Your browser is old and dusty. Try Google Chrome!

Details for ssl2501

ORF ssl2501
Accession NP_440905.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -228 -214 0.88457 0.197
NP_440557.1_1 Forward -228 -209 -2.36049 0.286
NP_440795.1_7 Forward -228 -221 14.6904 0.0123
NP_440795.1_7 Reverse -221 -228 14.6904 0.0123
NP_440795.1_7 Reverse -82 -89 8.8889 0.188
NP_441418.1_6 Forward -229 -210 -22.3217 0.175
NP_442291.1_5 Reverse -219 -235 12.8416 0.0314
NP_441453.1_1 Reverse -213 -231 7.78652 0.21
NP_441453.1_4 Reverse -220 -228 16.539 0.00633
NP_441453.1_4 Forward -229 -221 16.539 0.00633
NP_441453.1_7 Forward -129 -122 14.1988 0.175
NP_442151.1_6 Reverse -220 -234 12.6843 0.0691
NP_442151.1_6 Forward -229 -215 6.3911 0.236
NP_442151.1_6 Forward -242 -228 5.50613 0.274
NP_441818.1_1 Reverse -221 -232 18.446 0.0046
NP_440226.1_1 Forward -229 -210 22.7139 0.00565
NP_441630.1_3 Forward -237 -218 7.47261 0.122
NP_442655.1_1 Reverse -215 -234 3.14605 0.238
NP_442173.1_1 Forward -228 -220 15.4574 0.00633
NP_442173.1_1 Reverse -221 -229 15.4574 0.00633
NP_442752.1_4 Forward -229 -222 13.8055 0.0199
NP_442752.1_4 Reverse -220 -227 13.8055 0.0199
NP_442752.1_4 Forward -124 -117 6.52896 0.154
NP_443027.1_4 Reverse -218 -228 13.943 0.0452
NP_443027.1_4 Forward -231 -221 11.0914 0.107
NP_441812.1_3 Forward -281 -267 16.7159 0.0666
NP_441812.1_3 Forward -230 -216 14.9459 0.106
NP_442975.1_10 Reverse -216 -230 21.3367 0.00107
NP_441225.1_1 Forward -227 -208 -1.57384 0.149
NP_440784.1_7 Forward -228 -221 15.9687 0.0123
NP_440784.1_7 Reverse -221 -228 15.9687 0.0123
NP_442909.1_7 Forward -67 -53 6.29216 0.252
NP_440061.1_9 Reverse -113 -127 8.55376 0.17
NP_440061.1_9 Forward -231 -217 5.1122 0.294
NP_442062.1_8 Forward -229 -219 19.4496 0.000558
NP_442062.1_8 Reverse -220 -230 17.3846 0.00193
NP_440761.1_4 Reverse -99 -118 -13.7669 0.257
NP_441859.1_3 Forward -230 -211 6.39016 0.178
NP_441802.1_1 Forward -186 -167 4.81767 0.286
NP_440304.1_4 Reverse -218 -228 9.91146 0.051
NP_440304.1_4 Forward -231 -221 1.84832 0.299
NP_442242.1_4 Forward -228 -221 14.3954 0.0124
NP_442242.1_4 Reverse -221 -228 14.3954 0.0124
NP_440044.1_8 Forward -228 -209 -0.4922 0.223
NP_441208.1_9 Reverse -107 -121 6.3911 0.246
NP_441208.1_9 Forward -232 -218 4.91614 0.282
NP_441594.1_6 Reverse -211 -230 2.85105 0.242
NP_442110.1_7 Reverse -220 -234 9.93102 0.0684
NP_442110.1_7 Forward -229 -215 0.0979218 0.267
NP_441083.1_5 Reverse -220 -230 20.3345 0.00053
NP_441083.1_5 Forward -229 -219 11.3864 0.0159
NP_441434.1_7 Forward -227 -213 24.0907 0.00706
NP_441738.1_2 Forward -227 -220 15.28 0.0102
NP_441738.1_2 Reverse -222 -229 15.28 0.0102
NP_441738.1_4 Reverse -210 -229 6.19431 0.203
NP_441558.1_5 Forward -231 -212 11.0125 0.0879
NP_441558.1_5 Forward -121 -102 4.62101 0.276
NP_440209.1_1 Reverse -220 -228 18.1123 0.00295
NP_440209.1_1 Forward -229 -221 18.1123 0.00295
NP_442889.1_8 Reverse -217 -231 13.2736 0.0588
NP_440447.1_5 Forward -130 -120 15.123 0.277
NP_440447.1_5 Reverse -119 -129 11.4848 0.291
NP_440178.1_7 Forward -230 -211 -2.65548 0.0389
NP_440178.1_7 Reverse -219 -238 -14.0619 0.148
NP_440178.1_7 Reverse -109 -128 -21.24 0.215
NP_442570.1_3 Forward -138 -119 0.392778 0.207
NP_441716.1_1 Reverse -220 -234 3.8345 0.259
NP_442111.1_4 Forward -230 -216 3.14618 0.253
NP_441533.1_4 Reverse -264 -281 17.2407 0.202
NP_440906.1_5 Forward -228 -221 15.8704 0.0124
NP_440906.1_5 Reverse -221 -228 15.8704 0.0124
NP_442596.1_10 Reverse -329 -348 9.73422 0.281
NP_440747.1_10 Forward -232 -220 16.8536 0.00143
NP_440747.1_10 Reverse -217 -229 -2.02597 0.0196
NP_441130.1_10 Reverse -218 -232 19.2725 0.0114
NP_441130.1_10 Forward -231 -217 15.2409 0.034
NP_441486.1_1 Reverse -217 -231 5.01447 0.0398
NP_441486.1_1 Forward -232 -218 4.52282 0.0432
NP_442634.1_4 Forward -231 -217 -3.34366 0.161
NP_440842.1_10 Forward -122 -108 0.786239 0.299
NP_441014.1_10 Forward -230 -211 4.03023 0.205
NP_441014.1_10 Forward -287 -268 -2.55791 0.28
NP_442848.1_1 Forward -235 -221 7.57108 0.0791
NP_442848.1_1 Reverse -214 -228 5.21113 0.0859
NP_442848.1_5 Reverse -109 -127 -1.65248 0.276
NP_442848.1_9 Forward -235 -216 4.12936 0.208
NP_443018.1_3 Forward -228 -221 14.8871 0.0123
NP_443018.1_3 Reverse -221 -228 14.8871 0.0123
NP_441634.1_8 Forward -231 -217 24.5823 0.00171
