Your browser is old and dusty. Try Google Chrome!

Details for ssl2162

ORF ssl2162
Accession NP_441636.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -236 -222 23.599 0.00309
NP_441061.1_2 Forward -341 -327 0.786239 0.199
NP_441061.1_2 Reverse -327 -341 -1.27871 0.255
NP_440557.1_1 Forward -63 -44 4.71934 0.179
NP_440557.1_1 Reverse -229 -248 -0.688862 0.27
NP_442761.1_5 Forward -311 -292 19.3707 0.0459
NP_440795.1_7 Forward -236 -229 14.6904 0.0123
NP_440795.1_7 Reverse -229 -236 14.6904 0.0123
NP_441418.1_6 Reverse -228 -247 -26.9432 0.201
NP_441418.1_6 Forward -237 -218 -29.1065 0.216
NP_441418.1_6 Reverse -163 -182 -29.7948 0.238
NP_442291.1_5 Forward -143 -127 -2.39974 0.215
NP_442291.1_5 Forward -238 -222 -2.89139 0.229
NP_440897.1_6 Forward -231 -212 -1.8696 0.198
NP_441453.1_4 Forward -237 -229 16.6374 0.00633
NP_441453.1_4 Reverse -228 -236 16.539 0.00633
NP_441453.1_4 Forward -336 -328 4.34598 0.257
NP_441453.1_4 Reverse -327 -335 4.24765 0.259
NP_441453.1_4 Reverse -222 -230 4.24765 0.259
NP_442151.1_6 Forward -231 -217 15.4376 0.0238
NP_442151.1_6 Reverse -228 -242 10.9143 0.113
NP_442151.1_6 Reverse -222 -236 9.2427 0.155
NP_442151.1_6 Forward -237 -223 8.75105 0.164
NP_440561.1_1 Forward -298 -279 9.43841 0.284
NP_441818.1_1 Forward -236 -225 10.1862 0.232
NP_441818.1_9 Forward -320 -301 -7.4737 0.272
NP_441630.1_8 Forward -122 -103 19.2715 0.215
NP_440348.1_3 Reverse -217 -236 14.8474 0.274
NP_440150.1_1 Reverse -289 -308 7.86593 0.0574
NP_440150.1_2 Forward -235 -216 11.6017 0.201
NP_442173.1_1 Reverse -229 -237 17.3257 0.00633
NP_442173.1_1 Forward -236 -228 15.4574 0.00633
NP_001035873.1_8 Reverse -192 -211 10.7175 0.224
NP_442752.1_4 Reverse -228 -235 13.8055 0.0199
NP_443027.1_4 Reverse -226 -236 14.0414 0.0452
NP_443027.1_4 Reverse -325 -335 8.73149 0.191
NP_443027.1_4 Forward -338 -328 7.25653 0.24
NP_443027.1_4 Forward -239 -229 6.56821 0.275
NP_442975.1_10 Forward -241 -227 1.76896 0.291
NP_440784.1_7 Forward -236 -229 15.9687 0.0123
NP_440784.1_7 Reverse -229 -236 15.9687 0.0123
NP_442909.1_7 Forward -236 -222 13.6669 0.12
NP_442861.1_4 Forward -276 -257 1.27698 0.297
NP_440061.1_9 Forward -239 -225 7.17714 0.216
NP_440061.1_9 Reverse -226 -240 6.58715 0.239
NP_440110.1_4 Forward -248 -229 6.58763 0.15
NP_441054.1_1 Reverse -221 -235 19.3708 0.122
NP_441476.1_5 Forward -242 -223 -6.39206 0.273
NP_442062.1_3 Reverse -61 -80 3.93269 0.198
NP_442062.1_8 Reverse -228 -238 17.0896 0.0025
NP_442062.1_8 Forward -237 -227 14.9263 0.0108
NP_442062.1_8 Forward -330 -320 10.7964 0.0493
NP_440761.1_4 Reverse -111 -130 -12.4886 0.257
NP_442974.1_5 Reverse -320 -339 16.8141 0.0932
NP_440304.1_4 Reverse -226 -236 10.8948 0.051
NP_440304.1_4 Reverse -325 -335 8.73149 0.0678
NP_440304.1_4 Reverse -53 -63 5.97822 0.185
NP_440304.1_7 Reverse -137 -155 20.2753 0.201
NP_442242.1_4 Forward -236 -229 14.3954 0.0124
NP_442242.1_4 Reverse -229 -236 14.3954 0.0124
NP_440044.1_1 Forward -356 -337 12.4875 0.233
NP_440044.1_8 Forward -236 -217 3.04771 0.14
NP_440044.1_8 Reverse -229 -248 -0.688862 0.225
NP_440044.1_8 Reverse -50 -69 -3.63879 0.288
NP_442762.1_10 Forward -335 -316 -12.1936 0.284
NP_439918.1_2 Reverse -273 -292 3.73603 0.181
NP_439918.1_2 Reverse -279 -298 -2.75381 0.249
NP_442359.1_6 Reverse -143 -162 14.4541 0.11
NP_440764.1_10 Reverse -286 -305 16.7149 0.141
NP_441594.1_6 Reverse -219 -238 4.916 0.211
NP_441594.1_6 Forward -371 -352 -0.39387 0.299
NP_442110.1_7 Forward -237 -223 20.8458 0.013
NP_442110.1_7 Forward -336 -322 2.75286 0.222
NP_442110.1_7 Reverse -228 -242 2.35953 0.222
NP_442110.1_7 Reverse -272 -286 0.88457 0.245
NP_442110.1_7 Reverse -157 -171 -0.000409212 0.27
NP_442726.1_7 Forward -300 -282 -1.65248 0.297
NP_441083.1_3 Reverse -141 -151 17.3841 0.0681
NP_441083.1_5 Forward -237 -227 11.0914 0.0166
NP_441083.1_5 Reverse -228 -238 10.5014 0.0197
NP_441083.1_5 Reverse -297 -307 4.40493 0.146
NP_441083.1_5 Forward -231 -221 -0.511621 0.269
NP_441434.1_6 Reverse -53 -63 16.2046 0.258
NP_441738.1_2 Forward -235 -228 15.28 0.0102
NP_441738.1_2 Reverse -230 -237 11.5435 0.084
NP_441738.1_2 Forward -290 -283 6.52862 0.261
NP_441558.1_5 Reverse -226 -245 18.4857 0.0131
NP_441558.1_5 Forward -233 -214 16.8141 0.0262
NP_440209.1_1 Reverse -228 -236 18.1123 0.00295
NP_440209.1_1 Forward -237 -229 8.57422 0.0425
NP_442889.1_1 Reverse -326 -345 -12.4886 0.23
NP_441713.1_7 Reverse -284 -303 13.6675 0.293
NP_441770.1_4 Reverse -134 -153 -11.8986 0.29
NP_442570.1_3 Forward -338 -319 -5.11376 0.24
NP_442570.1_3 Reverse -276 -295 -5.9004 0.25
NP_442461.1_2 Forward -54 -35 13.0775 0.274
NP_442445.1_1 Reverse -223 -242 12.4875 0.256
NP_441716.1_1 Reverse -222 -236 10.3243 0.0963
NP_441716.1_1 Forward -237 -223 3.14618 0.278
NP_442111.1_4 Forward -238 -224 10.816 0.0518
NP_442111.1_4 Reverse -227 -241 2.65453 0.268
NP_441163.1_1 Forward -325 -308 11.0512 0.194
NP_441163.1_1 Forward -300 -283 7.60959 0.241
NP_441163.1_4 Forward -292 -273 12.7268 0.278
NP_441163.1_4 Reverse -311 -330 12.5332 0.288
NP_440906.1_5 Forward -236 -229 15.8704 0.0124
NP_440906.1_5 Reverse -229 -236 15.8704 0.0124
NP_440747.1_10 Forward -240 -228 14.9853 0.00221
NP_440747.1_10 Reverse -225 -237 7.4138 0.00422
NP_440747.1_10 Forward -130 -118 -12.0557 0.199
NP_440747.1_10 Forward -339 -327 -12.1541 0.227
NP_441854.1_10 Forward -308 -289 -0.000545616 0.286
NP_441486.1_1 Reverse -225 -239 15.7325 0.00595
NP_441486.1_1 Forward -240 -226 11.3077 0.0164
NP_441486.1_1 Forward -234 -220 2.06454 0.0918
NP_442634.1_4 Reverse -325 -339 -2.75368 0.156
NP_442634.1_4 Forward -338 -324 -4.62196 0.211
NP_440470.1_5 Reverse -62 -81 14.6576 0.158
