Your browser is old and dusty. Try Google Chrome!

Details for ssl2084

ORF ssl2084
Accession NP_440632.1
Symbol acpP
Category acyl carrier protein
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -275 -261 0.392915 0.211
NP_440557.1_1 Forward -275 -256 10.8159 0.111
NP_440795.1_7 Reverse -81 -88 11.1505 0.108
NP_441418.1_1 Forward -400 -381 11.3154 0.203
NP_441453.1_4 Reverse -48 -56 14.7691 0.0119
NP_441453.1_4 Forward -57 -49 6.80426 0.121
NP_441453.1_4 Forward -378 -370 3.85433 0.284
NP_441453.1_7 Forward -225 -218 12.1338 0.295
NP_441818.1_1 Reverse -49 -60 14.4145 0.0502
NP_440226.1_1 Reverse -48 -67 8.55425 0.0849
NP_441630.1_3 Reverse -318 -337 1.17943 0.252
NP_442744.1_8 Reverse -78 -97 -3.83545 0.297
NP_442655.1_1 Reverse -62 -81 -1.47551 0.272
NP_442173.1_1 Forward -56 -48 12.0158 0.0316
NP_442173.1_1 Reverse -49 -57 12.0158 0.0316
NP_442752.1_4 Forward -57 -50 13.8055 0.0199
NP_442752.1_4 Reverse -365 -372 5.34899 0.221
NP_442975.1_10 Forward -336 -322 2.45727 0.274
NP_440784.1_7 Forward -56 -49 6.23397 0.241
NP_440784.1_7 Reverse -49 -56 6.13563 0.241
NP_440061.1_9 Reverse -46 -60 13.2736 0.0819
NP_440061.1_9 Forward -266 -252 12.192 0.0999
NP_440061.1_9 Reverse -82 -96 7.27547 0.213
NP_440061.1_9 Forward -380 -366 5.70218 0.275
NP_441054.1_4 Forward -67 -49 8.27895 0.0835
NP_440878.1_9 Reverse -171 -190 -3.44213 0.293
NP_442062.1_8 Forward -378 -368 11.5831 0.0447
NP_442062.1_8 Reverse -365 -375 10.8948 0.0493
NP_442062.1_8 Forward -57 -47 8.23984 0.0793
NP_442062.1_8 Reverse -48 -58 7.55152 0.0946
NP_440304.1_4 Reverse -324 -334 3.02829 0.299
NP_441781.1_7 Forward -276 -257 7.7676 0.161
NP_441035.1_3 Forward -238 -219 2.55606 0.227
NP_441200.1_4 Reverse -256 -275 16.0274 0.15
NP_441594.1_6 Forward -341 -322 -0.197208 0.298
NP_442742.1_9 Forward -384 -365 -12.6852 0.269
NP_441491.1_5 Forward -350 -331 18.1907 0.195
NP_441082.1_10 Forward -314 -301 8.08242 0.289
NP_441925.1_4 Forward -97 -78 -5.21283 0.177
NP_441083.1_3 Forward -265 -255 16.8925 0.091
NP_441083.1_5 Reverse -48 -58 19.0562 0.00147
NP_441083.1_5 Forward -57 -47 16.7946 0.00546
NP_441083.1_5 Forward -302 -292 5.48657 0.116
NP_441434.1_7 Forward -55 -41 1.67122 0.299
NP_441738.1_2 Reverse -50 -57 15.28 0.0102
NP_441738.1_2 Forward -372 -365 8.00357 0.235
NP_441558.1_5 Reverse -367 -386 5.211 0.257
NP_440209.1_1 Forward -57 -49 8.57422 0.0425
NP_440209.1_1 Reverse -48 -56 8.47588 0.0457
NP_440209.1_2 Reverse -64 -80 14.5132 0.168
NP_442889.1_1 Reverse -287 -306 -13.1769 0.248
NP_442889.1_8 Reverse -45 -59 9.04542 0.105
