440554.1_4 Reverse -263 -273 5.38824 0.15
NP_442862.1_3 Forward -130 -113 3.97208 0.298
NP_441845.1_6 Forward -121 -103 -0.7675 0.274
NP_441885.1_5 Reverse -100 -110 11.4848 0.00668
NP_441885.1_5 Forward -109 -99 11.3864 0.00668
NP_441885.1_5 Reverse -262 -272 0.865012 0.117
NP_441885.1_5 Forward -317 -307 -0.216628 0.189
NP_441275.1_1 Forward -66 -48 4.14905 0.168
NP_440478.1_10 Forward -111 -97 8.35772 0.257
NP_442341.1_7 Forward -318 -304 7.47274 0.105
NP_442341.1_7 Reverse -99 -113 1.57289 0.286
NP_442341.1_9 Reverse -98 -112 11.9953 0.115
NP_442341.1_9 Reverse -260 -274 5.40719 0.271
NP_442341.1_9 Forward -111 -97 5.21053 0.277
NP_441756.1_5 Forward -275 -256 16.5191 0.0566
NP_441756.1_5 Forward -113 -94 -2.45882 0.277
NP_441756.1_5 Reverse -247 -266 -3.83545 0.29
NP_442395.2_4 Reverse -261 -280 -0.591301 0.298
NP_443000.1_7 Reverse -98 -108 20.3345 0.00223
NP_443000.1_7 Reverse -260 -270 10.5014 0.0345
NP_443000.1_7 Forward -111 -101 1.94665 0.226
NP_440552.1_8 Forward -63 -46 15.9993 0.11
NP_441561.1_7 Forward -199 -180 7.4718 0.274
NP_441561.1_7 Reverse -229 -248 6.39016 0.274
NP_441842.1_10 Reverse -93 -107 9.34103 0.192
NP_440275.1_3 Reverse -98 -108 16.1063 0.0155
NP_440275.1_3 Forward -111 -101 8.33817 0.0602
NP_440275.1_3 Reverse -260 -270 6.27322 0.118
NP_440275.1_3 Forward -273 -263 1.25834 0.291
NP_440091.1_1 Forward -113 -101 12.6253 0.0353
NP_440091.1_1 Reverse -96 -108 1.41561 0.197
NP_443046.1_9 Forward -220 -202 3.45998 0.278
NP_442451.1_2 Reverse -254 -273 -7.08038 0.232
NP_442686.1_8 Forward -398 -379 16.7157 0.238
NP_439962.1_4 Forward -341 -322 8.84924 0.134
NP_439962.1_4 Reverse -319 -338 -8.26035 0.292
NP_440175.1_4 Forward -251 -232 -11.0136 0.185
NP_442495.1_4 Forward -267 -257 15.713 0.124
NP_442495.1_4 Reverse -327 -337 11.9764 0.251
NP_440149.1_8 Reverse -256 -275 -7.86702 0.294
NP_441105.1_3 Reverse -251 -270 17.404 0.0114
NP_441105.1_3 Forward -282 -263 5.11266 0.0721
NP_441105.1_3 Forward -120 -101 -9.24366 0.286
NP_440216.1_1 Forward -109 -95 25.664 0.000481
NP_440216.1_1 Reverse -100 -114 7.76774 0.00849
NP_440216.1_1 Reverse -107 -121 3.93283 0.028
NP_440216.1_1 Reverse -155 -169 -6.68692 0.145
NP_440216.1_1 Forward -116 -102 -11.6035 0.203
NP_440216.1_1 Forward -271 -257 -12.1934 0.247
NP_440216.1_9 Forward -84 -75 13.1761 0.205
NP_440172.1_1 Forward -109 -99 17.5813 0.00421