NP_440842.1_4 Forward -88 -69 21.3801 0.019
NP_440842.1_10 Forward -296 -282 1.57289 0.288
NP_441695.1_8 Reverse -327 -341 9.93102 0.295
NP_441014.1_5 Reverse -217 -235 10.2456 0.263
NP_442848.1_1 Reverse -222 -236 7.37441 0.0791
NP_442848.1_1 Forward -237 -223 4.22782 0.109
NP_442848.1_1 Reverse -321 -335 -4.22864 0.282
NP_442848.1_5 Reverse -289 -307 -2.83245 0.286
NP_441012.1_4 Reverse -323 -336 13.9823 0.208
NP_441012.1_4 Reverse -224 -237 9.75405 0.272
NP_441012.1_4 Forward -235 -222 5.82081 0.29
NP_443018.1_3 Forward -236 -229 14.8871 0.0123
NP_443018.1_3 Reverse -229 -236 14.8871 0.0123
NP_443018.1_3 Forward -335 -328 12.5271 0.0523
NP_443018.1_3 Forward -230 -223 12.5271 0.0523
NP_443018.1_3 Reverse -328 -335 12.5271 0.0523
NP_443018.1_3 Reverse -223 -230 12.5271 0.0523
NP_441634.1_8 Reverse -131 -145 -3.93365 0.295
NP_441634.1_8 Reverse -220 -234 -4.81863 0.298
NP_440376.1_1 Forward -237 -228 9.73449 0.0365
NP_440376.1_1 Reverse -228 -237 9.63616 0.0385
NP_440376.1_1 Forward -127 -118 1.96635 0.236
NP_441588.1_4 Reverse -230 -240 9.7148 0.14
NP_441588.1_4 Forward -229 -219 5.09324 0.297
NP_442687.1_7 Reverse -227 -237 7.94484 0.121
NP_442191.1_4 Forward -335 -321 11.8657 0.238
NP_441077.1_2 Forward -78 -59 6.82725 0.196
NP_441013.1_2 Reverse -316 -334 10.5406 0.171
NP_441013.1_2 Forward -242 -224 -4.8974 0.299
NP_441013.1_3 Forward -163 -144 5.70265 0.281
NP_441422.1_7 Forward -239 -222 -2.02611 0.204
NP_441422.1_7 Reverse -319 -336 -8.81095 0.282
NP_442735.1_2 Reverse -128 -147 3.14605 0.279
NP_442296.1_5 Forward -356 -337 1.57275 0.281
NP_442296.1_5 Forward -229 -210 0.687771 0.289
NP_442658.1_1 Forward -144 -134 12.0743 0.0643
NP_442658.1_1 Reverse -319 -329 10.5993 0.114
NP_442658.1_1 Reverse -226 -236 6.76441 0.214
NP_442658.1_1 Forward -239 -229 5.87944 0.246
NP_441855.2_4 Forward -301 -282 13.3793 0.172
NP_441855.2_4 Reverse -220 -239 9.61947 0.275
NP_442782.1_2 Reverse -327 -341 13.0776 0.173
NP_442782.1_2 Forward -136 -122 9.14437 0.198
NP_442782.1_2 Reverse -211 -225 1.76955 0.281
NP_442782.1_2 Reverse -228 -242 0.0979218 0.296
NP_442782.1_7 Reverse -220 -239 21.0423 0.0147
NP_442205.1_9 Reverse -222 -238 -1.90808 0.264
NP_441414.1_9 Forward -231 -212 -1.08219 0.0977
NP_441414.1_9 Reverse -228 -247 -9.14533 0.254
NP_441487.1_6 Reverse -301 -320 -1.7705 0.285
NP_442300.1_10 Forward -135 -116 11.5042 0.282
NP_442937.1_5 Reverse -217 -236 12.7825 0.101
NP_441958.1_5 Reverse -227 -237 10.9931 0.00875
NP_441958.1_5 Forward -238 -228 2.53664 0.0409
NP_441958.1_5 Reverse -326 -336 0.373358 0.154
NP_441127.1_1 Forward -302 -288 8.65272 0.288
NP_441127.1_1 Reverse -222 -236 7.57108 0.3
NP_440203.1_5 Forward -234 -224 15.7125 0.0611
NP_440203.1_5 Forward -61 -51 12.0743 0.166
NP_443001.1_7 Forward -236 -217 1.17943 0.286
NP_440984.1_7 Reverse -217 -231 7.37441 0.175
NP_439990.1_5 Reverse -223 -236 11.3273 0.128
NP_439990.1_5 Forward -242 -229 9.36073 0.145
NP_442690.1_1 Reverse -62 -81 -3.14714 0.142
NP_442911.1_2 Reverse -218 -237 -5.31042 0.155
NP_442911.1_2 Forward -247 -228 -8.06369 0.226
NP_441580.1_6 Reverse -316 -335 0.0977854 0.149
NP_440369.1_6 Reverse -134 -153 8.55425 0.284
NP_442064.1_4 Forward -241 -222 8.84842 0.224
NP_440993.1_4 Forward -293 -276 8.98696 0.216
NP_440827.1_3 Forward -242 -223 17.5024 0.101
NP_442210.1_9 Forward -241 -223 7.98396 0.281
NP_440138.1_6 Reverse -322 -341 13.2733 0.109
NP_441348.1_7 Reverse -327 -346 5.70265 0.289
NP_441099.1_5 Forward -247 -228 -7.86702 0.181
NP_441099.1_5 Forward -316 -297 -9.24366 0.216
NP_441099.1_5 Reverse -218 -237 -9.44032 0.223
NP_440411.1_10 Forward -66 -47 8.70022 0.293
NP_441646.1_1 Forward -133 -114 -1.47551 0.287
NP_442438.1_10 Forward -242 -228 8.16106 0.0812
NP_442438.1_10 Reverse -223 -237 8.16106 0.0812
NP_441000.1_6 Forward -173 -159 -4.62196 0.248
NP_440147.1_4 Forward -239 -226 9.2624 0.0423
NP_440147.1_4 Reverse -226 -239 0.117615 0.265
NP_440147.1_6 Forward -395 -376 17.7974 0.238
NP_441175.1_7 Reverse -228 -247 6.29264 0.262
NP_441550.1_8 Reverse -226 -236 12.3692 0.0336
NP_441550.1_8 Forward -239 -229 9.81266 0.0836
NP_441916.1_7 Forward -237 -227 10.9931 0.0261
NP_441916.1_7 Reverse -228 -238 8.23984 0.0476
NP_441916.1_7 Forward -336 -326 7.05986 0.0779
NP_441916.1_7 Reverse -327 -337 4.3066 0.182
NP_441916.1_10 Reverse -47 -66 8.45592 0.169
NP_441916.1_10 Reverse -220 -239 0.982764 0.27
NP_441041.1_4 Forward -336 -317 2.26107 0.0743
NP_441041.1_4 Reverse -228 -247 0.786102 0.0837
NP_441041.1_4 Reverse -321 -340 -3.44213 0.122
NP_441041.1_4 Forward -237 -218 -9.44032 0.216
NP_441041.1_4 Reverse -216 -235 -10.4236 0.232
NP_441041.1_4 Reverse -222 -241 -10.6203 0.235
NP_441041.1_4 Reverse -272 -291 -13.4719 0.288
NP_441041.1_7 Forward -240 -228 7.70913 0.162
NP_441547.1_2 Reverse -217 -235 16.5388 0.0911
NP_442004.1_6 Forward -237 -223 20.3541 0.0534
NP_442004.1_6 Reverse -228 -242 3.73617 0.232
NP_441725.1_5 Forward -236 -226 11.2881 0.0247
NP_441725.1_5 Forward -335 -325 -0.609952 0.265
NP_441725.1_5 Reverse -164 -174 -1.10161 0.288
NP_439966.1_7 Reverse -226 -236 15.8108 0.0124
NP_439966.1_7 Reverse -161 -171 4.99446 0.248
NP_442941.1_3 Forward -236 -226 19.9412 0.00262
NP_442941.1_3 Reverse -229 -239 8.53483 0.0348
NP_442941.1_3 Forward -335 -325 0.373358 0.212
NP_440983.1_5 Reverse -37 -56 5.60432 0.178
NP_440260.1_8 Forward -246 -228 -5.29072 0.273
NP_441678.1_9 Forward -342 -323 1.76941 0.223
NP_442281.1_1 Forward -242 -228 18.1901 0.00483
NP_442281.1_1 Reverse -223 -237 11.7987 0.0437
NP_442281.1_1 Reverse -322 -336 6.19383 0.133
NP_442281.1_1 Forward -341 -327 2.35894 0.269
NP_442256.1_2 Reverse -226 -244 -7.55234 0.214
NP_441556.1_10 Forward -242 -228 12.7526 0.195