NP_441634.1_8 Reverse -51 -65 -2.75368 0.295
NP_441634.1_8 Reverse -108 -122 -4.13031 0.295
NP_440376.1_1 Forward -229 -220 19.4693 0.000692
NP_440376.1_1 Reverse -220 -229 19.4693 0.000692
NP_440376.1_1 Reverse -110 -119 4.52295 0.156
NP_441588.1_4 Reverse -222 -232 8.73149 0.14
NP_441588.1_4 Forward -227 -217 6.96153 0.178
NP_441588.1_4 Forward -117 -107 5.38824 0.272
NP_442730.1_8 Forward -288 -269 19.3698 0.0559
NP_442687.1_7 Reverse -219 -229 15.8113 0.0125
NP_442687.1_7 Forward -230 -220 8.92815 0.0994
NP_441077.1_2 Forward -324 -305 1.67069 0.282
NP_440066.1_5 Reverse -121 -140 6.1935 0.286
NP_441846.1_10 Reverse -43 -62 -23.5016 0.289
NP_441013.1_2 Forward -141 -123 0.510803 0.254
NP_441422.1_7 Forward -231 -214 6.43035 0.0992
NP_442658.1_1 Reverse -218 -228 18.7607 0.00222
NP_442658.1_1 Forward -231 -221 7.94438 0.199
NP_440141.1_8 Reverse -211 -230 6.39097 0.261
NP_441855.2_4 Reverse -212 -231 11.2584 0.221
NP_442205.1_9 Reverse -214 -230 5.36841 0.136
NP_441414.1_9 Reverse -220 -239 -1.37718 0.0996
NP_441478.1_3 Forward -142 -123 14.7491 0.138
NP_442937.1_5 Reverse -215 -234 11.3075 0.141
NP_442937.1_5 Forward -155 -136 10.8159 0.152
NP_442937.1_5 Forward -70 -51 8.45592 0.22
NP_442937.1_5 Forward -291 -272 6.88262 0.268
NP_442321.1_4 Forward -145 -126 -8.65367 0.289
NP_441958.1_5 Forward -230 -220 12.2714 0.00183
NP_441958.1_5 Reverse -219 -229 12.2714 0.00183
NP_442836.1_5 Forward -235 -216 11.9958 0.0822
NP_440984.1_7 Forward -234 -220 9.34103 0.127
NP_440984.1_7 Reverse -215 -229 6.88276 0.195
NP_439990.1_5 Forward -234 -221 12.5073 0.11
NP_442911.1_2 Forward -239 -220 5.89931 0.0311
NP_442911.1_2 Reverse -210 -229 -3.3438 0.111
NP_442911.1_2 Reverse -131 -150 -10.1286 0.27
NP_441580.1_6 Reverse -209 -228 3.83436 0.117
NP_440153.1_5 Reverse -221 -235 11.3077 0.0763
NP_440153.1_5 Forward -228 -214 2.65453 0.219
NP_441591.1_10 Forward -231 -212 5.70265 0.295
NP_443055.1_6 Reverse -212 -230 10.9331 0.114
NP_443055.1_6 Forward -294 -276 3.55831 0.195
NP_440993.1_2 Forward -234 -218 4.87675 0.249
NP_441099.1_8 Reverse -147 -165 18.1112 0.141
NP_442002.1_9 Reverse -219 -226 10.7572 0.185
NP_441294.1_7 Reverse -216 -230 17.8896 0.00674
NP_441646.1_1 Reverse -103 -122 2.26107 0.219
NP_442438.1_10 Reverse -215 -229 12.1926 0.0412
NP_442438.1_10 Forward -234 -220 6.48943 0.114
NP_441000.1_6 Forward -230 -216 5.01447 0.0933
NP_441000.1_6 Reverse -219 -233 4.91614 0.0933
NP_441674.1_6 Reverse -111 -130 4.52268 0.261
NP_440147.1_4 Forward -231 -218 16.8339 0.00906
NP_440147.1_4 Reverse -218 -231 11.0324 0.0341
NP_440147.1_4 Reverse -241 -254 2.87088 0.202
NP_441550.1_8 Forward -231 -221 15.1225 0.0132
NP_441550.1_8 Reverse -218 -228 10.501 0.066
NP_441550.1_8 Forward -339 -329 6.27276 0.214
NP_441916.1_7 Forward -229 -219 18.4663 0.00144
NP_441916.1_7 Reverse -220 -230 10.3048 0.0261
NP_440206.1_9 Reverse -120 -139 22.5172 0.0291
NP_441041.1_4 Reverse -328 -347 -6.88371 0.176
NP_441041.1_7 Reverse -217 -229 19.5648 0.00277
NP_441041.1_7 Forward -232 -220 10.8188 0.0864
NP_441041.1_7 Forward -93 -81 6.93171 0.185
NP_440703.1_9 Forward -118 -105 10.1468 0.208
NP_441725.1_5 Forward -228 -218 9.02648 0.0553
NP_441725.1_5 Reverse -221 -231 2.04498 0.115
NP_441725.1_5 Reverse -104 -114 -0.118297 0.232
NP_439966.1_7 Reverse -218 -228 17.4824 0.00636
NP_439966.1_7 Forward -231 -221 15.3192 0.0152
NP_439966.1_9 Reverse -218 -227 10.7178 0.0863
NP_442941.1_3 Reverse -221 -231 19.2529 0.00262
NP_442941.1_3 Forward -228 -218 2.53664 0.14
NP_440289.1_2 Reverse -217 -230 19.6855 0.00426
NP_440289.1_2 Forward -232 -219 5.91914 0.0605
NP_440289.1_2 Forward -93 -80 -1.06236 0.221
NP_441514.1_6 Reverse -42 -49 14.2971 0.248
NP_442281.1_1 Reverse -215 -229 16.8135 0.00698
NP_442281.1_1 Forward -234 -220 16.4202 0.00801
NP_442281.1_1 Forward -394 -380 3.04726 0.246
NP_442281.1_1 Forward -117 -103 2.65393 0.26
NP_441079.1_4 Reverse -106 -125 15.2979 0.285
NP_442256.1_2 Reverse -218 -236 -9.0273 0.247
NP_440437.1_1 Forward -235 -216 10.5209 0.0437
NP_441457.1_7 Forward -231 -212 1.17943 0.276
NP_440723.1_4 Reverse -217 -236 -0.39387 0.16
NP_441644.1_6 Reverse -220 -230 17.3841 0.00127
NP_441644.1_6 Forward -229 -219 10.1076 0.0628
NP_441644.1_6 Reverse -110 -120 6.27276 0.163
