Your browser is old and dusty. Try Google Chrome!

Details for ssl2384

ORF ssl2384
Accession NP_440164.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -372 -386 -1.08205 0.249
NP_440795.1_7 Forward -388 -381 10.2655 0.154
NP_441418.1_6 Forward -389 -370 -10.522 0.0362
NP_441418.1_6 Forward -188 -169 -23.2067 0.192
NP_442151.1_1 Reverse -287 -306 5.01433 0.287
NP_442151.1_6 Reverse -322 -336 5.01447 0.298
NP_441818.1_1 Reverse -180 -191 11.5629 0.176
NP_441818.1_9 Forward -394 -375 -3.73712 0.231
NP_441630.1_3 Forward -196 -177 5.60432 0.138
NP_441098.1_3 Forward -57 -38 -4.77918 0.28
NP_442655.1_2 Forward -249 -230 10.4225 0.104
NP_442173.1_1 Reverse -180 -188 8.27922 0.101
NP_442752.1_4 Forward -240 -233 5.44732 0.202
NP_439997.1_5 Reverse -2 -21 19.7719 0.113
NP_440784.1_10 Forward -273 -254 10.1275 0.185
NP_442000.2_6 Forward -379 -360 18.9773 0.0799
NP_440061.1_9 Reverse -327 -341 9.73373 0.14
NP_440061.1_9 Reverse -228 -242 7.76712 0.194
NP_439979.1_9 Forward -379 -361 7.88563 0.273
NP_442062.1_3 Forward -129 -110 3.53937 0.206
NP_441859.1_2 Forward -98 -79 11.11 0.219
NP_441641.1_4 Forward -36 -17 7.7676 0.296
NP_440304.1_4 Reverse -221 -231 6.46988 0.155
NP_440304.1_4 Forward -360 -350 4.20827 0.272
NP_442602.1_3 Reverse -214 -233 -1.57384 0.245
NP_439918.1_2 Forward -400 -381 1.47442 0.215
NP_439918.1_2 Forward -238 -219 -0.590531 0.233
NP_441208.1_1 Forward -388 -369 -4.72043 0.263
NP_441208.1_9 Forward -275 -261 4.81781 0.285
NP_442110.1_7 Reverse -293 -307 4.81781 0.192
NP_441925.1_4 Reverse -378 -397 -16.1275 0.281
NP_441925.1_4 Reverse -379 -398 -16.4225 0.282
NP_441083.1_5 Reverse -179 -189 14.9263 0.0138
NP_441083.1_5 Forward -331 -321 -0.314959 0.265
NP_441738.1_2 Reverse -181 -188 13.3134 0.0335
NP_441738.1_2 Reverse -233 -240 10.2652 0.101
NP_441558.1_5 Forward -333 -314 6.29264 0.22
NP_441942.1_6 Forward -378 -359 15.3503 0.235
NP_440209.1_1 Forward -331 -323 2.1827 0.254
NP_441770.1_4 Forward -346 -327 -7.37537 0.229
NP_441783.1_2 Reverse -373 -382 17.1093 0.108
NP_441792.1_5 Reverse -218 -234 14.8082 0.172
NP_441327.1_1 Forward -60 -41 10.941 0.184
NP_442111.1_3 Reverse -48 -61 12.1892 0.294
NP_441163.1_1 Reverse -216 -233 7.01961 0.251
NP_441209.1_8 Forward -53 -35 9.13108 0.24
NP_440747.1_10 Forward -191 -179 -12.4491 0.282
NP_441130.1_10 Reverse -177 -191 7.76774 0.149
NP_441194.1_1 Forward -152 -133 13.3207 0.238
NP_442634.1_4 Forward -382 -368 -5.11362 0.235
NP_440403.1_10 Reverse -371 -390 5.30933 0.243
NP_440842.1_6 Reverse -360 -379 11.995 0.253
NP_440842.1_10 Forward -334 -320 1.57289 0.288