NP_440178.1_7 Reverse -47 -66 -20.8467 0.201
NP_442570.1_3 Forward -272 -253 -2.36049 0.212
NP_441716.1_1 Reverse -48 -62 4.71948 0.252
NP_441163.1_1 Forward -95 -78 4.56135 0.287
NP_440906.1_5 Forward -56 -49 6.23397 0.234
NP_440906.1_5 Reverse -49 -56 6.13563 0.241
NP_440747.1_10 Forward -60 -48 7.11881 0.00789
NP_440747.1_10 Reverse -45 -57 -2.4193 0.0434
NP_440747.1_10 Forward -92 -80 -12.0557 0.199
NP_440747.1_10 Reverse -290 -302 -12.5474 0.297
NP_441130.1_10 Reverse -46 -60 12.586 0.0916
NP_441130.1_10 Forward -59 -45 6.19444 0.197
NP_441486.1_1 Forward -60 -46 -3.63866 0.18
NP_441486.1_1 Forward -381 -367 -5.21195 0.226
NP_441486.1_1 Forward -377 -363 -5.60527 0.248
NP_441486.1_1 Forward -135 -121 -5.80194 0.26
NP_441880.2_10 Forward -56 -38 10.1472 0.216
NP_442634.1_4 Forward -119 -105 -4.81863 0.22
NP_442760.1_5 Reverse -368 -380 17.738 0.208
NP_440842.1_2 Forward -104 -86 11.9172 0.277
NP_440842.1_10 Reverse -252 -266 1.86788 0.281
NP_441695.1_6 Reverse -78 -97 16.2241 0.218
NP_442848.1_4 Reverse -172 -186 9.04604 0.282
NP_443018.1_3 Reverse -49 -56 11.7405 0.0655
NP_443018.1_3 Forward -377 -370 11.3472 0.0846
NP_443018.1_3 Forward -56 -49 5.44732 0.193
NP_443018.1_3 Reverse -370 -377 4.16902 0.278
NP_441634.1_8 Forward -59 -45 -4.52363 0.295
NP_441634.1_9 Reverse -68 -87 14.3549 0.169
NP_440376.1_1 Forward -57 -48 15.7327 0.00625
NP_440376.1_1 Reverse -48 -57 9.63616 0.0385
NP_440376.1_1 Forward -89 -80 5.50626 0.131
NP_440376.1_1 Reverse -67 -76 2.94966 0.213
NP_441588.1_4 Reverse -371 -381 14.9263 0.0611
NP_442687.1_7 Reverse -39 -49 11.1898 0.0994
NP_442687.1_7 Reverse -47 -57 8.73149 0.101
NP_442687.1_7 Forward -58 -48 6.66654 0.155
NP_442687.1_7 Reverse -325 -335 6.37155 0.171
NP_441077.1_6 Forward -395 -379 18.3234 0.0733
NP_442485.1_3 Forward -100 -81 -1.86883 0.261
NP_441846.1_10 Reverse -68 -87 -21.6334 0.256
NP_441422.1_7 Forward -346 -329 -2.02611 0.204
NP_441950.1_8 Reverse -322 -336 5.50613 0.281
NP_440360.1_10 Forward -333 -319 4.71948 0.227
NP_442658.1_1 Reverse -46 -56 6.37109 0.231
NP_442658.1_1 Reverse -367 -377 6.27276 0.234
NP_442198.1_7 Reverse -146 -165 8.16011 0.298
NP_440141.1_8 Forward -295 -276 4.71934 0.281
NP_441971.1_4 Forward -185 -166 20.3531 0.133
NP_442782.1_2 Reverse -67 -81 13.2743 0.173
NP_442782.1_2 Reverse -80 -94 1.37622 0.281
NP_442782.1_2 Forward -275 -261 0.491246 0.289
NP_441414.1_9 Reverse -48 -67 -6.09707 0.187
NP_440720.1_1 Reverse -30 -49 3.24438 0.263
NP_441487.1_6 Reverse -258 -277 7.47261 0.206
NP_441487.1_9 Forward -87 -68 17.699 0.0454
NP_441487.1_9 Forward -58 -39 12.9791 0.0526