NP_441644.1_6 Forward -119 -109 4.50281 0.235
NP_442215.1_2 Reverse -218 -234 14.7098 0.0195
NP_442215.1_2 Reverse -101 -117 -4.46469 0.233
NP_442215.1_2 Forward -138 -122 -5.54633 0.251
NP_442029.1_6 Reverse -110 -129 7.17762 0.225
NP_440253.1_2 Forward -229 -211 15.6538 0.0157
NP_440253.1_2 Reverse -220 -238 2.18243 0.142
NP_440929.1_8 Forward -229 -220 19.2726 0.000701
NP_440929.1_8 Reverse -220 -229 19.2726 0.000701
NP_442933.1_10 Forward -229 -220 17.601 0.00325
NP_442933.1_10 Reverse -220 -229 17.601 0.00325
NP_441751.2_8 Reverse -221 -235 -4.52363 0.174
NP_441751.2_8 Forward -228 -214 -5.40861 0.206
NP_441751.2_8 Reverse -82 -96 -6.58858 0.273
NP_442554.1_8 Reverse -221 -231 16.2046 0.0065
NP_442554.1_8 Forward -228 -218 16.008 0.0065
NP_442554.1_8 Reverse -111 -121 7.45319 0.092
NP_442554.1_8 Forward -118 -108 3.71661 0.215
NP_441762.1_7 Forward -230 -218 12.4287 0.0142
NP_441762.1_7 Reverse -219 -231 2.39892 0.0676
NP_442313.1_4 Reverse -110 -129 7.66927 0.286
NP_442142.1_4 Forward -232 -219 14.7683 0.0302
NP_442142.1_4 Reverse -217 -230 13.8833 0.0324
NP_442292.1_1 Reverse -221 -230 18.486 0.00229
NP_442292.1_1 Forward -228 -219 9.63616 0.0183
NP_442476.1_6 Forward -228 -214 3.44117 0.156
NP_442476.1_6 Reverse -221 -235 1.67122 0.207
NP_440895.1_10 Forward -230 -213 3.48043 0.149
NP_442381.1_8 Reverse -217 -236 -13.7669 0.279
NP_443009.1_5 Forward -230 -219 18.3477 0.00265
NP_441715.1_4 Reverse -221 -231 17.3846 0.0106
NP_441715.1_4 Forward -228 -218 9.32148 0.097
NP_441448.1_1 Forward -262 -243 4.71934 0.273
NP_440158.1_8 Reverse -101 -120 10.2259 0.249
NP_440379.1_5 Reverse -211 -230 -11.7019 0.3
NP_441468.1_1 Forward -228 -221 15.8704 0.0124
NP_441468.1_1 Reverse -221 -228 15.8704 0.0124
NP_441020.2_6 Reverse -218 -235 6.52869 0.262
NP_441020.2_6 Forward -231 -214 5.84037 0.289
NP_441015.1_10 Reverse -215 -234 -2.26216 0.178
NP_441015.1_10 Forward -124 -105 -10.522 0.284
NP_441673.1_1 Forward -229 -220 20.8459 0.000698
NP_441673.1_1 Reverse -220 -229 20.8459 0.000698
NP_441876.1_9 Reverse -166 -176 12.2709 0.267
NP_441826.1_2 Forward -235 -221 14.6509 0.0196
NP_441826.1_2 Reverse -214 -228 2.65453 0.123
NP_441826.1_2 Forward -118 -104 -4.22864 0.293
NP_441637.1_9 Forward -157 -139 -3.81576 0.296
NP_442868.1_6 Forward -231 -221 19.2529 0.00563
NP_442868.1_6 Reverse -218 -228 8.53483 0.0555
NP_442719.1_2 Forward -157 -139 -10.8963 0.284
NP_442719.1_2 Reverse -152 -170 -11.1913 0.29
NP_441612.1_2 Reverse -220 -230 8.54929 0.21
NP_442427.1_8 Reverse -211 -230 13.8641 0.135
NP_442808.1_1 Reverse -219 -229 18.4657 0.00201
NP_442808.1_1 Forward -230 -220 8.63269 0.0481
NP_440145.1_3 Reverse -210 -229 2.0644 0.121
NP_442542.1_2 Reverse -218 -231 19.0955 0.0177
NP_442113.1_10 Forward -69 -50 -4.32711 0.224
NP_442050.1_5 Forward -231 -221 14.3359 0.0206
NP_442050.1_5 Reverse -218 -228 8.23937 0.234
NP_440558.1_2 Forward -122 -103 8.75091 0.108
NP_440558.1_2 Reverse -106 -125 5.30933 0.145
NP_441518.1_3 Reverse -210 -229 5.30933 0.05
NP_441878.1_6 Forward -230 -220 10.4031 0.0176
NP_441878.1_6 Reverse -219 -229 10.4031 0.0176
NP_441878.1_6 Reverse -109 -119 1.455 0.0979
NP_441878.1_6 Forward -120 -110 1.06167 0.116
NP_441036.1_8 Reverse -219 -229 17.7779 0.000554
NP_441036.1_8 Forward -230 -220 8.33817 0.174
NP_441557.1_5 Forward -229 -220 19.9609 0.000699
NP_441557.1_5 Reverse -220 -229 19.9609 0.000699
NP_441445.1_1 Reverse -211 -230 12.5858 0.0675
NP_442066.2_9 Reverse -216 -229 8.47575 0.185
NP_442066.2_9 Forward -233 -220 8.37742 0.185
NP_442419.1_2 Forward -234 -215 6.29264 0.152
NP_441739.1_2 Reverse -13 -29 5.26939 0.228
NP_441308.1_8 Reverse -218 -228 9.22315 0.226
NP_440101.1_3 Reverse -215 -234 8.25926 0.165
NP_441458.1_10 Forward -238 -219 1.96607 0.277
NP_442183.1_1 Forward -229 -215 16.6175 0.0139
NP_442397.1_9 Reverse -103 -122 3.04771 0.264
NP_441574.1_1 Reverse -208 -227 -3.3438 0.238
NP_441549.1_9 Forward -66 -48 -9.61729 0.256
NP_442347.1_2 Reverse -221 -230 12.4878 0.056
NP_442347.1_2 Forward -228 -219 11.1111 0.056
NP_442645.1_2 Forward -237 -218 -3.04881 0.0487
NP_442645.1_2 Reverse -212 -231 -20.5517 0.288
NP_441037.1_4 Reverse -218 -228 16.2838 0.0168
NP_441633.1_3 Forward -231 -218 20.5705 0.00512
NP_441633.1_3 Reverse -218 -231 -3.71729 0.177
NP_441633.1_3 Forward -271 -258 -4.9956 0.22