NP_441012.1_4 Reverse -373 -386 14.5723 0.2
NP_443018.1_3 Forward -307 -300 5.34899 0.212
NP_441634.1_8 Forward -190 -176 6.09611 0.114
NP_441634.1_8 Forward -391 -377 1.57289 0.188
NP_440376.1_1 Forward -232 -223 4.42462 0.159
NP_440376.1_1 Forward -240 -231 -0.000272808 0.285
NP_442687.1_7 Forward -332 -322 14.3364 0.0329
NP_442191.1_4 Reverse -232 -246 10.7022 0.288
NP_442485.1_3 Forward -190 -171 -3.73712 0.277
NP_442485.1_3 Forward -118 -99 -5.11376 0.287
NP_441846.1_10 Forward -250 -231 -6.98204 0.19
NP_441846.1_10 Reverse -86 -105 -19.3717 0.256
NP_441846.1_10 Forward -400 -381 -23.5016 0.289
NP_441846.1_10 Reverse -93 -112 -23.6 0.294
NP_440642.1_10 Forward -98 -84 9.93039 0.175
NP_441013.1_2 Forward -385 -367 2.37909 0.241
NP_440667.1_2 Forward -380 -361 -3.54046 0.234
NP_441950.1_7 Forward -392 -373 -5.9004 0.241
NP_440360.1_5 Reverse -257 -276 -5.9004 0.297
NP_440662.1_2 Reverse -171 -190 -1.08219 0.276
NP_441414.1_9 Reverse -159 -178 -6.68705 0.201
NP_441414.1_9 Forward -188 -169 -10.1286 0.277
NP_440720.1_1 Forward -342 -323 1.0811 0.279
NP_440607.1_8 Forward -391 -372 10.0292 0.148
NP_441256.1_8 Forward -346 -327 3.73603 0.273
NP_442937.1_5 Forward -141 -122 8.35759 0.225
NP_442937.1_5 Forward -193 -174 7.57094 0.248
NP_442836.1_10 Forward -187 -177 14.0414 0.212
NP_440984.1_1 Forward -190 -171 11.0125 0.275
NP_442690.1_1 Reverse -40 -59 -7.76869 0.178
NP_442690.1_1 Forward -62 -43 -17.3068 0.299
NP_442911.1_2 Reverse -169 -188 2.75272 0.0485
NP_440153.1_8 Reverse -374 -387 -2.83231 0.266
NP_440858.1_1 Forward -263 -244 19.3707 0.00557
NP_440325.1_1 Forward -150 -131 14.1591 0.188
NP_442064.1_1 Reverse -141 -160 -9.44032 0.259
NP_443055.1_6 Reverse -223 -241 14.6697 0.0816
NP_443055.1_6 Reverse -322 -340 -1.84987 0.284
NP_441424.1_2 Forward -149 -130 14.8486 0.14
NP_442438.1_10 Forward -385 -371 0.491246 0.225
NP_442431.1_10 Forward -392 -374 3.3624 0.218
NP_441000.1_6 Reverse -178 -192 2.94952 0.123
NP_440147.1_4 Forward -190 -177 2.67422 0.203
NP_441175.1_7 Forward -331 -312 5.50599 0.277
NP_441916.1_7 Reverse -371 -381 3.91327 0.198
NP_440345.1_5 Reverse -36 -50 13.5701 0.285
NP_441041.1_4 Forward -386 -367 -10.227 0.228
NP_441041.1_4 Forward -364 -345 -10.4236 0.232
NP_441041.1_4 Forward -380 -361 -13.5702 0.291
NP_442004.1_4 Reverse -242 -261 9.14342 0.299
NP_441725.1_5 Reverse -323 -333 5.48657 0.115
NP_439966.1_7 Reverse -177 -187 7.45273 0.15
NP_439966.1_7 Reverse -378 -388 6.17443 0.191
NP_439966.1_9 Forward -242 -233 5.3096 0.253
NP_442941.1_3 Reverse -180 -190 -0.0199663 0.244