NP_440172.1_1 Reverse -262 -272 8.92815 0.0586
NP_440172.1_1 Reverse -100 -110 8.73149 0.0586
NP_440172.1_1 Forward -271 -261 5.09324 0.153
NP_440172.1_1 Reverse -107 -117 2.04498 0.286
NP_442015.1_10 Forward -275 -262 3.5592 0.179
NP_442015.1_10 Forward -113 -100 1.88757 0.204
NP_441045.1_6 Reverse -264 -282 17.8162 0.284
NP_441226.1_7 Forward -108 -101 14.4934 0.0123
NP_441226.1_7 Reverse -101 -108 14.4934 0.0123
NP_441226.1_7 Reverse -263 -270 14.1984 0.024
NP_440198.1_3 Forward -207 -188 13.0766 0.297
NP_442446.1_3 Reverse -250 -269 13.9625 0.222
NP_441111.1_7 Forward -108 -100 18.7023 0.00294
NP_441111.1_7 Reverse -101 -109 18.7023 0.00294
NP_441111.1_7 Forward -270 -262 8.96754 0.0463
NP_440244.1_1 Reverse -366 -385 0.982764 0.187
NP_441766.1_2 Forward -109 -100 17.5026 0.00297
NP_441766.1_2 Reverse -100 -109 17.5026 0.00297
NP_441766.1_2 Reverse -262 -271 8.06287 0.0691
NP_440416.1_1 Forward -109 -90 -11.4069 0.272
NP_440416.1_9 Reverse -255 -274 0.58944 0.0513
NP_440416.1_9 Reverse -93 -112 -16.2252 0.21
NP_440416.1_9 Reverse -343 -362 -17.5035 0.241
NP_440416.1_9 Forward -278 -259 -20.8467 0.289
NP_443052.1_9 Forward -380 -361 -4.72043 0.26
NP_443052.1_9 Reverse -75 -94 -4.91709 0.262
NP_443052.1_9 Forward -374 -355 -5.50708 0.271
NP_440072.1_5 Reverse -365 -383 -3.22577 0.277
NP_440591.1_9 Forward -278 -260 21.5536 0.0158
NP_442564.1_2 Forward -281 -262 7.96426 0.253
NP_440261.1_5 Forward -108 -95 -2.83231 0.0932
NP_440261.1_5 Forward -270 -257 -4.30728 0.145
NP_440261.1_5 Reverse -263 -276 -10.9938 0.23
NP_440261.1_5 Reverse -101 -114 -12.3704 0.284
NP_440988.1_4 Forward -354 -335 12.9791 0.185
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCTAGTTGGACAAATTCACCTTCCCCCTCCCACACTGTCCACAGCCCGTAGTGGGGAAGCTGCCCCAGCAGATGGAGCCAACGACAATCGGCACAGGGTTCATCCAAAAGCATAATATCCCTGGCCGGAGCGATGGCCTGGGCCACAAGGCGGGATTGACGGTTCGGGAACACTGCATTTTGCACCAACAACACCCGGTCTACCCCCAAACCCCGCTGTAATCCTTCCACCACCAGTCGATAAGCATTATGTAAATCCTGGGACTGGAGAATCATTTCCAACAGTTGATCGGCGATCGCCTGTTGGACTGCGGTGCCATGGGAAGAAGGGGACATTGTTACATTCCTTAAAAAAGTGTTACAATAGTTAACATAGACTTTTACTAGGAGTAATCCAATT

CDS

ATGACCACCCGTGGCTTCCGCTTGGATCAGGACAACCGTCTCAACAACTTTGCCATCGAACCAGAGGTTTACGTCGACTCTTCCGTACAAGCGGGTTGGACTAAATACGCCGAAAAAATGAATGGTCGTTTCGCCATGATTGGTTTTGCCTCCCTCCTTATTATGGAAGTGGTCACAGGGCACGGCGTCATTGGTTGGTTAAATAGCCTGTAG

Protein

MTTRGFRLDQDNRLNNFAIEPEVYVDSSVQAGWTKYAEKMNGRFAMIGFASLLIMEVVTGHGVIGWLNSL