NP_441644.1_6 Forward -237 -227 15.0242 0.00766
NP_441644.1_6 Forward -336 -326 13.2542 0.0212
NP_441644.1_6 Forward -231 -221 11.2876 0.0524
NP_441644.1_6 Reverse -222 -232 10.206 0.0628
NP_441644.1_6 Reverse -228 -238 7.94438 0.113
NP_441644.1_6 Reverse -327 -337 6.17443 0.165
NP_443049.1_2 Reverse -325 -344 11.8975 0.222
NP_441071.1_3 Forward -211 -192 7.27514 0.276
NP_442215.1_2 Reverse -226 -242 6.35172 0.0719
NP_442215.1_2 Forward -239 -223 4.18844 0.0866
NP_442029.1_6 Forward -242 -223 9.73422 0.184
NP_442029.1_6 Reverse -223 -242 9.3409 0.191
NP_442029.1_6 Reverse -217 -236 8.84924 0.2
NP_440929.1_8 Forward -237 -228 9.93116 0.0249
NP_440929.1_8 Reverse -228 -237 9.83282 0.0254
NP_442933.1_10 Forward -237 -228 17.601 0.00325
NP_442933.1_10 Reverse -228 -237 17.601 0.00325
NP_442933.1_10 Reverse -327 -336 4.42462 0.246
NP_442933.1_10 Forward -336 -327 4.42462 0.246
NP_441751.2_8 Forward -236 -222 16.3225 0.00876
NP_441751.2_8 Reverse -328 -342 -5.01529 0.19
NP_442554.1_8 Forward -236 -226 15.9097 0.00747
NP_442554.1_8 Forward -335 -325 14.828 0.0108
NP_442554.1_8 Forward -230 -220 13.1564 0.0193
NP_442554.1_8 Reverse -229 -239 5.68323 0.141
NP_442554.1_8 Reverse -328 -338 5.48657 0.146
NP_442554.1_8 Reverse -223 -233 4.20827 0.193
NP_442167.1_1 Reverse -59 -78 12.9791 0.244
NP_441762.1_7 Forward -238 -226 -5.07423 0.187
NP_441762.1_7 Reverse -227 -239 -7.04085 0.285
NP_442313.1_5 Reverse -328 -347 4.03102 0.279
NP_442142.1_4 Reverse -225 -238 13.8833 0.0324
NP_442142.1_4 Reverse -324 -337 11.1301 0.062
NP_442142.1_4 Forward -234 -221 7.49186 0.137
NP_442142.1_4 Forward -240 -227 5.32859 0.194
NP_442142.1_4 Forward -339 -326 5.13193 0.201
NP_442142.1_4 Forward -333 -320 3.16532 0.265
NP_442292.1_1 Forward -236 -227 18.486 0.00229
NP_442292.1_1 Reverse -229 -238 9.53783 0.0183
NP_442292.1_1 Forward -230 -221 5.80125 0.129
NP_442292.1_1 Forward -335 -326 4.81794 0.17
NP_442143.1_3 Reverse -50 -69 2.75272 0.244
NP_440895.1_6 Reverse -222 -235 9.85238 0.214
NP_441523.1_6 Reverse -293 -312 4.916 0.246
NP_443009.1_5 Reverse -227 -238 7.82632 0.118
NP_443009.1_5 Forward -238 -227 4.8764 0.226
NP_441715.1_3 Reverse -291 -301 19.0562 0.0871
NP_441715.1_4 Forward -236 -226 14.828 0.0268
NP_441715.1_4 Reverse -229 -239 6.66654 0.132
NP_440158.1_1 Reverse -41 -60 14.9441 0.105
NP_440158.1_1 Forward -76 -57 10.1695 0.262
NP_441198.1_8 Reverse -325 -335 10.3415 0.28
NP_441468.1_1 Forward -236 -229 15.8704 0.0124
NP_441468.1_1 Reverse -229 -236 15.8704 0.0124
NP_441468.1_1 Reverse -328 -335 3.97235 0.277
NP_441468.1_1 Reverse -223 -230 3.97235 0.277
NP_441468.1_1 Forward -335 -328 3.97235 0.277
NP_441468.1_1 Forward -230 -223 3.97235 0.277
NP_441015.1_10 Reverse -223 -242 12.7825 0.0617
NP_441015.1_10 Forward -236 -217 7.47261 0.0996
NP_441015.1_10 Forward -335 -316 -10.227 0.283
NP_441015.1_10 Reverse -322 -341 -10.522 0.284
NP_441015.1_10 Reverse -217 -236 -11.5053 0.298
NP_441673.1_1 Forward -237 -228 11.1111 0.0121
NP_441673.1_1 Reverse -228 -237 11.0128 0.018
NP_441731.1_3 Reverse -220 -239 -5.9004 0.29
NP_441876.1_9 Forward -96 -86 13.3526 0.267
NP_441876.1_9 Reverse -313 -323 11.091 0.28
NP_441426.1_4 Forward -331 -312 2.3594 0.29
NP_441826.1_2 Reverse -222 -236 15.4376 0.0196
NP_441826.1_2 Forward -336 -322 0.982901 0.167
NP_441826.1_2 Forward -237 -223 0.88457 0.17
NP_441826.1_2 Forward -243 -229 -2.36035 0.271
NP_441826.1_2 Reverse -321 -335 -4.62196 0.298
NP_441330.1_1 Forward -242 -223 -14.7502 0.242
NP_442490.1_9 Reverse -216 -235 5.99764 0.161
NP_441764.1_8 Forward -105 -95 11.6935 0.284
NP_442868.1_6 Reverse -226 -236 9.91146 0.038
NP_442868.1_6 Forward -239 -229 0.963343 0.205
NP_442868.1_6 Forward -294 -284 0.471689 0.226
NP_441056.1_1 Forward -237 -218 14.5524 0.0381
NP_442361.1_3 Forward -243 -230 16.4406 0.0685
NP_442361.1_3 Reverse -222 -235 8.47575 0.285
NP_442775.1_6 Reverse -223 -242 12.3892 0.277
NP_442775.1_6 Reverse -164 -183 10.0292 0.283
NP_440145.1_3 Forward -247 -228 -0.688862 0.143
NP_440145.1_3 Forward -346 -327 -3.24547 0.192
NP_442050.1_5 Reverse -226 -236 16.4991 0.00812
NP_442050.1_5 Forward -239 -229 6.76441 0.282
NP_442050.1_6 Forward -319 -300 13.4708 0.222
NP_442342.1_9 Reverse -290 -306 8.61333 0.193
NP_440334.1_2 Forward -141 -128 13.6873 0.298
NP_440385.1_6 Forward -278 -259 14.6576 0.165
NP_440558.1_2 Reverse -219 -238 9.63589 0.1
NP_440558.1_2 Forward -339 -320 5.60432 0.142
NP_440558.1_2 Reverse -139 -158 -5.11376 0.253
NP_440558.1_2 Forward -296 -277 -5.21209 0.254
NP_440558.1_2 Forward -136 -117 -6.1954 0.272
NP_440558.1_3 Forward -304 -285 3.24438 0.283
NP_441878.1_6 Forward -337 -327 0.766681 0.134
NP_441878.1_6 Reverse -326 -336 0.668351 0.139
NP_441878.1_6 Forward -238 -228 0.668351 0.139
NP_441878.1_6 Reverse -221 -231 0.668351 0.139
NP_441878.1_6 Forward -232 -222 0.57002 0.14
NP_441878.1_6 Reverse -227 -237 0.57002 0.14
NP_441878.1_6 Forward -127 -117 -0.0199663 0.163
NP_441036.1_8 Forward -238 -228 8.04317 0.177
NP_442650.1_2 Reverse -228 -242 8.25939 0.13
NP_442650.1_2 Forward -237 -223 6.98109 0.13
NP_441557.1_5 Reverse -228 -237 18.6826 0.0015
NP_441557.1_5 Forward -237 -228 10.5211 0.00695
NP_441557.1_5 Reverse -327 -336 -0.885252 0.26
NP_441445.1_1 Reverse -219 -238 1.67108 0.248
NP_442066.2_4 Reverse -228 -247 -7.4737 0.28
NP_442419.1_2 Forward -242 -223 -2.85214 0.247
NP_440101.1_3 Forward -341 -322 2.75272 0.246
NP_440101.1_3 Forward -242 -223 2.75272 0.246
NP_441458.1_10 Reverse -219 -238 17.5024 0.0661
NP_441458.1_10 Forward -240 -221 6.09597 0.204
NP_442830.1_5 Forward -294 -280 -0.984293 0.299
NP_442183.1_1 Forward -237 -223 12.4876 0.0579
NP_440190.1_3 Forward -110 -91 12.3189 0.268