NP_440289.1_2 Reverse -176 -189 -2.83231 0.262
NP_440983.1_5 Reverse -211 -230 -9.047 0.3
NP_440260.1_7 Reverse -341 -360 -1.08219 0.241
NP_442281.1_1 Reverse -226 -240 5.60385 0.152
NP_440437.1_1 Forward -274 -255 -2.75381 0.224
NP_442500.1_2 Forward -388 -369 6.29264 0.283
NP_441457.1_7 Forward -118 -99 -1.18052 0.293
NP_440723.1_8 Forward -387 -373 13.8643 0.178
NP_441556.1_10 Forward -394 -380 15.3807 0.145
NP_441644.1_6 Forward -380 -370 5.09279 0.21
NP_441644.1_6 Reverse -179 -189 4.69947 0.228
NP_442215.1_2 Forward -235 -219 -2.89139 0.206
NP_440253.1_2 Reverse -179 -197 8.7706 0.0526
NP_442554.1_8 Reverse -180 -190 3.71661 0.215
NP_441586.1_3 Forward -379 -360 11.4058 0.172
NP_441762.1_7 Forward -189 -177 -5.07423 0.187
NP_442292.1_1 Reverse -180 -189 6.5879 0.101
NP_442292.1_2 Reverse -137 -151 17.4885 0.248
NP_442476.1_6 Reverse -381 -395 1.76955 0.205
NP_442301.1_2 Reverse -370 -389 19.2715 0.0769
NP_442301.1_2 Reverse -373 -392 9.83173 0.2
NP_441715.1_4 Reverse -180 -190 6.27322 0.155
NP_440357.1_3 Forward -242 -223 1.67108 0.272
NP_441448.1_2 Reverse -373 -392 -0.197979 0.252
NP_440183.1_1 Forward -100 -81 6.98095 0.27
NP_441020.2_6 Forward -382 -365 15.7718 0.0361
NP_441020.2_6 Forward -242 -225 9.97027 0.156
NP_441015.1_10 Forward -376 -357 -1.86883 0.176
NP_441015.1_10 Forward -379 -360 -9.83364 0.282
NP_441015.1_10 Forward -394 -375 -11.4069 0.296
NP_441673.1_1 Forward -380 -371 -8.06341 0.254
NP_441876.1_2 Reverse -35 -54 11.3075 0.268
NP_441826.1_2 Forward -337 -323 -4.32697 0.295
NP_441637.1_8 Reverse -163 -180 13.9035 0.197
NP_441764.1_1 Forward -149 -130 7.96426 0.28
NP_442868.1_6 Reverse -378 -388 5.87989 0.136
NP_442868.1_6 Forward -333 -323 3.42162 0.199
NP_442868.1_6 Forward -190 -180 -0.118297 0.264
NP_442719.1_2 Reverse -245 -263 -7.4547 0.234
NP_442719.1_2 Reverse -59 -77 -11.8796 0.297
NP_441251.1_7 Reverse -46 -59 12.3107 0.266
NP_440051.1_9 Forward -228 -214 21.6324 0.0311
NP_442808.1_1 Reverse -178 -188 9.91099 0.0481
NP_442050.1_1 Reverse -86 -105 11.5042 0.233
NP_442050.1_1 Reverse -85 -104 11.3075 0.233
NP_442050.1_1 Forward -387 -368 8.35759 0.251
NP_440038.1_4 Reverse -327 -346 3.34271 0.275
NP_442903.1_1 Forward -71 -52 19.5673 0.0628
NP_441114.1_3 Reverse -225 -234 7.37455 0.239
NP_440558.1_2 Reverse -214 -233 3.93269 0.153
NP_440558.1_2 Reverse -362 -381 -1.37718 0.214
NP_440558.1_5 Forward -232 -218 14.2576 0.288
NP_442789.1_4 Forward -382 -363 -2.16383 0.233
NP_440274.1_2 Reverse -11 -25 14.4536 0.236
NP_440923.1_2 Forward -152 -133 24.3978 0.00775