NP_440136.1_2 Forward -228 -221 15.9687 0.0123
NP_440136.1_2 Reverse -221 -228 15.9687 0.0123
NP_442590.1_10 Reverse -97 -116 6.29264 0.246
NP_442590.1_10 Reverse -103 -122 3.53937 0.29
NP_441728.2_4 Forward -327 -308 12.6523 0.271
NP_442998.1_5 Reverse -2 -12 8.82982 0.261
NP_442998.1_10 Forward -227 -220 15.5754 0.0102
NP_442998.1_10 Reverse -222 -229 15.5754 0.0102
NP_440299.1_1 Forward -233 -220 12.0151 0.0427
NP_440299.1_1 Forward -284 -271 6.31189 0.146
NP_440299.1_1 Forward -154 -141 3.36198 0.247
NP_441799.1_1 Reverse -216 -230 9.04542 0.1
NP_441799.1_1 Forward -233 -219 7.27547 0.147
NP_441007.1_10 Reverse -215 -228 5.52582 0.18
NP_441007.1_10 Forward -234 -221 0.60927 0.221
NP_442334.1_2 Forward -122 -105 -13.8258 0.297
NP_442333.2_5 Forward -123 -104 -7.17871 0.227
NP_440256.1_1 Forward -232 -213 17.3057 0.00544
NP_440256.1_1 Reverse -217 -236 -5.80207 0.193
NP_440256.1_1 Reverse -107 -126 -7.86702 0.247
NP_440521.1_5 Reverse -225 -243 13.7855 0.277
NP_441559.1_8 Forward -234 -220 -5.80194 0.27
NP_441559.1_8 Forward -129 -115 -6.58858 0.279
NP_440915.1_6 Forward -233 -219 11.3077 0.0263
NP_440915.1_6 Reverse -216 -230 6.3911 0.0826
NP_442158.1_4 Forward -132 -122 13.7464 0.212
NP_442866.1_1 Reverse -98 -117 1.47442 0.158
NP_442866.1_4 Reverse -104 -123 9.73422 0.164
NP_441464.1_8 Forward -229 -215 10.521 0.178
NP_441464.1_8 Reverse -139 -153 3.93283 0.283
NP_441939.1_3 Forward -228 -209 6.88262 0.22
NP_441939.1_3 Reverse -221 -240 6.88262 0.22
NP_442993.1_1 Forward -229 -213 -0.0397962 0.0684
NP_442386.1_9 Reverse -219 -228 15.7322 0.0144
NP_442386.1_9 Forward -230 -221 13.8639 0.0289
NP_442386.1_9 Reverse -80 -89 4.91586 0.276
NP_441340.1_5 Forward -228 -221 15.6737 0.0124
NP_441340.1_5 Reverse -221 -228 15.6737 0.0124
NP_442484.1_2 Forward -240 -221 -0.688862 0.271
NP_442791.1_5 Reverse -212 -231 -11.2103 0.287
NP_442240.1_2 Reverse -221 -240 -19.6667 0.295
NP_440586.1_8 Forward -228 -221 13.2151 0.026
NP_440586.1_8 Reverse -221 -228 13.2151 0.026
NP_440586.1_8 Forward -279 -272 10.7568 0.128
NP_442251.1_6 Forward -228 -221 15.2804 0.0124
NP_442251.1_6 Reverse -221 -228 15.2804 0.0124
NP_441262.1_3 Reverse -220 -227 14.7888 0.0223
NP_441262.1_3 Forward -229 -222 14.7888 0.0223
NP_440027.1_3 Reverse -210 -228 2.87 0.284
NP_440027.1_3 Forward -236 -218 2.28001 0.292
NP_443051.1_1 Reverse -219 -228 10.4228 0.00754
NP_443051.1_1 Forward -230 -221 10.4228 0.00754
NP_440439.1_1 Reverse -217 -230 2.47756 0.133
NP_440439.1_1 Forward -232 -219 1.9859 0.138
NP_440372.1_2 Forward -228 -221 16.3621 0.0124
NP_440372.1_2 Reverse -221 -228 16.3621 0.0124
NP_442783.1_8 Forward -49 -30 16.3215 0.216
NP_441803.1_2 Reverse -215 -234 4.52268 0.177
NP_439977.1_5 Reverse -214 -233 5.89931 0.141
NP_442384.1_10 Reverse -220 -233 13.4906 0.0197
NP_442114.1_4 Forward -229 -218 12.1534 0.107
NP_440364.1_7 Forward -288 -269 17.2074 0.121
NP_442262.1_10 Forward -228 -221 14.1988 0.0123
NP_442262.1_10 Reverse -221 -228 14.1988 0.0123
NP_441689.1_5 Forward -231 -221 5.78111 0.197
NP_440344.1_10 Reverse -213 -230 9.47861 0.00838
NP_440344.1_10 Forward -396 -379 -11.3676 0.212
NP_440531.1_6 Forward -127 -108 -5.21209 0.294
NP_441965.1_10 Reverse -217 -233 2.22182 0.289
NP_442693.1_7 Forward -126 -107 11.1109 0.227
NP_440297.1_9 Reverse -221 -231 -0.118297 0.282
NP_440297.1_9 Forward -228 -218 -0.216628 0.282
NP_441896.1_3 Reverse -211 -230 10.2259 0.0847
NP_441103.1_2 Forward -240 -222 6.40989 0.298
NP_440894.1_10 Forward -247 -228 11.3075 0.147
NP_440894.1_10 Reverse -108 -127 2.94938 0.279
NP_440999.1_9 Reverse -216 -230 14.1593 0.0277
NP_440999.1_9 Forward -233 -219 2.06454 0.154
NP_440888.1_2 Reverse -220 -234 20.0584 0.000881
NP_440888.1_2 Forward -229 -215 16.5185 0.00647
NP_440888.1_2 Forward -286 -272 9.24208 0.134
NP_440888.1_2 Reverse -110 -124 5.99717 0.254
NP_440803.1_3 Forward -151 -132 3.6377 0.286
NP_440491.1_1 Reverse -217 -236 15.2983 0.0862
NP_442033.1_10 Reverse -218 -237 -4.81876 0.179
NP_441543.1_2 Forward -228 -219 18.486 0.00236
NP_441543.1_2 Reverse -221 -230 16.9127 0.00359
NP_441543.1_2 Forward -279 -270 5.70292 0.181
NP_441543.1_3 Forward -46 -32 5.60385 0.288
NP_442845.1_2 Forward -125 -111 4.42448 0.259
NP_442845.1_2 Reverse -75 -89 3.24451 0.298
