Your browser is old and dusty. Try Google Chrome!

Details for ssl2153

ORF ssl2153
Accession NP_441648.1
Symbol
Category Sugars
Definition probable ribose phosphate isomerase B
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Forward -252 -233 5.29938 0.296
NP_440295.1_7 Reverse -356 -368 21.6718 0.23
NP_441453.1_8 Reverse -22 -39 24.3266 0.0251
NP_441623.1_1 Reverse -30 -48 10.0489 0.0963
NP_440061.1_9 Reverse -21 -35 9.53707 0.143
NP_441859.1_3 Forward -126 -107 2.16195 0.266
NP_441802.1_1 Forward -50 -31 4.81767 0.286
NP_441581.1_8 Forward -132 -113 16.4207 0.241
NP_441620.1_3 Forward -140 -121 11.5042 0.287
NP_441082.1_4 Reverse -193 -212 22.7139 0.032
NP_440769.1_8 Reverse -205 -224 18.7807 0.046
NP_441149.1_7 Reverse -106 -125 4.12936 0.267
NP_441558.1_5 Reverse -21 -40 4.22769 0.286
NP_441163.1_1 Forward -53 -36 8.49457 0.232
NP_441265.1_1 Forward -48 -29 -8.65367 0.16
NP_441014.1_8 Reverse -44 -63 -0.688862 0.218
NP_440781.1_1 Reverse -16 -30 14.0609 0.266
NP_441013.1_2 Reverse -44 -62 2.67408 0.237
NP_440360.1_10 Forward -396 -382 6.3911 0.227
NP_442782.1_2 Forward -245 -231 5.89945 0.234
NP_442496.1_5 Forward -53 -35 4.05072 0.299
NP_440800.1_7 Forward -260 -246 12.7826 0.241
NP_439905.1_1 Reverse -50 -63 9.75405 0.216
NP_443001.1_7 Reverse -347 -366 6.78429 0.252
NP_442690.1_1 Reverse -233 -252 -14.9469 0.276
NP_442690.1_1 Reverse -312 -331 -15.9302 0.282
NP_442911.1_2 Forward -109 -90 -4.13045 0.126
NP_440147.1_4 Forward -34 -21 -0.177378 0.276
NP_441041.1_7 Reverse -120 -132 5.27969 0.265
NP_440260.1_8 Reverse -34 -52 -6.76569 0.295
NP_441678.1_2 Reverse -34 -53 9.0459 0.238
NP_442281.1_1 Forward -43 -29 5.21053 0.166
NP_441079.1_7 Reverse -245 -264 0.686995 0.186
NP_440498.1_1 Reverse -92 -110 -3.91409 0.281
NP_440375.1_9 Forward -332 -313 14.5449 0.271
NP_441644.1_6 Reverse -23 -33 3.71617 0.267
NP_440587.1_6 Reverse -232 -251 14.6508 0.115
NP_442215.1_2 Reverse -41 -57 -4.56302 0.235
NP_442215.1_2 Reverse -20 -36 -7.21796 0.289
NP_442029.1_6 Forward -37 -18 2.94938 0.286
NP_441525.1_1 Reverse -19 -32 16.1456 0.203
NP_441264.1_3 Forward -48 -29 -3.14714 0.293
NP_443009.1_5 Forward -133 -122 13.7261 0.0285
NP_440379.1_5 Reverse -19 -38 0.196116 0.172
NP_441731.1_7 Forward -66 -47 12.7825 0.147
NP_441826.1_2 Forward -38 -24 1.76955 0.142
NP_442719.1_2 Reverse -237 -255 -8.04469 0.241
NP_442719.1_2 Reverse -236 -254 -8.92966 0.258
NP_441612.1_2 Forward -48 -38 8.83972 0.21
NP_443058.1_7 Forward -152 -133 2.75272 0.28
NP_442808.1_1 Forward -369 -359 1.45457 0.285
NP_442820.1_5 Reverse -58 -77 7.66927 0.228
NP_441114.1_3 Reverse -24 -33 7.66954 0.231