NP_441878.1_6 Forward -233 -223 -6.11649 0.191
NP_441878.1_6 Forward -381 -371 -7.19813 0.21
NP_441036.1_8 Forward -381 -371 5.48657 0.279
NP_442650.1_2 Reverse -380 -394 2.06454 0.297
NP_441445.1_1 Forward -249 -230 0.392778 0.275
NP_440101.1_3 Reverse -240 -259 2.85105 0.244
NP_442183.1_1 Forward -188 -174 6.48943 0.171
NP_441819.1_5 Reverse -134 -153 8.83258 0.293
NP_442347.1_2 Reverse -381 -390 3.93297 0.284
NP_442347.1_2 Reverse -180 -189 3.34298 0.284
NP_442965.1_2 Reverse -87 -106 3.83436 0.168
NP_442594.1_8 Reverse -85 -104 4.22769 0.269
NP_442594.1_10 Forward -103 -84 7.76679 0.288
NP_440932.1_5 Forward -179 -160 3.24438 0.274
NP_440136.1_2 Forward -388 -381 4.26735 0.218
NP_441728.2_4 Forward -153 -134 12.0793 0.273
NP_442998.1_5 Reverse -49 -59 11.7798 0.176
NP_442998.1_10 Reverse -181 -188 12.3305 0.0564
NP_441799.1_1 Reverse -175 -189 5.70218 0.197
NP_440640.1_6 Forward -392 -373 3.83436 0.213
NP_441007.1_10 Forward -385 -372 2.57589 0.183
NP_441007.1_10 Forward -394 -381 -0.472371 0.285
NP_442334.1_2 Forward -341 -324 4.56207 0.128
NP_440087.1_1 Forward -188 -169 -5.9004 0.249
NP_441559.1_8 Forward -244 -230 -7.08024 0.283
NP_440915.1_6 Forward -244 -230 6.78443 0.0791
NP_442855.1_3 Forward -278 -259 11.7992 0.257
NP_441296.1_9 Reverse -349 -362 10.2451 0.271
NP_440164.1_1 Forward -131 -112 27.6305 0.000791
NP_440164.1_2 Forward -153 -134 30.9737 0.000136
NP_440164.1_6 Forward -324 -305 20.059 0.0329
NP_440164.1_7 Forward -216 -197 18.6823 0.0638
NP_440164.1_9 Forward -52 -33 20.8456 0.121
NP_440748.1_5 Forward -356 -337 0.687771 0.246
NP_442031.1_5 Reverse -333 -352 4.32602 0.298
NP_441464.1_10 Forward -22 -8 14.6509 0.166
NP_440026.1_2 Reverse -275 -294 18.289 0.163
NP_442993.1_1 Reverse -371 -387 -12.4295 0.271
NP_442386.1_9 Reverse -379 -388 5.70251 0.241
NP_442386.1_9 Reverse -178 -187 4.52254 0.297
NP_441340.1_9 Reverse -48 -58 8.15881 0.256
NP_440586.1_1 Forward -393 -374 -5.60541 0.286
NP_442251.1_6 Reverse -323 -330 8.69224 0.199
NP_440684.1_9 Reverse -350 -364 7.9644 0.246
NP_439937.1_8 Forward -391 -372 -0.0988766 0.237
NP_441167.1_1 Forward -152 -133 5.80098 0.237
NP_441740.2_10 Forward -395 -376 7.27595 0.286
NP_440439.1_1 Forward -243 -230 -0.472371 0.221
NP_440171.1_3 Reverse -82 -101 12.4875 0.177
NP_441789.1_7 Reverse -361 -380 4.62021 0.193
NP_439977.1_10 Forward -179 -160 14.9458 0.218
NP_440139.1_1 Forward -326 -307 1.08032 0.272
NP_442262.1_10 Reverse -180 -187 9.67555 0.173
NP_442262.1_10 Forward -307 -300 7.6106 0.274
NP_440163.1_10 Forward -383 -373 8.92815 0.256