NP_441958.1_5 Reverse -47 -57 10.6981 0.0112
NP_441958.1_5 Forward -58 -48 10.0098 0.0167
NP_442836.1_5 Reverse -74 -93 5.211 0.192
NP_439905.1_1 Reverse -49 -62 17.6205 0.0361
NP_440984.1_7 Reverse -43 -57 13.8643 0.0968
NP_442911.1_2 Forward -67 -48 -5.9004 0.17
NP_442064.1_4 Reverse -164 -183 11.405 0.183
NP_443055.1_6 Reverse -40 -58 6.99988 0.164
NP_443055.1_6 Forward -57 -39 3.8533 0.192
NP_443055.1_6 Reverse -330 -348 3.36165 0.196
NP_443055.1_6 Reverse -361 -379 0.903388 0.238
NP_443044.1_1 Forward -279 -260 2.55606 0.296
NP_441099.1_5 Forward -67 -48 -9.24366 0.216
NP_441294.1_7 Reverse -44 -58 16.7377 0.013
NP_441752.1_6 Reverse -56 -75 -1.67217 0.294
NP_441000.1_6 Reverse -47 -61 2.94952 0.123
NP_441000.1_6 Reverse -364 -378 -3.24533 0.221
NP_441000.1_6 Reverse -79 -93 -4.03198 0.225
NP_441000.1_6 Forward -58 -44 -4.7203 0.251
NP_442771.1_1 Reverse -78 -96 11.7205 0.0174
NP_442870.1_2 Forward -233 -217 14.9065 0.297
NP_441110.1_10 Reverse -167 -186 14.0608 0.219
NP_440147.1_4 Forward -59 -46 14.8673 0.0213
NP_440147.1_4 Reverse -46 -59 8.37742 0.0518
NP_440147.1_4 Forward -380 -367 7.39411 0.0695
NP_441550.1_8 Reverse -46 -56 17.1874 0.00906
NP_441550.1_8 Forward -59 -49 13.8442 0.0207
NP_441916.1_7 Forward -57 -47 7.15819 0.0745
NP_441916.1_7 Reverse -369 -379 4.99491 0.15
NP_441916.1_7 Forward -89 -79 4.10993 0.19
NP_441916.1_7 Reverse -67 -77 2.63497 0.246
NP_441916.1_7 Forward -374 -364 2.43831 0.254
NP_441916.1_7 Reverse -41 -51 1.25834 0.289
NP_441916.1_10 Reverse -259 -278 4.22769 0.223
NP_440206.1_4 Forward -86 -67 -1.77127 0.293
NP_440465.1_10 Reverse -323 -342 -0.983855 0.29
NP_441041.1_4 Reverse -48 -67 -12.8819 0.276
NP_441041.1_7 Reverse -45 -57 10.5273 0.095
NP_440099.1_1 Forward -117 -98 4.12856 0.256
NP_442396.1_5 Forward -382 -369 10.7374 0.106
NP_442396.1_5 Forward -355 -342 6.80412 0.219
NP_442004.1_6 Forward -374 -360 6.58777 0.171
NP_442004.1_6 Reverse -369 -383 3.53951 0.238
NP_440703.1_9 Reverse -255 -268 7.88518 0.252
NP_441725.1_5 Forward -56 -46 2.04498 0.115
NP_441725.1_5 Forward -88 -78 -0.0199663 0.223
NP_439966.1_7 Reverse -46 -56 7.64939 0.15
NP_439966.1_7 Forward -59 -49 5.58445 0.216
NP_439966.1_7 Forward -376 -366 4.89613 0.254
NP_440202.1_10 Reverse -341 -360 16.7157 0.21
NP_442941.1_3 Reverse -49 -59 9.41981 0.0319
NP_442941.1_3 Forward -56 -46 0.963343 0.16
NP_440289.1_2 Reverse -45 -58 12.114 0.0169
NP_440289.1_2 Forward -60 -47 -3.71729 0.267
NP_440260.1_8 Forward -279 -261 -6.86402 0.295
NP_441514.1_6 Forward -173 -166 14.2971 0.248
NP_442281.1_1 Reverse -43 -57 18.5835 0.00414