NP_441114.1_3 Forward -366 -357 7.57121 0.231
NP_440558.1_2 Forward -35 -16 -6.58872 0.277
NP_441878.1_6 Forward -39 -29 -0.0199663 0.163
NP_440101.1_3 Reverse -18 -37 2.16274 0.259
NP_441564.1_10 Forward -24 -5 2.45773 0.287
NP_442645.1_2 Forward -376 -357 -15.1435 0.19
NP_442645.1_2 Reverse -122 -141 -22.5183 0.291
NP_440256.1_1 Forward -35 -16 14.8474 0.00763
NP_442860.1_7 Forward -254 -236 7.35377 0.293
NP_442866.1_1 Reverse -17 -36 -6.1954 0.251
NP_442386.1_9 Reverse -48 -57 8.84908 0.182
NP_441912.1_10 Forward -228 -209 13.3725 0.191
NP_440027.1_8 Forward -35 -16 8.16011 0.249
NP_439937.1_9 Forward -283 -266 -13.2365 0.283
NP_441595.1_2 Forward -198 -185 10.0884 0.277
NP_440408.1_7 Forward -110 -91 6.98095 0.295
NP_441138.1_5 Forward -74 -61 8.84703 0.238
NP_441181.1_6 Forward -124 -106 9.0656 0.219
NP_440819.1_5 Forward -48 -40 7.68924 0.266
NP_441803.1_2 Reverse -96 -115 5.01433 0.171
NP_442384.1_10 Reverse -23 -36 6.70579 0.0963
NP_440350.1_5 Reverse -248 -267 -7.17871 0.299
NP_442280.1_10 Reverse -19 -37 4.67522 0.296
NP_441103.1_9 Reverse -41 -51 15.1264 0.192
NP_440888.1_2 Forward -125 -111 5.01387 0.298
NP_441621.1_3 Forward -55 -37 15.6538 0.182
NP_442204.1_6 Reverse -20 -39 10.7175 0.19
NP_442872.1_1 Forward -218 -199 -8.16202 0.241
NP_442823.1_8 Forward -21 -2 16.2241 0.177
NP_442612.1_1 Forward -375 -360 17.7778 0.214
NP_440673.1_2 Forward -120 -101 13.2186 0.123
NP_440673.1_3 Forward -123 -116 9.08556 0.202
NP_440436.1_4 Reverse -124 -133 6.48915 0.157
NP_441004.1_1 Forward -64 -45 -17.1101 0.289
NP_442366.1_3 Reverse -122 -140 5.32902 0.0878
NP_441683.1_7 Reverse -201 -220 -10.3253 0.284
NP_441046.1_2 Forward -256 -237 5.99764 0.221
NP_442689.1_8 Reverse -237 -254 6.23369 0.155
NP_442843.1_7 Forward -258 -240 13.8527 0.3
NP_440588.1_5 Forward -262 -248 15.4815 0.215
NP_440943.1_4 Reverse -141 -153 16.7552 0.107
NP_442006.1_2 Reverse -49 -66 -17.7591 0.282
NP_442348.1_2 Reverse -35 -44 12.2911 0.218
NP_441131.1_5 Forward -53 -34 0.982764 0.269
NP_441057.1_3 Reverse -228 -247 -13.6686 0.297
NP_440913.1_1 Reverse -21 -39 4.83737 0.254
NP_440565.1_3 Reverse -40 -59 15.0964 0.246
NP_440459.1_2 Reverse -21 -38 11.7402 0.166
NP_440459.1_2 Forward -19 -2 8.49531 0.259
NP_441895.1_10 Forward -198 -179 -18.7818 0.282
NP_440875.1_9 Forward -56 -46 8.08002 0.243
NP_439901.1_3 Forward -46 -27 12.0167 0.237
NP_441239.1_9 Forward -40 -28 8.00379 0.145
NP_441239.1_9 Reverse -21 -33 7.80712 0.148
NP_441239.1_9 Forward -60 -48 3.67722 0.279
NP_440462.1_4 Reverse -200 -214 9.93102 0.242
NP_442465.1_9 Reverse -61 -75 8.35772 0.298
NP_442479.1_9 Reverse -234 -253 -13.5702 0.288