NP_441469.1_8 Reverse -219 -228 16.126 0.00797
NP_441469.1_8 Forward -230 -221 6.48957 0.227
NP_443064.1_6 Reverse -220 -230 12.5669 0.0796
NP_442578.1_7 Forward -228 -221 14.5921 0.026
NP_442578.1_7 Reverse -221 -228 14.5921 0.026
NP_440071.1_2 Forward -122 -108 16.2242 0.24
NP_440220.1_4 Forward -143 -124 -3.14789 0.285
NP_440148.1_1 Forward -32 -13 -4.22878 0.219
NP_441462.1_2 Forward -229 -219 11.5831 0.00406
NP_441462.1_2 Reverse -220 -230 11.5831 0.00406
NP_441621.1_7 Reverse -218 -232 -3.24533 0.188
NP_441621.1_7 Forward -231 -217 -3.44199 0.188
NP_441929.1_6 Reverse -127 -146 4.81767 0.294
NP_443062.1_6 Forward -237 -218 6.58763 0.18
NP_442204.1_1 Forward -233 -222 2.22195 0.266
NP_442204.1_5 Forward -239 -220 -0.590531 0.293
NP_441560.1_3 Reverse -44 -62 5.13236 0.298
NP_440516.1_2 Forward -131 -113 -0.177514 0.246
NP_440516.1_8 Forward -229 -220 16.9127 0.00442
NP_440516.1_8 Reverse -220 -229 16.9127 0.00442
NP_441785.1_1 Reverse -380 -394 13.417 0.219
NP_442428.1_5 Forward -228 -221 15.8704 0.0124
NP_442428.1_5 Reverse -221 -228 15.8704 0.0124
NP_440673.1_2 Forward -129 -110 8.63366 0.264
NP_440673.1_3 Forward -227 -220 12.4288 0.0426
NP_440673.1_3 Reverse -222 -229 12.4288 0.0426
NP_440673.1_7 Forward -240 -221 3.83436 0.197
NP_440865.1_9 Reverse -214 -233 -4.6221 0.207
NP_441052.1_2 Reverse -220 -230 19.9412 0.00106
NP_441052.1_2 Forward -229 -219 10.5014 0.0285
NP_441052.1_2 Forward -119 -109 4.3066 0.161
NP_442219.1_8 Reverse -216 -235 10.9695 0.19
NP_442219.1_9 Reverse -221 -230 17.7976 0.00718
NP_442219.1_9 Forward -228 -219 8.35786 0.0681
NP_442219.1_9 Forward -89 -80 5.70292 0.135
NP_440436.1_4 Forward -228 -219 18.1905 0.00233
NP_440436.1_4 Reverse -221 -230 17.2072 0.00233
NP_441884.1_9 Reverse -217 -236 -4.03212 0.0594
NP_441719.1_4 Forward -228 -221 16.3621 0.0124
NP_441719.1_4 Reverse -221 -228 16.3621 0.0124
NP_441733.1_10 Reverse -217 -230 10.639 0.106
NP_441733.1_10 Forward -232 -219 9.85238 0.106
NP_441004.1_1 Reverse -121 -140 -17.4051 0.291
NP_441004.1_1 Forward -188 -169 -17.7985 0.294
NP_442366.1_3 Reverse -219 -237 5.82068 0.0829
NP_442366.1_3 Forward -331 -313 0.609134 0.167
NP_442366.1_3 Reverse -229 -247 -4.01242 0.262
NP_441115.1_4 Reverse -219 -237 12.8997 0.0942
NP_442206.1_10 Reverse -328 -343 4.69978 0.178
NP_440328.1_4 Forward -235 -216 5.30933 0.148
NP_443054.1_2 Forward -231 -217 19.7641 0.0121
NP_443054.1_2 Reverse -1 -15 2.65453 0.242
NP_441851.1_10 Reverse -219 -229 16.008 0.00552
NP_441851.1_10 Forward -230 -220 15.8113 0.00552
NP_442208.1_5 Reverse -43 -62 -7.86702 0.275
NP_442001.1_4 Forward -345 -326 13.5683 0.189
NP_441668.1_4 Forward -239 -220 1.37609 0.215
NP_442515.1_1 Forward -230 -216 5.30946 0.107
NP_442515.1_1 Reverse -138 -152 1.47456 0.158
NP_442515.1_1 Forward -113 -99 -2.75368 0.279
NP_440593.1_3 Forward -234 -215 -1.27885 0.211
NP_440463.1_8 Reverse -109 -128 11.1788 0.203
NP_441046.1_2 Reverse -266 -285 7.86593 0.221
NP_441349.1_10 Forward -239 -220 -0.295539 0.0936
NP_441661.1_3 Forward -156 -139 -6.05768 0.283
NP_440432.1_9 Forward -228 -213 7.94471 0.0427
NP_440432.1_9 Reverse -221 -236 3.22482 0.0967
NP_442843.1_1 Forward -228 -209 -11.2103 0.286
NP_439960.1_10 Forward -236 -218 -1.75081 0.245
NP_440474.1_8 Forward -228 -214 11.897 0.0963
NP_441124.1_5 Forward -161 -151 10.9073 0.272
NP_440195.1_5 Reverse -214 -233 1.76941 0.28
NP_442006.1_2 Reverse -328 -345 -19.1357 0.299
NP_443047.1_7 Forward -228 -209 8.35759 0.211
NP_442243.1_1 Forward -125 -107 2.28001 0.204
NP_442243.1_3 Forward -350 -331 17.3048 0.1
NP_441570.1_1 Forward -229 -211 -8.63398 0.117
NP_441570.1_1 Reverse -220 -238 -9.51896 0.139
NP_441570.1_1 Reverse -110 -128 -16.5005 0.247
NP_441078.1_4 Forward -229 -220 19.6659 0.0007
NP_441078.1_4 Reverse -220 -229 19.6659 0.0007
NP_441078.1_4 Forward -119 -110 -1.37691 0.254
NP_441078.1_4 Reverse -110 -119 -1.47524 0.266
NP_442348.1_2 Forward -330 -321 14.7494 0.146
NP_442348.1_2 Forward -137 -128 7.07956 0.291
NP_441094.1_6 Reverse -213 -230 8.78956 0.261
NP_440526.1_3 Forward -228 -217 11.7595 0.0646
NP_440526.1_3 Reverse -221 -232 10.2846 0.0646
NP_440526.1_3 Forward -388 -377 6.74468 0.184
NP_441432.1_8 Forward -230 -221 16.8143 0.00595
NP_441432.1_8 Reverse -219 -228 8.25953 0.0755
NP_441432.1_8 Reverse -109 -118 3.44131 0.245