NP_439980.1_1 Reverse -217 -236 14.7609 0.286
NP_441574.1_1 Forward -249 -230 -6.68705 0.277
NP_442347.1_2 Forward -236 -227 12.4878 0.056
NP_442347.1_2 Reverse -229 -238 2.94966 0.292
NP_442645.1_2 Reverse -220 -239 -9.34199 0.14
NP_442645.1_2 Forward -338 -319 -10.9153 0.144
NP_442645.1_2 Forward -239 -220 -16.6185 0.237
NP_441890.1_5 Reverse -310 -329 16.3224 0.209
NP_442594.1_7 Reverse -217 -236 12.0933 0.16
NP_441633.1_3 Forward -239 -226 -6.2739 0.242
NP_440136.1_2 Forward -236 -229 15.9687 0.0123
NP_440136.1_2 Reverse -229 -236 15.9687 0.0123
NP_442590.1_10 Forward -336 -317 3.44104 0.293
NP_442590.1_10 Forward -237 -218 3.04771 0.297
NP_442998.1_5 Forward -383 -373 11.3864 0.187
NP_442998.1_10 Forward -235 -228 15.5754 0.0102
NP_442998.1_10 Reverse -230 -237 5.74231 0.255
NP_440899.1_1 Forward -148 -129 12.8967 0.145
NP_440299.1_1 Reverse -224 -237 22.4381 0.000547
NP_440299.1_1 Forward -241 -228 18.8982 0.00321
NP_440299.1_1 Reverse -218 -231 3.36198 0.247
NP_441799.1_1 Forward -241 -227 7.96378 0.128
NP_441799.1_1 Forward -340 -326 6.19383 0.179
NP_441799.1_1 Reverse -224 -238 4.52221 0.247
NP_440640.1_9 Forward -142 -123 17.699 0.165
NP_442802.1_6 Reverse -296 -315 -4.52377 0.256
NP_441007.1_10 Reverse -223 -236 1.39592 0.203
NP_442333.2_5 Reverse -316 -335 -15.5368 0.298
NP_440256.1_1 Forward -339 -320 14.4541 0.00842
NP_440256.1_1 Forward -240 -221 -4.32711 0.152
NP_440256.1_1 Reverse -225 -244 -9.24366 0.275
NP_440709.1_1 Forward -80 -61 17.4032 0.0302
NP_441559.1_8 Reverse -316 -330 1.67122 0.155
NP_440915.1_6 Forward -340 -326 4.52282 0.0953
NP_440915.1_6 Forward -241 -227 1.86788 0.131
NP_440915.1_6 Forward -305 -291 -1.96703 0.254
NP_441866.1_6 Forward -239 -220 6.98015 0.285
NP_442069.1_4 Forward -153 -134 4.52268 0.254
NP_440748.1_5 Reverse -323 -342 3.93269 0.204
NP_440748.1_5 Forward -290 -271 2.0644 0.224
NP_441464.1_1 Reverse -149 -168 7.7676 0.261
NP_440695.1_5 Reverse -228 -247 -1.27885 0.284
NP_440695.1_5 Forward -237 -218 -2.16383 0.296
NP_440695.1_6 Forward -102 -88 15.4531 0.181
NP_441939.1_3 Reverse -229 -248 8.25926 0.177
NP_441494.1_6 Forward -322 -309 6.50913 0.285
NP_440677.1_6 Reverse -219 -238 7.7676 0.291
NP_442386.1_9 Forward -238 -229 14.8472 0.0287
NP_442386.1_9 Reverse -227 -236 13.8639 0.0289
NP_442386.1_9 Forward -232 -223 12.2907 0.0676
NP_442386.1_9 Reverse -221 -230 10.324 0.132
NP_442386.1_9 Reverse -320 -329 8.84908 0.182
NP_440570.1_5 Reverse -212 -231 4.12936 0.231
NP_441340.1_5 Forward -236 -229 15.6737 0.0124
NP_441340.1_5 Reverse -229 -236 15.6737 0.0124
NP_441340.1_5 Reverse -328 -335 4.07068 0.239
NP_441340.1_5 Reverse -223 -230 4.07068 0.239
NP_441340.1_5 Forward -335 -328 4.07068 0.239
NP_441340.1_5 Forward -230 -223 4.07068 0.239
NP_442484.1_2 Reverse -211 -230 5.60432 0.167
NP_442484.1_2 Forward -242 -223 -0.39387 0.262
NP_442484.1_2 Forward -248 -229 -1.08219 0.284
NP_442240.1_2 Reverse -229 -248 -8.45701 0.137
NP_442240.1_2 Reverse -328 -347 -19.8634 0.295
NP_440586.1_8 Forward -236 -229 13.2151 0.026
NP_440586.1_8 Reverse -229 -236 13.2151 0.026
NP_440586.1_8 Forward -335 -328 7.61025 0.227
NP_440586.1_8 Forward -230 -223 7.61025 0.227
NP_440586.1_8 Reverse -328 -335 7.61025 0.227
NP_440586.1_8 Reverse -223 -230 7.61025 0.227
NP_440452.1_2 Forward -56 -37 14.9449 0.247
NP_442251.1_6 Forward -236 -229 15.2804 0.0124
NP_442251.1_6 Reverse -229 -236 15.2804 0.0124
NP_441912.1_3 Forward -231 -212 5.60432 0.297
NP_440684.1_9 Reverse -222 -236 12.291 0.168
NP_441262.1_3 Reverse -228 -235 14.7888 0.0223
NP_441262.1_3 Forward -237 -230 13.9038 0.0336
NP_440027.1_3 Reverse -317 -335 6.99988 0.218
NP_440027.1_3 Forward -346 -328 3.06666 0.28
NP_440027.1_8 Forward -240 -221 15.0432 0.148
NP_443051.1_1 Reverse -227 -236 10.4228 0.00754
NP_443051.1_1 Forward -238 -229 1.08137 0.123
NP_443051.1_1 Reverse -326 -335 -0.000272808 0.245
NP_440408.1_7 Forward -237 -218 12.8808 0.2
NP_440408.1_7 Reverse -222 -241 11.2092 0.229
NP_440439.1_1 Reverse -225 -238 0.805932 0.175
NP_439943.1_7 Reverse -223 -242 9.53756 0.168
NP_440372.1_2 Forward -236 -229 16.3621 0.0124
NP_440372.1_2 Reverse -229 -236 16.3621 0.0124
NP_442783.1_10 Forward -290 -280 16.8925 0.149
NP_441789.1_7 Forward -310 -291 -5.40949 0.298
NP_440316.1_10 Reverse -221 -231 8.4365 0.239
NP_440316.1_10 Reverse -326 -336 6.27322 0.264
NP_441803.1_2 Reverse -223 -242 17.2074 0.0309
NP_439977.1_5 Forward -243 -224 1.0811 0.196
NP_439977.1_5 Forward -342 -323 -0.787193 0.236
NP_440139.1_1 Reverse -157 -176 0.785326 0.281
NP_441572.1_7 Forward -148 -129 -4.81876 0.244
NP_442887.1_5 Forward -376 -357 -4.81876 0.264
NP_442384.1_10 Forward -237 -224 16.9322 0.00688
NP_442384.1_10 Reverse -228 -241 7.59077 0.0784
NP_442384.1_10 Reverse -321 -334 3.06754 0.203
NP_441604.1_4 Reverse -214 -233 -5.11376 0.248
NP_441877.1_7 Reverse -316 -335 4.52188 0.218
NP_441877.1_7 Reverse -158 -177 0.981987 0.248
NP_441877.1_9 Reverse -59 -76 7.41366 0.271
NP_441018.1_7 Reverse -218 -237 17.6007 0.069
NP_441018.1_7 Forward -241 -222 15.2408 0.115
NP_441018.1_7 Forward -167 -148 8.84924 0.239
NP_442262.1_10 Forward -236 -229 14.1988 0.0123
NP_442262.1_10 Reverse -229 -236 14.1988 0.0123
NP_442262.1_10 Forward -335 -328 10.4622 0.145
NP_442262.1_10 Forward -230 -223 10.4622 0.145
NP_442262.1_10 Reverse -328 -335 10.4622 0.145
NP_442262.1_10 Reverse -223 -230 10.4622 0.145
NP_441689.1_5 Reverse -226 -236 15.3192 0.0403
NP_441689.1_5 Forward -239 -229 8.04271 0.166
NP_440163.1_10 Reverse -225 -235 12.4681 0.159
NP_440344.1_10 Reverse -221 -238 -6.54933 0.114
NP_440344.1_10 Reverse -111 -128 -12.2525 0.246
NP_440282.1_3 Reverse -44 -63 0.58944 0.281