NP_440344.1_10 Reverse -373 -390 -4.97604 0.102
NP_440282.1_10 Reverse -361 -380 -6.09707 0.25
NP_442123.1_3 Reverse -287 -306 11.4058 0.245
NP_441335.1_8 Reverse -175 -194 8.55425 0.253
NP_441335.1_8 Forward -189 -170 6.78429 0.281
NP_442187.1_3 Forward -189 -179 14.6313 0.165
NP_441896.1_1 Reverse -132 -151 8.16011 0.258
NP_440999.1_9 Reverse -376 -390 3.63784 0.126
NP_440999.1_9 Reverse -175 -189 1.08123 0.171
NP_440888.1_2 Reverse -179 -193 7.86545 0.179
NP_440600.1_9 Forward -56 -37 13.5117 0.243
NP_442147.1_7 Reverse -85 -104 9.43923 0.257
NP_441123.1_3 Reverse -66 -85 18.9773 0.0484
NP_441949.1_5 Forward -151 -132 13.1865 0.2
NP_441469.1_8 Reverse -379 -388 5.70292 0.257
NP_442315.1_2 Forward -393 -381 14.592 0.27
NP_442337.1_6 Reverse -250 -269 12.5678 0.286
NP_441621.1_7 Reverse -369 -383 -6.09693 0.275
NP_441601.1_2 Forward -194 -175 -0.688862 0.219
NP_442204.1_5 Forward -341 -322 1.57275 0.232
NP_440516.1_8 Forward -188 -179 9.14451 0.0354
NP_440516.1_8 Reverse -322 -331 -0.295266 0.232
NP_440516.1_8 Forward -240 -231 -0.590259 0.283
NP_442768.1_5 Reverse -148 -167 14.3558 0.268
NP_441443.1_1 Reverse -84 -103 -2.16383 0.26
NP_441443.1_2 Reverse -322 -341 6.29264 0.164
NP_441443.1_10 Forward -94 -76 2.08335 0.275
NP_442120.1_10 Forward -238 -219 2.85105 0.145
NP_440673.1_3 Reverse -324 -331 10.4622 0.139
NP_440673.1_3 Forward -369 -362 8.20058 0.234
NP_441052.1_2 Forward -331 -321 1.455 0.244
NP_441052.1_2 Reverse -179 -189 1.25834 0.249
NP_441052.1_2 Reverse -380 -390 -0.609952 0.288
NP_440436.1_4 Forward -330 -321 4.42421 0.265
NP_441884.1_9 Reverse -68 -87 -20.945 0.218
NP_441884.1_9 Forward -191 -172 -23.5016 0.284
NP_441733.1_10 Forward -191 -178 8.9674 0.131
NP_441733.1_10 Forward -243 -230 5.62415 0.21
NP_441004.1_1 Forward -392 -373 4.12936 0.106
NP_441004.1_1 Forward -337 -318 -9.14533 0.206
NP_441004.1_1 Forward -238 -219 -9.83364 0.212
NP_441004.1_2 Forward -342 -323 -4.22878 0.29
NP_441004.1_4 Forward -334 -324 8.63316 0.269
NP_442813.1_4 Forward -98 -79 -3.24547 0.289
NP_440129.1_10 Reverse -216 -230 2.5562 0.25
NP_442873.1_9 Reverse -358 -377 10.815 0.205
NP_440296.1_10 Forward -383 -364 -13.8652 0.269
NP_443054.1_2 Reverse -221 -235 6.19444 0.204
NP_443054.1_2 Reverse -222 -236 0.88457 0.252
NP_442856.1_2 Reverse -80 -99 19.6656 0.0231
NP_441683.1_7 Reverse -85 -104 -12.0953 0.284
NP_440593.1_3 Forward -336 -317 -6.58872 0.278
NP_442689.1_8 Reverse -137 -154 -6.94266 0.292
NP_440940.1_7 Reverse -370 -388 3.26332 0.274
NP_442024.1_8 Forward -151 -141 15.418 0.254