NP_442281.1_1 Reverse -250 -264 4.22722 0.203
NP_442256.1_2 Reverse -46 -64 -9.12563 0.249
NP_001035871.2_7 Reverse -340 -350 12.9597 0.237
NP_440437.1_1 Forward -95 -76 -5.21209 0.276
NP_442012.1_1 Forward -384 -365 3.93269 0.179
NP_441087.1_6 Reverse -167 -185 0.903388 0.258
NP_441556.1_10 Forward -62 -48 12.8499 0.192
NP_441556.1_10 Reverse -288 -302 10.9032 0.253
NP_441644.1_6 Reverse -48 -58 17.0891 0.00219
NP_441644.1_6 Forward -57 -47 6.0761 0.167
NP_441644.1_6 Reverse -369 -379 4.40448 0.239
NP_440929.1_8 Reverse -48 -57 16.5193 0.00413
NP_440929.1_8 Forward -57 -48 9.53783 0.0296
NP_442933.1_10 Reverse -369 -378 11.7994 0.0339
NP_442933.1_10 Reverse -48 -57 8.06287 0.0885
NP_442933.1_10 Forward -57 -48 7.96454 0.0937
NP_442933.1_10 Forward -374 -365 5.3096 0.203
NP_441751.2_8 Reverse -49 -63 -6.88358 0.289
NP_442554.1_8 Forward -56 -46 12.7631 0.0225
NP_442554.1_8 Reverse -49 -59 6.37155 0.12
NP_442554.1_8 Reverse -370 -380 4.40493 0.188
NP_442554.1_8 Forward -263 -253 3.42162 0.226
NP_442167.1_6 Forward -329 -313 10.6776 0.271
NP_442313.1_6 Reverse -167 -186 9.53756 0.251
NP_442142.1_4 Reverse -45 -58 3.36198 0.258
NP_442292.1_1 Reverse -49 -58 8.65285 0.0335
NP_442292.1_1 Forward -56 -47 -0.196935 0.239
NP_442292.1_5 Forward -61 -42 -1.86883 0.272
NP_440919.1_7 Forward -358 -340 11.5246 0.171
NP_442476.1_6 Reverse -49 -63 3.93283 0.153
NP_442476.1_6 Reverse -366 -380 1.27789 0.223
NP_440895.1_6 Forward -63 -50 10.5407 0.202
NP_442381.1_8 Reverse -77 -96 -6.49039 0.16
NP_441523.1_6 Forward -306 -287 4.32602 0.256
NP_443009.1_5 Forward -58 -47 6.05637 0.177
NP_443009.1_5 Reverse -364 -375 3.8931 0.274
NP_441715.1_4 Reverse -49 -59 7.55152 0.108
NP_441448.1_1 Forward -346 -327 6.98095 0.236
NP_441448.1_1 Reverse -61 -80 6.78429 0.241
NP_441448.1_2 Reverse -43 -62 1.08032 0.215
NP_441198.1_8 Reverse -143 -153 11.0251 0.228
NP_441468.1_1 Forward -56 -49 6.13563 0.209
NP_441468.1_1 Reverse -49 -56 6.0373 0.223
NP_441468.1_1 Reverse -370 -377 3.97235 0.277
NP_441020.2_6 Reverse -78 -95 8.7903 0.188
NP_441020.2_7 Forward -93 -74 7.4718 0.269
NP_441015.1_8 Reverse -249 -268 4.62101 0.258
NP_441015.1_10 Reverse -333 -352 -3.93378 0.195
NP_441673.1_1 Forward -57 -48 11.1111 0.0121
NP_441673.1_1 Reverse -48 -57 11.0128 0.018
NP_441731.1_3 Forward -65 -46 -6.29373 0.29
NP_441016.2_9 Reverse -82 -101 21.8289 0.0413
NP_441876.1_9 Reverse -213 -223 11.7793 0.273
NP_441876.1_9 Forward -330 -320 10.5993 0.287
NP_442868.1_6 Forward -59 -49 9.51814 0.0447
NP_442868.1_6 Reverse -46 -56 8.73149 0.0555