NP_441848.1_7 Reverse -325 -344 -4.1312 0.287
NP_441084.1_6 Forward -182 -168 9.53803 0.278
NP_442679.1_1 Forward -270 -251 2.75272 0.161
NP_440160.1_9 Forward -32 -13 7.96426 0.27
NP_440505.1_3 Forward -34 -24 4.40493 0.292
NP_440351.1_8 Forward -42 -24 6.70565 0.26
NP_441252.1_6 Reverse -146 -153 14.3954 0.168
NP_441252.1_6 Reverse -16 -23 14.3954 0.168
NP_441408.2_7 Forward -253 -234 -1.96717 0.262
NP_440914.1_1 Reverse -23 -33 11.2501 0.103
NP_442533.1_6 Reverse -29 -38 2.06468 0.275
NP_441028.1_6 Forward -218 -208 7.74772 0.218
NP_441028.1_6 Reverse -41 -51 5.38779 0.255
NP_441028.1_6 Reverse -40 -50 5.38779 0.255
NP_440116.1_5 Forward -154 -137 3.38209 0.233
NP_441347.1_5 Forward -33 -19 10.2254 0.269
NP_441059.1_2 Reverse -137 -156 -2.45882 0.242
NP_441961.1_3 Forward -130 -111 12.1925 0.244
NP_441106.1_3 Forward -330 -311 10.0292 0.288
NP_441815.1_6 Reverse -38 -57 11.2084 0.118
NP_442674.1_2 Forward -196 -177 12.2908 0.208
NP_442717.1_2 Forward -190 -171 -0.000545616 0.211
NP_441427.1_6 Forward -35 -17 12.1139 0.211
NP_441021.1_8 Forward -137 -119 4.05072 0.225
NP_441962.1_4 Reverse -102 -121 -0.4922 0.117
NP_441065.1_2 Reverse -174 -193 10.7468 0.243
NP_441836.1_2 Reverse -17 -36 8.25926 0.101
NP_440114.1_10 Forward -32 -18 9.04604 0.186
NP_440287.1_6 Reverse -378 -397 1.37609 0.276
NP_441237.1_9 Forward -367 -357 10.2065 0.241
NP_442930.1_1 Forward -212 -202 10.6976 0.276
NP_441984.1_3 Forward -42 -24 11.2289 0.177
NP_442862.1_3 Forward -76 -59 4.26707 0.29
NP_441173.1_9 Reverse -167 -175 10.2454 0.261
NP_440560.1_5 Reverse -224 -243 9.32929 0.276
NP_440560.1_7 Forward -80 -61 6.68515 0.292
NP_439962.1_4 Reverse -108 -127 -8.85033 0.298
NP_442015.1_10 Reverse -45 -58 -0.964025 0.289
NP_440416.1_9 Forward -39 -20 -12.3902 0.157
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTACAATAGCTCCAATGATATTTGAAGGATACTGCAACGCCCAAGTAGTATGCAGGTGGATAGAAGAAATGTTGTTACCAGAGTTAATACCAGGTCAGATACTAATTATGGATAATGCAAGCTTTCATCCGAAAGAAAGAATCAAGGAATTGTTAGCAAAAGCTGGGTGTGAGGTTATATTTTTACCACCATATTCACCGGACTTGAACAAAATTGAGAAGTTCTGGGCGAAACTAAAACGTTATGTTGCCCAACTGGTTAGTAATGGAGAATCGCTGATTGCTGCATTGGATATAGCGTTGAGAGAGCTGTCCTAACTATCTCATTCTTTGCTTATTTGGCGCCTTGGCAGGGGAAAAAGACCCCTGGCCATTGGTTGCCCAACAATTAGCGGAAGCG

CDS

GTGGCCGGTCAAACCGTAGAGGAAGGCATACTATTTTGTTGGACGGGAACGGGTGTCTCCATTGCGGCCAATAAAGTACCGGGTATCAGGGCCGCCCTAGTGAGGGATGCGGAAACTGCCAAGGGAACCCGTTGGTGGAACGATGTCAATGTGCTGGTAATGAGTTTACGGGCCACTTCCCCGGCGATCGCCAAGGAAATTTTGGCCGCCTGGTTTACGGAACAAGTCAAACCGGAAGAATTGGATTGTATTCAACTGGTGACGGCGATCGAGCAAAAATATTCTAGCCAAACCTAA

Protein

MAGQTVEEGILFCWTGTGVSIAANKVPGIRAALVRDAETAKGTRWWNDVNVLVMSLRATSPAIAKEILAAWFTEQVKPEELDCIQLVTAIEQKYSSQT