NP_440282.1_10 Forward -310 -291 -10.0303 0.29
NP_440562.1_3 Reverse -229 -246 6.92201 0.15
NP_441965.1_10 Reverse -225 -241 3.40179 0.265
NP_441965.1_10 Reverse -324 -340 3.00846 0.277
NP_441640.1_8 Forward -236 -217 5.50599 0.111
NP_441640.1_8 Reverse -223 -242 2.26107 0.159
NP_440838.1_5 Reverse -136 -155 10.5209 0.271
NP_440297.1_9 Forward -236 -226 9.32148 0.0917
NP_440297.1_9 Forward -335 -325 9.22315 0.0917
NP_440297.1_9 Reverse -50 -60 6.46988 0.185
NP_440297.1_9 Reverse -223 -233 0.865012 0.282
NP_440297.1_9 Forward -230 -220 -0.118297 0.282
NP_440297.1_9 Reverse -333 -343 -0.216628 0.282
NP_442280.1_10 Reverse -212 -230 14.1231 0.13
NP_441896.1_5 Reverse -332 -339 12.2322 0.273
NP_440999.1_1 Reverse -289 -308 6.48849 0.184
NP_440999.1_9 Forward -241 -227 3.53951 0.128
NP_440999.1_9 Reverse -317 -331 0.491246 0.183
NP_440888.1_2 Forward -237 -223 14.8469 0.0144
NP_440888.1_2 Forward -330 -316 6.88214 0.217
NP_440888.1_2 Reverse -228 -242 6.29216 0.241
NP_440888.1_2 Forward -336 -322 5.30886 0.284
NP_440600.1_4 Forward -245 -227 -2.83245 0.209
NP_440491.1_1 Reverse -225 -244 14.7136 0.0994
NP_441123.1_8 Forward -162 -143 13.5691 0.243
NP_442818.1_3 Forward -35 -18 -5.07437 0.259
NP_441543.1_2 Forward -236 -227 16.9127 0.00359
NP_441543.1_2 Reverse -229 -238 13.8644 0.021
NP_441543.1_2 Forward -230 -221 5.11294 0.209
NP_441543.1_2 Forward -335 -326 4.12963 0.279
NP_442845.1_2 Reverse -222 -236 18.1908 0.0608
NP_442845.1_2 Reverse -216 -230 12.291 0.114
NP_442845.1_2 Forward -342 -328 8.55439 0.193
NP_442845.1_2 Forward -237 -223 7.07942 0.199
NP_442845.1_2 Forward -243 -229 6.3911 0.21
NP_442845.1_2 Reverse -321 -335 5.50613 0.231
NP_441834.1_10 Forward -236 -217 7.27595 0.26
NP_441834.1_10 Reverse -223 -242 4.916 0.26
NP_441834.1_10 Forward -335 -316 3.44104 0.26
NP_441319.1_5 Reverse -134 -153 8.75091 0.281
NP_441918.1_10 Reverse -292 -310 16.7354 0.119
NP_441469.1_8 Reverse -227 -236 6.48957 0.227
NP_443064.1_6 Reverse -297 -307 11.7912 0.119
NP_443064.1_6 Forward -237 -227 9.75513 0.199
NP_443064.1_6 Reverse -228 -238 8.97947 0.254
NP_442337.1_8 Forward -162 -143 5.60432 0.21
NP_442578.1_7 Forward -236 -229 14.5921 0.026
NP_442578.1_7 Reverse -229 -236 14.5921 0.026
NP_441462.1_2 Reverse -228 -238 10.5998 0.0068
NP_441462.1_2 Forward -237 -227 1.84832 0.081
NP_441462.1_2 Reverse -327 -337 -0.314959 0.206
NP_443062.1_1 Forward -231 -213 7.96088 0.163
NP_443062.1_1 Forward -237 -219 4.84065 0.247
NP_443062.1_1 Forward -336 -318 4.64563 0.255
NP_440519.1_3 Forward -69 -50 7.66927 0.285
NP_442204.1_1 Reverse -224 -235 9.69511 0.0736
NP_442204.1_1 Reverse -51 -62 1.23864 0.277
NP_442204.1_1 Reverse -323 -334 1.04198 0.281
NP_440454.1_2 Reverse -36 -50 11.9481 0.268
NP_440516.1_8 Reverse -228 -237 9.4395 0.0183
NP_440516.1_8 Forward -237 -228 7.17789 0.0754
NP_440516.1_8 Reverse -222 -231 -0.590259 0.283
NP_442428.1_5 Forward -236 -229 15.8704 0.0124
NP_442428.1_5 Reverse -229 -236 15.8704 0.0124
NP_442428.1_5 Forward -335 -328 4.36568 0.271
NP_442428.1_5 Reverse -328 -335 4.36568 0.271
NP_442428.1_5 Forward -230 -223 4.36568 0.271
NP_442428.1_5 Reverse -223 -230 4.36568 0.271
NP_442859.1_2 Reverse -328 -347 23.6972 0.0355
NP_442859.1_2 Reverse -322 -341 1.76941 0.297
NP_440673.1_2 Reverse -132 -151 11.0725 0.188
NP_440673.1_2 Reverse -317 -336 8.24345 0.275
NP_440673.1_3 Reverse -230 -237 14.0021 0.0426
NP_440673.1_3 Forward -235 -228 12.4288 0.0426
NP_441714.1_3 Forward -244 -226 13.9813 0.202
NP_441052.1_2 Forward -231 -221 14.3364 0.0224
NP_441052.1_2 Forward -237 -227 11.4848 0.0285
NP_441052.1_2 Reverse -228 -238 10.1081 0.0295
NP_441052.1_2 Reverse -222 -232 4.0116 0.168
NP_442219.1_8 Forward -235 -216 12.9988 0.153
NP_442219.1_9 Reverse -229 -238 18.486 0.00718
NP_442219.1_9 Forward -236 -227 17.7976 0.00718
NP_440436.1_4 Forward -236 -227 17.2072 0.00233
NP_440436.1_4 Reverse -229 -238 15.9289 0.00508
NP_440436.1_4 Reverse -134 -143 7.47246 0.129
NP_440436.1_4 Forward -230 -221 4.7192 0.244
NP_441893.1_5 Reverse -114 -128 18.0918 0.166
NP_441893.1_10 Forward -143 -124 13.9625 0.186
NP_442907.1_9 Reverse -322 -341 -5.9004 0.284
NP_441719.1_4 Forward -236 -229 16.3621 0.0124
NP_441719.1_4 Reverse -229 -236 16.3621 0.0124
NP_441004.1_1 Reverse -216 -235 -12.8819 0.251
NP_442366.1_3 Forward -238 -220 14.6705 0.0216
NP_442366.1_3 Reverse -227 -245 -0.177514 0.186
NP_442366.1_5 Forward -240 -230 10.0093 0.292
NP_442206.1_10 Reverse -228 -243 12.2713 0.0889
NP_442854.1_6 Reverse -327 -346 4.81767 0.249
NP_442854.1_6 Reverse -321 -340 0.687771 0.29
NP_442430.1_10 Forward -247 -228 14.2566 0.159
NP_442430.1_10 Reverse -153 -172 11.405 0.245
NP_441851.1_10 Reverse -227 -237 16.9913 0.00552
NP_441851.1_10 Forward -238 -228 6.56821 0.161
NP_441157.1_1 Forward -187 -173 5.1122 0.25
NP_442622.1_8 Forward -172 -154 -19.1554 0.296
NP_442011.1_1 Reverse -282 -301 -1.57384 0.268
NP_442856.1_7 Reverse -219 -238 -6.09707 0.295
NP_441668.1_4 Reverse -212 -231 0.196116 0.245
NP_441396.1_5 Forward -389 -380 7.27622 0.29
NP_440593.1_3 Forward -242 -223 7.86593 0.109
NP_440593.1_3 Reverse -217 -236 4.916 0.128
NP_440593.1_3 Forward -236 -217 2.45773 0.175
NP_440593.1_3 Reverse -223 -242 -3.63879 0.238
NP_440593.1_9 Reverse -287 -301 11.406 0.24
NP_440593.1_9 Forward -130 -116 8.65272 0.255
NP_442689.1_8 Reverse -66 -83 -4.18939 0.263
NP_441349.1_10 Reverse -218 -237 -0.590531 0.0947
NP_441349.1_10 Forward -161 -142 -6.39206 0.228
NP_441661.1_3 Reverse -85 -102 1.90713 0.226
NP_441409.1_5 Forward -101 -82 15.8299 0.153
NP_439960.1_4 Reverse -221 -240 15.2399 0.153
NP_439960.1_10 Forward -394 -376 -0.865831 0.238
NP_442450.1_5 Reverse -226 -236 9.32148 0.115