NP_442868.1_6 Reverse -324 -334 4.40493 0.178
NP_442868.1_6 Reverse -65 -75 -0.314959 0.284
NP_442719.1_2 Forward -384 -366 -0.178247 0.162
NP_441612.1_2 Forward -302 -292 6.80666 0.277
NP_442427.1_8 Reverse -39 -58 7.27595 0.216
NP_442808.1_1 Reverse -47 -57 9.321 0.0481
NP_442692.1_10 Forward -234 -221 17.0002 0.213
NP_440145.1_3 Reverse -38 -57 -1.08219 0.146
NP_442542.1_2 Reverse -46 -59 13.9823 0.114
NP_442542.1_2 Forward -59 -46 6.60746 0.216
NP_442050.1_1 Reverse -254 -273 11.5042 0.233
NP_442050.1_5 Reverse -46 -56 11.4843 0.0959
NP_440558.1_2 Reverse -99 -118 -2.95047 0.232
NP_440162.1_2 Forward -73 -54 16.4207 0.151
NP_442789.1_4 Reverse -272 -291 -6.98204 0.289
NP_442789.1_4 Reverse -78 -97 -7.57203 0.298
NP_441878.1_2 Reverse -67 -86 16.8141 0.252
NP_441878.1_4 Forward -186 -167 6.19431 0.271
NP_441878.1_6 Reverse -47 -57 10.4031 0.0176
NP_441878.1_6 Reverse -368 -378 1.65166 0.0795
NP_441878.1_6 Reverse -254 -264 1.06167 0.116
NP_441878.1_6 Forward -58 -48 0.668351 0.139
NP_441878.1_6 Forward -265 -255 -0.118297 0.167
NP_441878.1_6 Reverse -40 -50 -7.29646 0.217
NP_441878.1_6 Forward -50 -40 -7.29646 0.217
NP_441878.1_6 Reverse -79 -89 -7.59145 0.245
NP_441036.1_8 Forward -58 -48 7.05986 0.21
NP_441557.1_5 Forward -57 -48 10.2261 0.0144
NP_441557.1_5 Reverse -48 -57 10.1278 0.0188
NP_441557.1_5 Forward -378 -369 -0.885252 0.26
NP_441445.1_1 Forward -66 -47 2.3594 0.235
NP_440084.1_8 Forward -392 -378 9.46532 0.289
NP_440101.1_6 Forward -91 -72 12.3892 0.256
NP_442830.1_5 Reverse -46 -60 2.75226 0.255
NP_442166.1_7 Reverse -81 -95 8.45605 0.235
NP_441574.1_1 Reverse -326 -345 -4.22878 0.252
NP_441549.1_9 Forward -61 -43 -4.8974 0.198
NP_441549.1_9 Reverse -289 -307 -6.07737 0.198
NP_441238.1_10 Forward -68 -54 10.0294 0.292
NP_442347.1_2 Reverse -49 -58 10.3245 0.058
NP_442645.1_2 Forward -386 -367 -6.09707 0.081
NP_441633.1_3 Forward -91 -78 7.39411 0.0479
NP_441633.1_3 Forward -59 -46 3.16588 0.0738
NP_440136.1_2 Forward -56 -49 6.23397 0.171
NP_440136.1_2 Reverse -49 -56 6.13563 0.193
NP_440136.1_2 Reverse -366 -373 3.97235 0.288
NP_442998.1_5 Reverse -374 -384 10.9931 0.199
NP_442998.1_5 Reverse -225 -235 9.7148 0.236
NP_442998.1_10 Reverse -50 -57 15.5754 0.0102
NP_442998.1_10 Reverse -371 -378 6.23397 0.157
NP_442998.1_10 Forward -55 -48 5.84064 0.235
NP_440899.1_5 Forward -96 -77 1.0811 0.296
NP_440299.1_1 Forward -382 -369 7.98351 0.1
NP_440299.1_1 Forward -93 -80 6.60689 0.136
NP_441799.1_1 Reverse -44 -58 8.45543 0.114
NP_441799.1_9 Reverse -47 -66 -4.32711 0.256
NP_441007.1_10 Reverse -75 -88 8.18076 0.116