NP_441409.1_6 Reverse -173 -192 -15.5368 0.297
NP_439960.1_10 Reverse -77 -95 -4.60241 0.293
NP_440954.1_1 Forward -380 -361 -2.36049 0.224
NP_442006.1_2 Reverse -79 -96 -10.0892 0.197
NP_442006.1_2 Reverse -78 -95 -18.1524 0.288
NP_441003.1_9 Forward -195 -176 4.81767 0.277
NP_441570.1_1 Forward -380 -362 -16.5988 0.249
NP_440078.1_10 Forward -386 -367 9.0459 0.196
NP_441078.1_4 Forward -380 -371 -1.77023 0.266
NP_442348.1_2 Forward -233 -224 13.1761 0.206
NP_440707.1_9 Forward -382 -363 -0.295539 0.299
NP_442443.1_1 Forward -379 -360 -6.1954 0.293
NP_440793.1_1 Forward -99 -85 9.53707 0.293
NP_441432.1_8 Forward -189 -180 4.42462 0.213
NP_442344.1_7 Reverse -224 -243 -8.94866 0.232
NP_441732.1_2 Forward -306 -290 -17.641 0.281
NP_440760.1_1 Forward -136 -117 -16.5201 0.179
NP_440760.1_1 Reverse -223 -242 -20.2567 0.222
NP_442797.1_6 Reverse -289 -308 8.90373 0.254
NP_442489.1_7 Forward -380 -371 -1.27858 0.185
NP_442489.1_7 Reverse -223 -232 -1.57357 0.213
NP_442489.1_7 Forward -232 -223 -1.6719 0.235
NP_442489.1_7 Reverse -322 -331 -1.6719 0.235
NP_442489.1_7 Reverse -371 -380 -2.06522 0.288
NP_440559.1_1 Forward -330 -321 4.71961 0.217
NP_439956.1_7 Forward -386 -367 0.982764 0.292
NP_442346.1_5 Forward -332 -322 10.0098 0.11
NP_442346.1_10 Forward -118 -99 -3.24547 0.294
NP_440459.1_2 Forward -373 -356 7.512 0.288
NP_442603.1_7 Forward -188 -174 6.29216 0.249
NP_442828.1_7 Reverse -83 -102 -3.83545 0.276
NP_441948.1_4 Forward -195 -177 -1.55415 0.146
NP_442498.1_7 Forward -393 -376 19.1019 0.108
NP_441895.1_2 Reverse -80 -99 -26.4516 0.24
NP_440204.1_1 Forward -237 -218 0.786102 0.3
NP_442199.1_5 Forward -304 -285 -3.44213 0.206
NP_442723.1_1 Reverse -1 -20 3.34192 0.278
NP_442021.1_3 Forward -238 -219 -5.80207 0.257
NP_440875.1_9 Reverse -233 -243 10.5134 0.212
NP_440590.1_4 Reverse -180 -193 -5.68391 0.286
NP_440567.1_1 Forward -187 -173 0.294584 0.25
NP_440227.1_2 Forward -60 -44 7.2367 0.295
NP_441239.1_9 Reverse -177 -189 10.3637 0.0807
NP_441239.1_9 Forward -341 -329 3.77555 0.276
NP_440604.1_6 Forward -266 -247 -6.1954 0.29
NP_440604.1_6 Forward -82 -63 -6.1954 0.29
NP_442193.1_1 Forward -400 -382 12.9988 0.221
NP_442270.1_9 Reverse -357 -376 -11.4069 0.27
NP_441541.1_1 Reverse -38 -56 5.63601 0.164
NP_442216.1_4 Forward -174 -166 8.08217 0.255
NP_440546.1_4 Forward -188 -178 10.4338 0.109
NP_440546.1_6 Forward -390 -371 8.25926 0.26
NP_440462.1_6 Reverse -177 -187 4.69992 0.187
NP_441607.1_1 Reverse -86 -105 13.1181 0.289
NP_440868.1_4 Reverse -175 -187 3.77555 0.133
NP_440868.1_4 Forward -375 -363 -0.944332 0.284