NP_440588.1_2 Reverse -219 -238 6.68596 0.0535
NP_440588.1_2 Reverse -288 -307 -5.21209 0.243
NP_442006.1_2 Forward -151 -134 -16.7758 0.264
NP_441003.1_9 Reverse -213 -232 9.14423 0.218
NP_440483.1_1 Forward -306 -287 -1.86883 0.208
NP_441570.1_1 Forward -336 -318 -0.374176 0.046
NP_441570.1_1 Reverse -222 -240 -7.84733 0.0968
NP_441078.1_4 Forward -237 -228 9.93116 0.0203
NP_441078.1_4 Reverse -228 -237 9.83282 0.0226
NP_441078.1_4 Reverse -222 -231 -1.6719 0.266
NP_441078.1_4 Forward -336 -327 -1.6719 0.266
NP_441078.1_4 Reverse -327 -336 -1.77023 0.266
NP_441078.1_4 Forward -231 -222 -1.77023 0.266
NP_442729.1_5 Reverse -221 -231 8.33817 0.248
NP_442388.1_4 Reverse -45 -64 9.63507 0.289
NP_442348.1_2 Reverse -308 -317 8.25953 0.28
NP_440526.1_3 Forward -236 -225 7.92465 0.126
NP_441432.1_8 Reverse -227 -236 16.8143 0.00595
NP_441432.1_8 Forward -238 -229 7.07956 0.105
NP_441432.1_8 Reverse -326 -335 6.19458 0.118
NP_441432.1_8 Reverse -221 -230 6.19458 0.118
NP_442320.1_8 Reverse -222 -236 5.70279 0.0334
NP_442320.1_8 Forward -243 -229 -4.62196 0.177
NP_442320.1_8 Reverse -216 -230 -5.80194 0.249
NP_441732.1_2 Forward -241 -225 -7.80794 0.0935
NP_441732.1_2 Reverse -224 -240 -7.80794 0.0935
NP_441732.1_2 Reverse -51 -67 -16.8544 0.207
NP_442540.1_5 Forward -341 -322 11.7983 0.233
NP_442157.1_9 Reverse -292 -311 15.9291 0.242
NP_440199.1_10 Reverse -324 -334 13.0581 0.114
NP_440199.1_10 Reverse -225 -235 7.64985 0.231
NP_441945.1_10 Forward -336 -317 11.6025 0.235
NP_441057.1_4 Reverse -133 -151 9.0656 0.141
NP_442353.1_4 Forward -243 -224 -0.689632 0.29
NP_440913.1_1 Forward -338 -320 18.2104 0.0951
NP_442751.1_2 Reverse -126 -145 7.07848 0.206
NP_440713.1_4 Reverse -218 -237 12.7825 0.103
NP_440713.1_4 Reverse -317 -336 1.27776 0.289
NP_442489.1_2 Forward -242 -223 15.3391 0.126
NP_442489.1_2 Reverse -217 -236 7.96426 0.172
NP_442489.1_2 Reverse -223 -242 1.57275 0.285
NP_442489.1_7 Forward -237 -228 10.4228 0.0151
NP_442489.1_7 Reverse -228 -237 10.3245 0.0193
NP_442489.1_7 Forward -336 -327 -1.6719 0.235
NP_442489.1_7 Reverse -222 -231 -1.6719 0.235
NP_442489.1_7 Forward -231 -222 -1.77023 0.247
NP_442489.1_7 Reverse -327 -336 -1.77023 0.247
NP_440559.1_1 Reverse -229 -238 17.5026 0.00658
NP_440559.1_1 Forward -236 -227 17.4043 0.00658
NP_441659.2_8 Forward -237 -227 15.9097 0.00467
NP_441659.2_8 Reverse -228 -238 8.53483 0.0412
NP_441659.2_8 Forward -336 -326 6.8632 0.0663
NP_440786.1_10 Forward -140 -121 18.879 0.22
NP_441040.1_5 Reverse -217 -236 9.24257 0.226
NP_441040.1_5 Reverse -316 -335 7.66927 0.229
NP_441040.1_5 Forward -242 -223 6.39097 0.229
NP_440708.1_6 Forward -334 -315 1.27776 0.188
NP_440708.1_6 Reverse -323 -342 -8.45701 0.258
NP_441800.1_3 Reverse -223 -241 7.00065 0.286
NP_441800.1_3 Reverse -292 -310 4.73903 0.286
NP_441800.1_3 Forward -242 -224 4.14905 0.289
NP_441185.1_6 Reverse -129 -148 1.27776 0.222
NP_442346.1_2 Forward -347 -328 6.98095 0.256
NP_442346.1_5 Reverse -227 -237 16.2046 0.00277
NP_442346.1_5 Forward -238 -228 14.533 0.0127
NP_442346.1_5 Reverse -326 -336 13.8447 0.0194
NP_442346.1_5 Forward -337 -327 12.1731 0.0475
NP_442346.1_5 Forward -232 -222 10.8948 0.0813
NP_442346.1_5 Reverse -221 -231 6.27322 0.208
NP_440352.1_5 Reverse -80 -99 13.7264 0.18
NP_440545.1_3 Forward -241 -224 2.79211 0.0941
NP_440545.1_3 Forward -340 -323 -6.64766 0.285
NP_440545.1_5 Reverse -286 -303 9.57695 0.21
NP_440459.1_2 Reverse -213 -230 16.3618 0.0966
NP_440459.1_2 Forward -233 -216 14.3952 0.119
NP_440459.1_2 Reverse -318 -335 10.7569 0.192
NP_440010.1_4 Forward -241 -222 3.14526 0.22
NP_442311.1_5 Reverse -131 -150 0.196116 0.277
NP_442603.1_7 Reverse -228 -242 10.0287 0.134
NP_442603.1_7 Forward -237 -223 8.25877 0.178
NP_441888.1_7 Reverse -158 -172 2.06454 0.229
NP_441502.1_3 Reverse -226 -245 5.01433 0.299
NP_441833.1_4 Forward -236 -229 15.9687 0.0124
NP_441833.1_4 Reverse -229 -236 15.9687 0.0124
NP_442162.1_9 Forward -236 -229 16.2637 0.0124
NP_442162.1_9 Reverse -229 -236 16.2637 0.0124
NP_440671.1_1 Reverse -59 -78 16.18 0.0861
NP_440671.1_4 Reverse -222 -236 22.1241 0.00197
NP_440671.1_4 Reverse -321 -335 5.89945 0.27
NP_440224.1_1 Forward -248 -229 -1.57384 0.178
NP_442045.1_5 Reverse -219 -238 5.70265 0.205
NP_442073.1_6 Reverse -219 -238 -3.3438 0.291
NP_442140.1_3 Reverse -229 -239 11.9764 0.0673
NP_442140.1_3 Forward -230 -220 7.45319 0.14
NP_442140.1_3 Forward -236 -226 4.40493 0.243
NP_442021.1_3 Reverse -222 -241 -4.72043 0.251
NP_440875.1_9 Reverse -329 -339 9.05339 0.233
NP_441813.1_5 Reverse -226 -236 15.9097 0.01
NP_441813.1_5 Forward -239 -229 7.84651 0.0573
NP_441813.1_5 Reverse -161 -171 -0.118297 0.234
NP_440590.1_4 Forward -236 -223 4.14919 0.0632
NP_440590.1_4 Reverse -229 -242 1.10092 0.133
NP_440590.1_4 Forward -230 -217 -1.94734 0.233
NP_440590.1_4 Forward -205 -192 -4.01229 0.257
NP_440567.1_1 Reverse -229 -243 13.2743 0.0213
NP_440567.1_1 Forward -236 -222 13.0776 0.0213
NP_442497.1_10 Forward -236 -227 10.4228 0.0087
NP_442497.1_10 Reverse -229 -238 8.55452 0.0294
NP_440821.1_4 Reverse -226 -236 18.2696 0.00448
NP_440821.1_4 Forward -239 -229 0.668351 0.159
NP_441239.1_9 Forward -338 -326 11.5437 0.0589
NP_441239.1_9 Reverse -325 -337 8.10212 0.142
NP_441239.1_9 Forward -233 -221 4.16888 0.26
NP_441239.1_9 Reverse -330 -342 3.77555 0.276
NP_441892.1_1 Reverse -318 -335 18.1317 0.0226
NP_441892.1_1 Forward -240 -223 -5.07437 0.273
NP_441892.1_1 Forward -345 -328 -5.36936 0.279
NP_441892.1_1 Reverse -219 -236 -5.95935 0.294
NP_440604.1_6 Reverse -228 -247 -4.81876 0.26
NP_442193.1_8 Forward -240 -221 10.7167 0.283
NP_442270.1_9 Reverse -217 -236 3.14605 0.14