NP_441432.1_8 Reverse -276 -285 2.85133 0.281
NP_442320.1_8 Reverse -214 -228 16.5192 0.00763
NP_442320.1_8 Forward -235 -221 4.32615 0.0511
NP_441732.1_2 Forward -233 -217 -15.0844 0.145
NP_440760.1_1 Forward -229 -210 -3.54046 0.0345
NP_440760.1_1 Reverse -220 -239 -6.49039 0.0597
NP_440199.1_10 Reverse -72 -82 8.04317 0.231
NP_440199.1_10 Forward -232 -222 7.25653 0.231
NP_442353.1_5 Forward -48 -29 19.2723 0.104
NP_440913.1_1 Forward -231 -213 13.2938 0.139
NP_440913.1_1 Reverse -218 -236 6.11567 0.23
NP_442968.1_8 Reverse -111 -130 16.7157 0.116
NP_441072.1_2 Reverse -99 -118 9.43923 0.218
NP_442489.1_7 Forward -229 -220 20.1576 0.000695
NP_442489.1_7 Reverse -220 -229 20.1576 0.000695
NP_442489.1_7 Forward -119 -110 -1.37691 0.195
NP_442489.1_7 Reverse -110 -119 -1.47524 0.203
NP_441706.1_10 Forward -232 -213 13.0775 0.158
NP_440559.1_1 Reverse -221 -230 17.4043 0.00658
NP_440559.1_1 Forward -228 -219 8.75118 0.0586
NP_441659.2_8 Reverse -220 -230 18.1713 0.00133
NP_441659.2_8 Forward -229 -219 11.9764 0.0147
NP_442913.1_10 Forward -238 -219 8.16093 0.0491
NP_442913.1_10 Reverse -211 -230 -6.1954 0.296
NP_442849.1_1 Forward -173 -159 10.816 0.203
NP_442849.1_1 Forward -185 -171 7.9644 0.282
NP_440779.1_5 Forward -229 -212 -14.5141 0.246
NP_442346.1_5 Forward -230 -220 16.6963 0.00248
NP_442346.1_5 Reverse -219 -229 9.02648 0.118
NP_442346.1_5 Reverse -109 -119 5.19158 0.256
NP_442346.1_5 Forward -120 -110 4.99491 0.267
NP_440545.1_3 Reverse -106 -123 -0.354483 0.152
NP_440545.1_3 Reverse -112 -129 -6.54933 0.283
NP_440545.1_5 Reverse -106 -123 18.2301 0.108
NP_440831.1_3 Reverse -118 -137 6.09591 0.275
NP_440459.1_2 Reverse -101 -118 11.0519 0.183
NP_440459.1_2 Reverse -218 -235 9.57695 0.224
NP_440459.1_2 Reverse -269 -286 8.7903 0.249
NP_440459.1_2 Forward -238 -221 8.20031 0.267
NP_441653.1_2 Reverse -209 -228 4.30269 0.258
NP_440010.1_3 Reverse -322 -341 -8.16202 0.294
NP_442603.1_7 Reverse -220 -234 12.6836 0.0948
NP_441888.1_7 Forward -234 -220 2.45787 0.225
NP_441948.1_4 Reverse -213 -231 -1.55415 0.146
NP_441948.1_4 Forward -236 -218 -2.0458 0.158
NP_441833.1_4 Forward -228 -221 15.9687 0.0124
NP_441833.1_4 Reverse -221 -228 15.9687 0.0124
NP_441895.1_2 Reverse -121 -140 -17.3068 0.217
NP_441895.1_2 Reverse -120 -139 -17.7001 0.234
NP_442162.1_9 Forward -228 -221 16.2637 0.0124
NP_442162.1_9 Reverse -221 -228 16.2637 0.0124
NP_440671.1_4 Reverse -214 -228 6.98109 0.23
NP_440671.1_4 Forward -235 -221 6.88276 0.233
NP_442404.1_9 Reverse -141 -155 8.94708 0.289
NP_442140.1_3 Forward -228 -218 17.4829 0.0159
NP_442140.1_3 Reverse -221 -231 10.3048 0.0902
NP_441671.1_10 Forward -130 -111 1.96607 0.257
NP_440875.1_9 Forward -227 -217 17.619 0.0104
NP_440875.1_9 Reverse -222 -232 7.69067 0.255
NP_440875.1_9 Reverse -112 -122 6.81464 0.297
NP_441813.1_5 Forward -231 -221 18.1713 0.00743
NP_441813.1_5 Reverse -218 -228 10.0098 0.0208
NP_442089.1_1 Forward -232 -213 -2.45882 0.298
NP_440590.1_4 Reverse -221 -234 21.0621 0.00401
NP_440590.1_4 Forward -228 -215 11.9173 0.0173
NP_440567.1_1 Forward -228 -214 4.42448 0.121
NP_440567.1_1 Reverse -111 -125 0.589577 0.24
NP_442497.1_10 Forward -228 -219 10.4228 0.0087
NP_442497.1_10 Reverse -221 -230 10.4228 0.0087
NP_440821.1_4 Reverse -218 -228 18.7612 0.00422
NP_440821.1_4 Forward -231 -221 9.41981 0.0286
NP_440821.1_4 Reverse -79 -89 2.92996 0.131
NP_441239.1_9 Reverse -218 -230 16.0669 0.0175
NP_441239.1_9 Forward -231 -219 7.80712 0.148
NP_441239.1_9 Forward -121 -109 5.54551 0.217
NP_440400.1_1 Forward -346 -327 7.07848 0.22
NP_441892.1_1 Reverse -211 -228 6.72535 0.0936
NP_441892.1_1 Forward -128 -111 -5.66436 0.285
NP_441017.1_6 Forward -233 -219 12.2903 0.221
NP_440949.1_7 Forward -397 -378 14.1583 0.195
NP_442138.1_5 Reverse -125 -144 10.0292 0.276
NP_442138.1_9 Forward -125 -106 10.7167 0.208
NP_442809.1_6 Forward -124 -105 7.57094 0.256
NP_440546.1_4 Forward -229 -219 11.8882 0.0679
NP_440546.1_4 Reverse -220 -230 10.046 0.109
NP_440546.1_4 Reverse -328 -338 9.75513 0.121
NP_440546.1_4 Forward -337 -327 8.00989 0.209
NP_440675.1_1 Reverse -100 -119 9.73422 0.195
NP_440462.1_6 Reverse -218 -228 17.9746 0.00578
NP_440462.1_6 Forward -231 -221 9.61647 0.0429
NP_440868.1_4 Reverse -216 -228 9.77374 0.043
NP_440868.1_4 Forward -233 -221 1.02229 0.193