NP_440401.1_9 Reverse -8 -15 12.6251 0.287
NP_441249.1_3 Forward -310 -291 3.93269 0.278
NP_442479.1_9 Forward -251 -232 -10.4236 0.268
NP_441474.1_1 Reverse -361 -380 4.42355 0.221
NP_442402.1_2 Forward -97 -83 14.1586 0.263
NP_442402.1_4 Forward -102 -83 -5.21283 0.238
NP_442402.1_4 Forward -65 -46 -6.98278 0.268
NP_442402.1_10 Reverse -245 -255 11.091 0.269
NP_441848.1_4 Reverse -43 -59 16.1449 0.151
NP_441811.1_1 Reverse -367 -386 4.32602 0.285
NP_441811.1_8 Forward -377 -363 8.16106 0.238
NP_440825.1_6 Forward -242 -223 9.24257 0.285
NP_442696.1_6 Forward -296 -277 -3.14714 0.147
NP_442053.1_1 Reverse -179 -188 4.81794 0.222
NP_442053.1_1 Forward -188 -179 4.22796 0.261
NP_440505.1_3 Forward -242 -232 8.73149 0.135
NP_440505.1_3 Forward -190 -180 7.05986 0.165
NP_441203.1_1 Reverse -323 -342 -14.4552 0.19
NP_442471.1_10 Reverse -368 -387 16.9124 0.0858
NP_442532.1_7 Forward -188 -174 2.75286 0.226
NP_442533.1_1 Forward -398 -379 -5.21209 0.155
NP_442533.1_1 Forward -392 -373 -7.37537 0.188
NP_442533.1_6 Forward -380 -371 3.83464 0.202
NP_441028.1_6 Forward -92 -82 15.2208 0.152
NP_441028.1_6 Forward -91 -81 4.10949 0.278
NP_441028.1_6 Forward -93 -83 3.42118 0.296
NP_441680.1_4 Reverse -178 -197 -3.63879 0.3
NP_441420.1_1 Reverse -321 -340 -4.6221 0.292
NP_001035870.1_3 Reverse -115 -134 -0.590531 0.2
NP_441286.1_1 Reverse -321 -333 3.67722 0.0467
NP_441286.1_1 Forward -189 -177 -5.46756 0.203
NP_441286.1_1 Forward -390 -378 -6.64753 0.271
NP_440670.1_8 Forward -188 -179 5.50626 0.152
NP_440670.1_8 Reverse -322 -331 3.93297 0.212
NP_442908.1_9 Forward -310 -291 11.0125 0.205
NP_440886.1_7 Reverse -178 -188 6.76441 0.114
NP_440886.1_7 Reverse -379 -389 4.89613 0.213
NP_440886.1_7 Reverse -361 -371 3.71617 0.267
NP_440886.1_7 Reverse -10 -20 3.22451 0.291
NP_441399.1_10 Forward -391 -372 17.404 0.209
NP_442401.1_2 Reverse -361 -380 12.7816 0.159
NP_441808.1_8 Forward -377 -358 5.80098 0.295
NP_440907.2_8 Reverse -232 -242 5.19112 0.215
NP_442264.1_2 Forward -390 -373 5.84037 0.27
NP_442459.1_8 Forward -385 -366 15.0441 0.089
NP_441463.1_3 Forward -318 -299 -9.14533 0.277
NP_441463.1_6 Reverse -369 -383 6.22266 0.279
NP_442615.1_1 Reverse -313 -331 -5.48739 0.215
NP_441962.1_4 Forward -231 -212 -11.9969 0.25
NP_441962.1_4 Reverse -122 -141 -13.3736 0.272
NP_440387.1_1 Forward -380 -364 -0.924775 0.142
NP_440387.1_1 Reverse -371 -387 -6.62797 0.298
NP_441431.1_2 Reverse -377 -391 5.50552 0.298
NP_441431.1_2 Forward -243 -229 5.50552 0.298
NP_441993.1_1 Forward -238 -219 2.23906 0.261