NP_442270.1_9 Forward -242 -223 1.47442 0.14
NP_441508.1_1 Reverse -62 -81 16.3242 0.101
NP_442643.1_1 Reverse -222 -241 -12.4886 0.263
NP_442643.1_5 Reverse -231 -250 -1.7705 0.272
NP_441874.1_1 Reverse -218 -232 16.0275 0.165
NP_440354.1_5 Forward -240 -221 3.44104 0.239
NP_442809.1_6 Reverse -222 -241 1.76941 0.27
NP_440546.1_4 Reverse -327 -337 12.9547 0.0572
NP_440546.1_4 Forward -336 -326 12.0821 0.0679
NP_440546.1_4 Reverse -228 -238 11.6943 0.0748
NP_440546.1_4 Forward -237 -227 10.8217 0.104
NP_440546.1_4 Reverse -222 -232 8.97947 0.16
NP_440462.1_6 Reverse -226 -236 7.74818 0.0699
NP_441184.1_3 Forward -344 -325 1.0811 0.296
NP_440868.1_4 Reverse -224 -236 6.1355 0.0878
NP_440868.1_4 Reverse -159 -171 1.61227 0.177
NP_441879.1_3 Forward -236 -217 3.14605 0.261
NP_442402.1_9 Forward -165 -146 11.1109 0.242
NP_440653.1_10 Forward -230 -211 10.3242 0.154
NP_440653.1_10 Reverse -229 -248 2.55606 0.288
NP_439942.1_2 Forward -185 -166 19.6857 0.144
NP_442460.1_7 Reverse -216 -235 8.35759 0.145
NP_440696.1_3 Forward -68 -50 -2.24246 0.274
NP_440696.1_3 Forward -340 -322 -2.73412 0.279
NP_440696.1_9 Reverse -213 -232 12.7816 0.296
NP_442923.1_4 Forward -151 -132 9.63589 0.0739
NP_442039.1_4 Forward -236 -229 15.1821 0.0124
NP_442039.1_4 Reverse -229 -236 15.1821 0.0124
NP_441811.1_4 Forward -147 -128 4.62101 0.237
NP_441811.1_8 Forward -386 -372 8.35772 0.238
NP_441811.1_8 Reverse -222 -236 7.47274 0.243
NP_440825.1_7 Reverse -229 -239 15.3494 0.152
NP_440825.1_7 Reverse -251 -261 11.0554 0.278
NP_442837.1_3 Forward -236 -229 15.7721 0.0124
NP_442837.1_3 Reverse -229 -236 15.7721 0.0124
NP_440160.1_2 Forward -342 -323 -3.83545 0.26
NP_440160.1_2 Reverse -290 -309 -9.24366 0.293
NP_440160.1_5 Reverse -315 -325 15.1225 0.267
NP_442053.1_1 Reverse -228 -237 9.24284 0.068
NP_442053.1_1 Forward -237 -228 8.94785 0.07
NP_440505.1_3 Reverse -226 -236 16.303 0.00696
NP_440505.1_3 Reverse -53 -63 9.12481 0.125
NP_441203.1_1 Reverse -3 -22 -17.7985 0.297
NP_441203.1_1 Forward -236 -217 -20.0601 0.297
NP_441408.2_7 Forward -239 -220 -1.96717 0.262
NP_440914.1_1 Forward -237 -227 16.3248 0.00196
NP_440914.1_1 Reverse -321 -331 10.079 0.158
NP_440914.1_1 Forward -142 -132 9.39583 0.186
NP_440914.1_1 Reverse -228 -238 8.51751 0.186
NP_440914.1_1 Forward -292 -282 8.32233 0.197
NP_441699.1_7 Forward -77 -58 5.50519 0.255
NP_441011.1_8 Reverse -229 -238 9.53783 0.123
NP_441011.1_8 Forward -236 -227 8.25953 0.144
NP_442101.1_10 Forward -245 -226 -9.83364 0.252
NP_442533.1_6 Reverse -228 -237 15.1427 0.00675
NP_442533.1_6 Reverse -327 -336 14.4544 0.013
NP_442533.1_6 Forward -237 -228 7.47288 0.0898
NP_442533.1_6 Reverse -222 -231 7.17789 0.0948
NP_442533.1_6 Forward -336 -327 6.78456 0.103
NP_442533.1_6 Forward -231 -222 6.68623 0.105
NP_442533.1_6 Reverse -117 -126 3.44131 0.212
NP_442533.1_6 Forward -125 -116 2.75299 0.241
NP_442533.1_6 Reverse -118 -127 2.65466 0.246
NP_442533.1_6 Forward -299 -290 1.57302 0.294
NP_442533.1_6 Reverse -292 -301 1.47469 0.298
NP_442541.1_4 Reverse -313 -331 16.0463 0.174
NP_442322.1_4 Forward -344 -327 -1.63347 0.226
NP_441482.1_7 Reverse -222 -236 10.1277 0.0135
NP_441482.1_7 Reverse -321 -335 -1.77037 0.0823
NP_441482.1_7 Reverse -49 -63 -2.26202 0.0962
NP_441482.1_7 Forward -336 -322 -9.63684 0.208
NP_439944.1_9 Forward -236 -226 19.0562 0.00329
NP_439944.1_9 Reverse -229 -239 8.82982 0.101
NP_439944.1_9 Forward -335 -325 5.5849 0.239
NP_441028.1_6 Forward -97 -87 6.0761 0.232
NP_440116.1_8 Forward -236 -217 -9.44032 0.278
NP_440116.1_8 Reverse -229 -248 -9.44032 0.278
NP_440115.1_6 Reverse -225 -235 9.41981 0.115
NP_440115.1_6 Forward -240 -230 8.04317 0.144
NP_440007.1_9 Reverse -224 -238 10.0294 0.163
NP_440007.1_9 Reverse -323 -337 4.32615 0.267
NP_441347.1_5 Forward -226 -212 18.0918 0.118
NP_442492.1_2 Reverse -228 -247 4.71934 0.212
NP_441602.1_3 Reverse -128 -147 -3.73712 0.252
NP_441972.1_5 Forward -230 -211 -5.11376 0.215
NP_441972.1_5 Reverse -310 -329 -6.58872 0.233
NP_441972.1_5 Reverse -298 -317 -6.98204 0.24
NP_441972.1_5 Reverse -322 -341 -9.14533 0.281
NP_441106.1_1 Reverse -227 -236 9.63616 0.0311
NP_441106.1_1 Forward -238 -229 8.75118 0.0469
NP_441106.1_1 Reverse -326 -335 5.50626 0.145
NP_441106.1_1 Forward -337 -328 4.62128 0.213
NP_440429.1_2 Reverse -291 -310 7.57094 0.284
NP_439903.1_6 Forward -339 -320 14.9449 0.0686
NP_439903.1_6 Forward -240 -221 5.40686 0.183
NP_439903.1_6 Forward -246 -227 1.76863 0.24
NP_442588.1_6 Reverse -380 -399 2.26107 0.23
NP_441286.1_1 Forward -238 -226 12.232 0.00999
NP_441286.1_1 Reverse -227 -239 3.67722 0.0467
NP_441286.1_1 Reverse -221 -233 0.825626 0.107
NP_441286.1_1 Reverse -282 -294 -7.04085 0.3
NP_440670.1_8 Reverse -228 -237 8.94785 0.0606
NP_440670.1_8 Forward -237 -228 8.84951 0.0606
NP_442614.1_2 Reverse -228 -242 7.86607 0.262
NP_442072.1_9 Reverse -227 -245 -21.8103 0.212
NP_439899.1_1 Reverse -58 -76 10.0275 0.165
NP_442295.1_7 Forward -367 -349 13.6864 0.289
NP_440907.2_8 Reverse -229 -239 4.7978 0.243
NP_442264.1_5 Forward -237 -223 12.4876 0.253
NP_441021.1_1 Forward -236 -217 -4.72043 0.172
NP_441021.1_1 Reverse -229 -248 -9.93197 0.224
NP_440326.1_5 Forward -66 -53 12.5073 0.296
NP_441463.1_2 Reverse -66 -84 9.88553 0.138
NP_441463.1_2 Forward -51 -33 -0.878771 0.293
NP_441463.1_3 Forward -241 -222 -10.4236 0.294
NP_441463.1_6 Forward -239 -225 5.73949 0.287
NP_442842.1_4 Reverse -164 -183 1.86774 0.277
NP_441626.1_2 Forward -236 -229 15.7721 0.0124
NP_441626.1_2 Reverse -229 -236 15.7721 0.0124
NP_441901.1_1 Reverse -213 -232 3.24438 0.218
NP_440107.1_5 Reverse -126 -145 -1.86883 0.178
NP_442794.1_1 Reverse -224 -236 19.7052 0.00523
NP_442794.1_1 Forward -241 -229 14.002 0.0721