NP_441868.1_4 Forward -126 -112 14.2576 0.282
NP_440905.1_1 Forward -57 -39 25.9785 0.00433
NP_440905.1_2 Forward -25 -8 24.9166 0.022
NP_442402.1_4 Reverse -107 -126 -8.6544 0.284
NP_442402.1_4 Forward -248 -229 -8.94939 0.285
NP_441084.1_6 Forward -121 -107 14.6768 0.0972
NP_440696.1_3 Reverse -110 -128 -2.73412 0.279
NP_442039.1_4 Forward -228 -221 15.1821 0.0124
NP_442039.1_4 Reverse -221 -228 15.1821 0.0124
NP_442039.1_4 Forward -89 -82 8.59391 0.193
NP_442696.1_2 Forward -230 -212 12.7038 0.134
NP_442837.1_3 Forward -228 -221 15.7721 0.0124
NP_442837.1_3 Reverse -221 -228 15.7721 0.0124
NP_440160.1_2 Forward -368 -349 -0.885524 0.232
NP_440160.1_2 Reverse -56 -75 -8.06369 0.286
NP_439994.1_3 Reverse -219 -238 18.779 0.0532
NP_442053.1_1 Forward -229 -220 18.3876 0.0007
NP_442053.1_1 Reverse -220 -229 18.3876 0.0007
NP_440505.1_3 Forward -231 -221 18.3679 0.00213
NP_440505.1_3 Reverse -218 -228 14.1397 0.0235
NP_441701.1_3 Forward -128 -111 9.67528 0.245
NP_441203.1_1 Reverse -221 -240 -10.6203 0.137
NP_441203.1_1 Reverse -104 -123 -12.6852 0.144
NP_442532.1_7 Forward -229 -215 6.19444 0.171
NP_440914.1_1 Reverse -220 -230 17.5935 0.000537
NP_440914.1_1 Forward -229 -219 8.6151 0.186
NP_440914.1_1 Reverse -277 -287 7.15123 0.249
NP_441011.1_8 Forward -228 -219 16.9127 0.00602
NP_441011.1_8 Reverse -221 -230 8.25953 0.144
NP_442101.1_4 Reverse -268 -287 12.9791 0.112
NP_442533.1_6 Forward -229 -220 17.2076 0.00137
NP_442533.1_6 Reverse -220 -229 17.2076 0.00137
NP_442533.1_6 Forward -119 -110 7.27622 0.0928
NP_442533.1_6 Reverse -110 -119 7.17789 0.0948
NP_442541.1_10 Reverse -110 -124 3.93223 0.252
NP_441482.1_7 Forward -235 -221 -0.492064 0.0612
NP_441482.1_7 Reverse -214 -228 -8.5552 0.193
NP_439944.1_9 Reverse -221 -231 10.5014 0.0887
NP_439944.1_9 Forward -228 -218 10.4031 0.0887
NP_441028.1_6 Forward -133 -123 8.14104 0.217
NP_441028.1_6 Forward -145 -135 5.78111 0.243
NP_440116.1_8 Reverse -221 -240 -7.76869 0.237
NP_441527.1_4 Forward -177 -158 -2.91293 0.162
NP_441527.1_4 Forward -180 -161 -12.6531 0.292
NP_440115.1_6 Forward -232 -222 6.8632 0.167
NP_440007.1_9 Forward -128 -114 0.687908 0.292
NP_440007.1_9 Forward -233 -219 0.392915 0.298
NP_441347.1_5 Reverse -109 -123 12.0937 0.245
NP_441961.1_4 Reverse -212 -231 7.17762 0.27
NP_440608.1_6 Forward -111 -92 5.11187 0.255
NP_441602.1_3 Forward -234 -215 -2.55715 0.233
NP_441106.1_1 Reverse -219 -228 18.191 0.0028
NP_441106.1_1 Forward -230 -221 9.63616 0.0311
NP_439903.1_6 Forward -365 -346 4.42355 0.195
NP_442306.1_10 Forward -234 -215 -9.44032 0.11
NP_441286.1_1 Forward -230 -218 14.7886 0.00418
NP_441286.1_1 Reverse -219 -231 3.38223 0.0467
NP_440670.1_8 Forward -229 -220 18.3876 0.000699
NP_440670.1_8 Reverse -220 -229 18.3876 0.000699
NP_440886.1_7 Reverse -219 -229 17.7774 0.0011
NP_440886.1_7 Forward -230 -220 7.94438 0.0805
NP_442614.1_2 Reverse -220 -234 5.80112 0.297
NP_442072.1_9 Reverse -219 -237 -4.11075 0.041
NP_442072.1_9 Forward -230 -212 -13.8455 0.123
NP_440907.2_8 Forward -228 -218 17.4824 0.00685
NP_442264.1_2 Reverse -99 -116 9.77361 0.194
NP_441021.1_1 Reverse -221 -240 -5.99873 0.177
NP_441021.1_4 Forward -141 -122 12.4875 0.241
NP_441021.1_8 Forward -234 -216 12.9988 0.0938
NP_440841.1_4 Reverse -275 -294 -6.78538 0.215
NP_441463.1_3 Forward -129 -110 -10.4236 0.294
NP_441626.1_2 Forward -228 -221 15.7721 0.0124
NP_441626.1_2 Reverse -221 -228 15.7721 0.0124
NP_442211.1_3 Forward -305 -286 9.02821 0.263
NP_442365.1_7 Forward -233 -214 -4.52377 0.245
NP_442238.1_10 Reverse -59 -78 16.8132 0.232
NP_440107.1_5 Forward -230 -211 -1.18052 0.178
NP_442794.1_1 Forward -233 -221 10.4621 0.0721
NP_442615.1_1 Reverse -211 -229 -4.60241 0.19
NP_441962.1_4 Forward -234 -215 -7.17871 0.185
NP_441962.1_4 Reverse -215 -234 -12.1936 0.253
NP_440387.1_1 Forward -229 -213 -2.49807 0.148
NP_440387.1_1 Reverse -220 -236 -3.38305 0.158
NP_441431.1_2 Forward -122 -108 11.7987 0.132
NP_441431.1_2 Reverse -217 -231 8.84875 0.204
NP_441488.1_8 Forward -234 -220 8.84875 0.172
NP_441836.1_1 Reverse -297 -316 13.5447 0.223
NP_441836.1_1 Forward -161 -142 12.4733 0.257
NP_441993.1_1 Forward -229 -210 7.59921 0.16
NP_441993.1_1 Reverse -220 -239 2.1416 0.262
NP_441993.1_1 Reverse -214 -233 1.06957 0.285