NP_440114.1_10 Forward -240 -226 8.84938 0.192
NP_440737.1_1 Reverse -97 -116 7.96426 0.251
NP_442698.1_10 Reverse -83 -102 5.40766 0.238
NP_440293.1_10 Forward -389 -370 -1.37718 0.271
NP_441237.1_9 Forward -239 -229 10.5014 0.228
NP_441237.1_9 Reverse -323 -333 9.7148 0.272
NP_440643.1_6 Reverse -218 -237 3.93269 0.232
NP_442867.1_8 Forward -95 -76 5.70265 0.276
NP_440457.1_1 Forward -244 -232 -0.74767 0.273
NP_441801.1_4 Reverse -75 -85 3.32329 0.231
NP_441984.1_6 Reverse -324 -336 17.6402 0.145
NP_441332.1_6 Reverse -230 -240 12.6149 0.221
NP_442509.1_9 Reverse -322 -332 5.97777 0.298
NP_442509.1_9 Reverse -231 -241 5.97777 0.298
NP_442514.1_5 Forward -96 -77 -7.3761 0.276
NP_442514.1_5 Reverse -73 -92 -9.24438 0.295
NP_442514.1_6 Forward -354 -335 11.1109 0.208
NP_440554.1_4 Reverse -180 -190 2.7333 0.254
NP_442862.1_3 Forward -58 -41 11.3469 0.202
NP_441885.1_8 Forward -195 -176 22.0247 0.0373
NP_442341.1_7 Reverse -262 -276 6.58777 0.123
NP_442341.1_7 Forward -189 -175 2.85119 0.243
NP_441173.1_9 Reverse -248 -256 12.2121 0.21
NP_440423.1_6 Forward -196 -177 -20.945 0.276
NP_443000.1_7 Forward -190 -180 0.57002 0.294
NP_440275.1_3 Forward -190 -180 2.7333 0.254
NP_442932.1_9 Reverse -81 -100 7.37428 0.241
NP_440312.1_8 Reverse -309 -328 11.644 0.271
NP_440679.1_10 Forward -378 -359 -5.21209 0.161
NP_441105.1_3 Reverse -225 -244 -7.76869 0.259
NP_440216.1_9 Reverse -219 -228 16.5193 0.128
NP_440172.1_1 Reverse -322 -332 4.69992 0.171
NP_440172.1_1 Forward -232 -222 1.74999 0.299
NP_442446.1_4 Reverse -370 -389 18.879 0.123
NP_441766.1_2 Reverse -179 -188 5.01461 0.148
NP_440416.1_9 Reverse -119 -138 -20.945 0.289
NP_443052.1_9 Reverse -373 -392 -2.26216 0.235
NP_442116.1_6 Reverse -43 -60 5.39969 0.299
NP_442154.1_1 Forward -397 -379 -0.177514 0.109
NP_442154.1_1 Forward -388 -370 -14.2388 0.217
NP_442564.1_10 Reverse -78 -92 8.94771 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGAGTGTGTTTGGGGTCGCGGCGGTGGACTTGATTGCGGAAGGCAAATTCGACCACATGGTGGCCTGGCGCAATCGTCAAACCATTAGTGTGCCCATTGAGGAAGCCATCCAAACCTATCAAACGGTGCAGTTGGACGGCACCTTGGTGAAAACTGCGCGGGGATTGGGCATTTGCCTTGGTAACGATTAAGTTCCTAGCAGTTCCTAACTGGCGATCTGGGCCATATTTCCCCGATAAAGCAGCGCAATTGTAAAGAAATGTGGCGGATGTTAAAGCTTAGTTGCAAAAACCGCCCTTTCTCTCCCTTTTCCCCCGGGGGAGTGATACGTTGTAAAACGAAATTTTTCCATAACTTTAATTAATCGGATCAATAACTAAGGGGTGGGGGTTAAAAATC

CDS

ATGTTTGATCGTTCCAACAAAGATTTAATCAGCGCTGGTTTGGTTTCCGCCCTGGGGGCAGGCATTGTGACTTCCTTTGCCGTTAATCAGGGGCAAGACCCCTTTGTTGCTTTGATGATCACGGCGATCGCCAGTGTTTGTGGTATGGTGTGTCACCAGTTTGATCTAATTTGA

Protein

MFDRSNKDLISAGLVSALGAGIVTSFAVNQGQDPFVALMITAIASVCGMVCHQFDLI