NP_442794.1_1 Reverse -218 -230 7.21714 0.144
NP_441401.1_5 Reverse -140 -159 11.0289 0.297
NP_442615.1_1 Reverse -219 -237 5.42735 0.0386
NP_442615.1_1 Forward -246 -228 4.73903 0.0437
NP_441962.1_4 Forward -236 -217 -4.42544 0.158
NP_441962.1_4 Forward -156 -137 -10.522 0.229
NP_441962.1_4 Reverse -223 -242 -12.8819 0.265
NP_440387.1_1 Forward -237 -221 3.59845 0.0551
NP_440387.1_1 Reverse -228 -244 2.8118 0.0715
NP_440855.1_4 Forward -173 -154 15.6341 0.203
NP_440855.1_5 Forward -332 -313 3.63691 0.287
NP_441488.1_8 Reverse -217 -231 9.53707 0.15
NP_441993.1_1 Reverse -321 -340 9.93819 0.135
NP_441993.1_1 Forward -336 -317 9.74328 0.135
NP_441993.1_1 Reverse -222 -241 7.59921 0.16
NP_440114.1_10 Forward -336 -322 7.86607 0.223
NP_442323.1_7 Forward -242 -223 6.68515 0.19
NP_441510.2_6 Forward -137 -118 14.0599 0.233
NP_441510.2_7 Forward -292 -278 11.1104 0.28
NP_440293.1_3 Forward -165 -146 -4.81876 0.265
NP_440293.1_3 Reverse -325 -344 -5.01543 0.269
NP_440293.1_3 Reverse -331 -350 -6.78538 0.293
NP_440766.1_4 Reverse -224 -238 9.2427 0.0871
NP_439988.1_3 Reverse -328 -342 9.43936 0.249
NP_441237.1_9 Reverse -284 -294 10.5998 0.224
NP_441979.1_10 Forward -227 -208 13.0775 0.206
NP_442743.1_5 Forward -236 -217 9.24257 0.148
NP_442743.1_5 Reverse -223 -242 3.14605 0.277
NP_441311.1_2 Forward -243 -229 11.7003 0.243
NP_440643.1_6 Reverse -38 -57 7.66927 0.193
NP_439910.1_2 Forward -245 -228 -21.889 0.195
NP_440457.1_1 Reverse -224 -236 8.29878 0.101
NP_440142.1_7 Reverse -229 -248 7.27595 0.256
NP_441984.1_3 Reverse -112 -130 5.13236 0.295
NP_441332.1_6 Forward -293 -283 10.7754 0.287
NP_440554.1_4 Reverse -328 -338 7.35486 0.103
NP_440554.1_4 Forward -236 -226 7.05986 0.106
NP_440554.1_4 Forward -335 -325 3.42162 0.23
NP_440554.1_4 Reverse -229 -239 1.84832 0.287
NP_441885.1_5 Reverse -228 -238 19.6462 0.00179
NP_441885.1_5 Forward -237 -227 11.1898 0.00775
NP_442703.1_4 Forward -237 -218 11.0117 0.167
NP_442341.1_7 Forward -238 -224 6.3911 0.127
NP_442341.1_7 Reverse -227 -241 6.29277 0.13
NP_441173.1_9 Forward -96 -88 10.8354 0.243
NP_442395.2_3 Forward -207 -189 16.2438 0.274
NP_442395.2_4 Reverse -308 -327 3.24359 0.207
NP_440423.1_4 Reverse -316 -335 11.7008 0.296
NP_443000.1_7 Reverse -226 -236 17.0896 0.00865
NP_443000.1_7 Forward -239 -229 9.61647 0.0437
NP_440507.2_3 Reverse -219 -238 17.1082 0.0656
NP_440507.2_3 Forward -240 -221 8.35677 0.253
NP_440552.1_8 Forward -86 -69 22.6837 0.0072
NP_440275.1_3 Reverse -226 -236 8.1415 0.0602
NP_440091.1_1 Reverse -224 -236 -0.452677 0.273
NP_441122.1_1 Reverse -129 -144 3.81481 0.28
NP_440866.1_5 Reverse -45 -63 15.2604 0.268
NP_439962.1_4 Forward -150 -131 -1.37718 0.214
NP_440175.1_7 Forward -167 -149 10.9246 0.249
NP_442495.1_4 Forward -302 -292 13.4514 0.187
NP_440149.1_8 Reverse -321 -340 5.30933 0.0746
NP_440149.1_8 Forward -237 -218 5.30933 0.0746
NP_440149.1_8 Reverse -222 -241 0.786102 0.133
NP_440149.1_8 Forward -336 -317 0.196116 0.141
NP_440149.1_8 Reverse -163 -182 -5.60541 0.23
NP_441105.1_3 Reverse -217 -236 14.7491 0.0212
NP_441105.1_3 Forward -347 -328 -2.26216 0.159
NP_441105.1_3 Forward -242 -223 -6.49039 0.236
NP_441105.1_3 Forward -69 -50 -8.752 0.278
NP_441105.1_3 Reverse -211 -230 -9.63698 0.292
NP_441730.1_2 Reverse -66 -84 9.55725 0.283
NP_440216.1_1 Reverse -228 -242 -10.3252 0.145
NP_440216.1_9 Forward -229 -220 7.37455 0.286
NP_440216.1_9 Reverse -51 -60 7.37455 0.286
NP_440216.1_9 Forward -140 -131 5.70292 0.29
NP_440172.1_1 Reverse -228 -238 17.2863 0.00544
NP_440172.1_1 Reverse -327 -337 7.45319 0.0789
NP_440172.1_1 Forward -237 -227 5.28991 0.146
NP_440172.1_1 Reverse -222 -232 3.61828 0.222
NP_440172.1_3 Reverse -349 -368 22.7139 0.0432
NP_440046.1_5 Reverse -61 -80 8.26467 0.271
NP_442015.1_10 Forward -241 -228 12.9006 0.0365
NP_442015.1_10 Reverse -224 -237 9.06573 0.0553
NP_442015.1_10 Forward -235 -222 -0.177378 0.255
NP_442015.1_10 Reverse -317 -330 -0.37404 0.264
NP_441226.1_7 Forward -236 -229 14.4934 0.0123
NP_441226.1_7 Reverse -229 -236 14.4934 0.0123
NP_441111.1_7 Forward -236 -228 18.7023 0.00294
NP_441111.1_7 Reverse -229 -237 8.86921 0.0589
NP_442379.1_10 Forward -244 -227 0.727158 0.223
NP_442379.1_10 Forward -343 -326 -2.02611 0.224
NP_441766.1_2 Reverse -228 -237 17.896 0.00297
NP_441766.1_2 Forward -237 -228 9.4395 0.0285
NP_442417.1_5 Reverse -228 -242 6.78443 0.207
NP_442252.1_4 Reverse -117 -136 15.4374 0.235
NP_440416.1_9 Reverse -221 -240 1.0811 0.0481
NP_440416.1_9 Forward -244 -225 -7.17871 0.0972
NP_440416.1_9 Forward -337 -318 -11.8003 0.154
NP_440416.1_9 Forward -179 -160 -14.4552 0.176
NP_440416.1_9 Forward -232 -213 -19.1751 0.27
NP_442154.1_4 Forward -310 -291 14.3558 0.105
NP_440261.1_5 Forward -236 -223 -10.5021 0.201
NP_440261.1_5 Reverse -229 -242 -10.7971 0.21
NP_440988.1_10 Forward -233 -219 11.9662 0.187
NP_440988.1_10 Reverse -226 -240 7.22233 0.219
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCAAGCTACCCTTGTGGGGGTAGATTCCTACGACCAAGCCTATCAAATTCTAGAACAGGGCCAAGCCATGGCCTTTGCTGGGGACAATTCCGTGCTGAGCGGCTGGGCCCAATCCCAATCCGATTACTATCATTTACCTTTGCAATTAACAGTTAACCCCTTAGCGATCGCCATGGCCAAAGGATTGCAACATCAGGCTCTCCAACGGGAAGTTAACCAAACCCTACTGCAATTGCGGGCTTCTGGTTGGCTCCGGCAACAATGGCAAGCCTGGGGCCTGCCCTTCTAAGAAATGCAGAAAATTTCACCCCAGTCAACAATACTTAACAAAGGTTTACAATTGCCTTGGCTTTTGTTAAGGTGTAGTTGTCAAAGTTGGTTTACCTAGAGAAATCAAAC

CDS

ATGCAATCCTCACAGACCTGGGCGATGTCCTCCGCAGACACAGCTACCAAAGAAACCAACTGGCTCTCTCTGCTGTTCTTTTTGATGGGGGCCATGAATGCCTACATGTTTTTCCGTCGCCAACGGGATTGGTTGAATCAGCAGGGACTGCGTCTGATTAAAGTTGCCCTGGCATCCTTCGGCTGTGCCGCTCTCCTGGAAGCATTAATCTTTTAG

Protein

MQSSQTWAMSSADTATKETNWLSLLFFLMGAMNAYMFFRRQRDWLNQQGLRLIKVALASFGCAALLEALIF