NP_440114.1_10 Forward -229 -215 17.2075 0.0116
NP_440114.1_10 Reverse -81 -95 8.35772 0.207
NP_440114.1_10 Forward -337 -323 6.78443 0.258
NP_440293.1_3 Reverse -108 -127 -5.11376 0.272
NP_440766.1_4 Forward -233 -219 9.04604 0.0871
NP_439988.1_3 Forward -341 -327 5.99778 0.278
NP_442743.1_4 Reverse -221 -240 -7.4737 0.279
NP_439910.1_2 Reverse -212 -229 -13.2358 0.153
NP_440457.1_1 Forward -233 -221 6.33216 0.123
NP_440457.1_1 Reverse -49 -61 5.74217 0.138
NP_440798.1_6 Forward -228 -215 2.47756 0.17
NP_441801.1_4 Reverse -117 -127 2.92996 0.231
NP_440801.1_9 Forward -131 -117 12.6414 0.286
NP_440142.1_7 Forward -124 -105 8.35759 0.233
NP_441984.1_3 Reverse -216 -234 16.6371 0.0928
NP_441984.1_3 Reverse -42 -60 6.41066 0.269
NP_442509.1_9 Forward -229 -219 16.2041 0.00739
NP_442509.1_9 Reverse -220 -230 8.14104 0.192
NP_443037.1_7 Forward -162 -143 -4.03212 0.276
NP_442514.1_5 Reverse -113 -132 -3.44288 0.228
NP_440554.1_4 Forward -228 -218 13.943 0.0218
NP_440554.1_4 Reverse -221 -231 8.92815 0.0646
NP_442737.1_5 Reverse -320 -339 11.7155 0.284
NP_441885.1_5 Reverse -220 -230 20.9245 0.000538
NP_441885.1_5 Forward -229 -219 11.4848 0.00668
NP_440478.1_10 Reverse -218 -232 10.6193 0.193
NP_442341.1_7 Forward -230 -216 12.291 0.0455
NP_442341.1_7 Reverse -219 -233 11.2093 0.0567
NP_442341.1_9 Forward -339 -325 13.7653 0.0763
NP_441756.1_5 Reverse -216 -235 -3.93378 0.29
NP_440409.1_1 Forward -237 -218 -3.63879 0.255
NP_440423.1_6 Reverse -212 -231 5.40766 0.059
NP_443000.1_7 Forward -231 -221 19.9412 0.00223
NP_443000.1_7 Reverse -218 -228 2.04498 0.226
NP_442513.1_5 Reverse -212 -231 9.43841 0.266
NP_441842.1_10 Reverse -213 -227 6.19444 0.297
NP_440275.1_3 Reverse -218 -228 17.9746 0.0082
NP_440275.1_3 Forward -231 -221 15.123 0.0182
NP_440091.1_1 Reverse -216 -228 20.1968 0.00953
NP_440091.1_1 Forward -233 -221 1.31728 0.198
NP_442275.1_1 Reverse -343 -362 4.03102 0.274
NP_443010.1_10 Reverse -217 -234 6.73278 0.179
NP_442451.1_2 Forward -237 -218 7.07928 0.106
NP_442451.1_2 Reverse -212 -231 0.196116 0.153
NP_440149.1_8 Reverse -220 -239 -0.39387 0.147
NP_440149.1_8 Forward -229 -210 -1.57384 0.162
NP_441105.1_3 Forward -240 -221 -9.14533 0.284
NP_440216.1_1 Reverse -220 -234 9.93102 0.00589
NP_440216.1_1 Forward -229 -215 6.29277 0.0156
NP_440216.1_9 Reverse -122 -131 11.6028 0.254
NP_440216.1_9 Reverse -123 -132 7.27622 0.286
NP_440216.1_9 Forward -117 -108 6.98123 0.289
NP_440172.1_1 Reverse -220 -230 15.0247 0.00945
NP_440172.1_1 Forward -229 -219 8.73149 0.0586
NP_440172.1_1 Forward -112 -102 8.23984 0.0653
NP_442290.1_8 Forward -230 -216 14.6509 0.288
NP_442015.1_10 Forward -233 -220 12.6056 0.0365
NP_441226.1_7 Forward -228 -221 14.4934 0.0123
NP_441226.1_7 Reverse -221 -228 14.4934 0.0123
NP_441226.1_7 Forward -336 -329 9.47853 0.147
NP_442222.1_4 Forward -137 -118 10.1275 0.284
NP_441111.1_7 Forward -228 -220 18.7023 0.00294
NP_441111.1_7 Reverse -221 -229 18.7023 0.00294
NP_441766.1_2 Forward -229 -220 17.5026 0.00297
NP_441766.1_2 Reverse -220 -229 17.5026 0.00297
NP_440416.1_1 Forward -229 -210 -14.6519 0.295
NP_440416.1_9 Reverse -108 -127 -10.817 0.146
NP_440416.1_9 Reverse -109 -128 -12.0953 0.155
NP_440416.1_9 Forward -236 -217 -18.6834 0.262
NP_440416.1_9 Forward -287 -268 -19.0768 0.269
NP_443052.1_8 Reverse -210 -229 -6.29373 0.142
NP_440885.1_6 Reverse -138 -157 8.07696 0.227
NP_440261.1_5 Reverse -221 -234 -2.63565 0.0924
NP_440261.1_5 Forward -228 -215 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGCTCACAACAGCGATGCTAACTTTAGAGTAGTGTAAGGTCTCTGCCAAGACTCTACACCTACCCCATCGGGCATTGTTAAGGACAGTTGACACAGTGACAGAAAACTAATCTGCCCTTTGCCATCAATTTCTAATCACCGTAGTGAACAGATTGTCCATGATAACCACTGGCGATCGCCGCTTCTGCTTCTAAGCTCAGCTTTTAGGGTTGACTAGTGAAAAGAAGGGGGCAAAAGATGTCAGACTTTGGTGATATTCCCCCGGACTTTTCCCTGGGGAGGCCAAGGCCAATCACTATAATGGAGACGTGCGATACCGATATTCATTGGAAGTGGTCTGCACCGCCCTGCTTCCCCTTAAACCCTTGAACGTTTAGGGATATTAGCGGTTTTAGCCCT

CDS

ATGAACACCCAGTTTTTTGAAGAATACCAAACCCAGTTACTGGACTGGCAAAAGAAATTTTTTAGCACTTGGATGGAAAGCCTGCCCAAAGGCACCGCTGAAATTAAATTGACCGATACCTTTGAAACCAGTTTGAAATTACAAGAGGAAATGGTCAAAAGCTACCTGGAAGCCCAGGAAAAATCCGCCACAATGATGATCGATGCCCAAAAACAATTTTGGGACAACTATTTTCAAGCCCTGCGGCAAGAGCCCGTATCGGCTAACTAG

Protein

MNTQFFEEYQTQLLDWQKKFFSTWMESLPKGTAEIKLTDTFETSLKLQEEMVKSYLEAQEKSATMMIDAQKQFWDNYFQALRQEPVSAN