NP_442201.1_10 Reverse -69 -88 -12.9802 0.27
NP_440256.1_1 Forward -60 -41 -2.75381 0.122
NP_440087.1_1 Forward -66 -47 -8.94866 0.287
NP_441559.1_8 Forward -339 -325 1.86788 0.153
NP_441559.1_8 Forward -281 -267 1.47456 0.155
NP_441559.1_8 Forward -62 -48 -6.78525 0.279
NP_441559.1_8 Forward -379 -365 -7.67023 0.297
NP_440915.1_6 Forward -61 -47 0.982901 0.148
NP_441296.1_7 Forward -61 -42 13.9625 0.267
NP_440717.1_3 Reverse -171 -185 6.68548 0.298
NP_442785.1_7 Reverse -46 -60 18.6825 0.0787
NP_442866.1_6 Forward -59 -40 9.0459 0.236
NP_441464.1_8 Forward -378 -364 5.70279 0.253
NP_440702.1_2 Reverse -308 -327 -4.22878 0.257
NP_441494.1_6 Reverse -321 -334 6.60746 0.28
NP_442957.1_8 Forward -355 -336 9.0459 0.287
NP_442993.1_1 Forward -57 -41 -8.88958 0.176
NP_441340.1_5 Forward -56 -49 13.5105 0.0314
NP_441340.1_5 Reverse -49 -56 5.84064 0.208
NP_441340.1_5 Forward -377 -370 4.07068 0.239
NP_442484.1_2 Reverse -170 -189 2.65439 0.223
NP_442484.1_2 Forward -68 -49 1.67108 0.227
NP_442484.1_2 Forward -275 -256 1.0811 0.238
NP_440168.1_9 Reverse -207 -226 -5.99873 0.296
NP_440146.1_1 Forward -32 -14 15.5672 0.198
NP_442714.1_7 Forward -111 -92 -1.96717 0.292
NP_440586.1_8 Forward -377 -370 12.8218 0.0395
NP_440586.1_8 Reverse -49 -56 9.47853 0.146
NP_440586.1_8 Forward -56 -49 5.74197 0.283
NP_441262.1_3 Forward -57 -50 14.7888 0.0223
NP_440027.1_8 Reverse -166 -185 5.60352 0.279
NP_443051.1_1 Reverse -47 -56 8.25953 0.0414
NP_443051.1_1 Forward -58 -49 7.47288 0.0571
NP_443051.1_1 Reverse -79 -88 -1.18024 0.297
NP_439996.1_6 Forward -73 -54 14.7157 0.169
NP_441232.1_10 Forward -143 -124 0.884433 0.296
NP_439984.1_3 Forward -385 -371 13.5686 0.223
NP_439984.1_3 Reverse -73 -87 12.9786 0.239
NP_439937.1_8 Reverse -324 -343 -0.295539 0.239
NP_439937.1_9 Reverse -47 -64 3.57804 0.0798
NP_439937.1_9 Reverse -364 -381 -8.8116 0.177
NP_440408.1_7 Reverse -255 -274 18.9773 0.107
NP_440408.1_7 Forward -184 -165 9.93088 0.253
NP_440439.1_1 Forward -60 -47 11.1307 0.0339
NP_440921.1_3 Reverse -49 -68 15.6341 0.154
NP_442239.1_8 Reverse -74 -93 11.9958 0.239
NP_439943.1_1 Forward -384 -365 -8.06369 0.263
NP_440372.1_2 Forward -56 -49 13.8055 0.0214
NP_440372.1_2 Reverse -49 -56 6.52896 0.188
NP_440171.1_3 Reverse -64 -83 10.4225 0.224
NP_441789.1_7 Forward -324 -305 -3.63955 0.277
NP_440819.1_5 Forward -399 -391 7.68924 0.266
NP_441803.1_2 Reverse -318 -337 0.982764 0.242
NP_439977.1_5 Forward -95 -76 -0.590531 0.229
NP_441572.1_7 Reverse -42 -61 -1.7705 0.19
NP_441572.1_7 Reverse -74 -93 -1.86883 0.19
NP_440267.1_2 Reverse -43 -57 8.75042 0.162
NP_442384.1_10 Reverse -48 -61 17.4239 0.00585
NP_442384.1_10 Reverse -369 -382 5.03416 0.139
NP_442384.1_10 Forward -302 -289 0.510939 0.289
NP_442384.1_10 Forward -49 -36 0.314277 0.294
NP_442114.1_4 Reverse -365 -376 7.33516 0.29
NP_441877.1_5 Reverse -141 -160 2.26107 0.253
NP_442262.1_10 Reverse -49 -56 13.2155 0.0213
NP_442262.1_10 Forward -377 -370 10.3639 0.153
NP_441689.1_5 Reverse -143 -153 5.68278 0.215
NP_440344.1_10 Forward -339 -322 -12.2525 0.246
NP_440282.1_10 Forward -274 -255 -9.83364 0.289
NP_440189.1_2 Reverse -322 -341 -0.983855 0.294
NP_441965.1_10 Reverse -45 -61 3.20513 0.271
NP_441965.1_10 Reverse -142 -158 2.32015 0.288
NP_441640.1_8 Reverse -49 -68 -0.885524 0.205
NP_440297.1_9 Forward -263 -253 0.0783647 0.282
NP_440297.1_9 Forward -56 -46 -0.118297 0.282
NP_440350.1_1 Forward -236 -217 0.491109 0.21
NP_442280.1_10 Reverse -171 -189 8.37644 0.258
NP_442280.1_10 Reverse -165 -183 6.81803 0.268
NP_442280.1_10 Forward -273 -255 4.96742 0.291
NP_441592.1_4 Forward -302 -283 -2.85214 0.272
NP_440894.1_10 Forward -349 -330 9.14423 0.163
NP_440999.1_9 Forward -93 -79 -2.55701 0.27
NP_440888.1_2 Reverse -48 -62 12.487 0.0442
NP_442033.1_10 Reverse -46 -65 -4.03212 0.177
NP_442033.1_10 Forward -52 -33 -11.6036 0.255
NP_441543.1_2 Reverse -49 -58 7.07956 0.131
NP_442845.1_2 Forward -63 -49 6.29277 0.212
NP_442710.1_7 Forward -396 -377 -0.975606 0.213
NP_443064.1_6 Forward -57 -47 12.6639 0.0796
NP_443064.1_6 Reverse -48 -58 10.4338 0.153
NP_442337.1_8 Forward -270 -251 1.67108 0.233
NP_442578.1_7 Forward -56 -49 6.0373 0.18
NP_440710.1_1 Forward -97 -79 -8.14232 0.257
NP_441462.1_2 Forward -57 -47 18.3679 0.0036
NP_441462.1_2 Reverse -48 -58 1.74999 0.0811
NP_441462.1_2 Forward -378 -368 -0.0199663 0.177
NP_441462.1_2 Forward -89 -79 -0.904945 0.265
NP_441621.1_7 Reverse -324 -338 -4.13031 0.208
NP_441621.1_7 Forward -91 -77 -5.80194 0.263
NP_443062.1_1 Forward -117 -99 5.71821 0.22
NP_443062.1_1 Reverse -48 -66 3.67056 0.289
NP_443062.1_6 Forward -65 -46 1.76941 0.268
NP_440519.1_6 Reverse -164 -178 11.2093 0.29
NP_442204.1_1 Forward -61 -50 -0.0396598 0.285
NP_442204.1_6 Forward -66 -47 10.3242 0.19
NP_440516.1_8 Forward -57 -48 16.9127 0.00442
NP_440516.1_8 Reverse -48 -57 14.8477 0.00685
NP_442428.1_5 Forward -56 -49 6.13563 0.209
NP_442428.1_5 Reverse -49 -56 6.0373 0.212
NP_442428.1_5 Reverse -370 -377 4.36568 0.271
NP_441443.1_7 Reverse -348 -367 -0.39387 0.245
NP_441267.1_1 Forward -380 -361 5.89931 0.227
NP_442120.1_10 Forward -170 -151 -11.4069 0.262
NP_440673.1_3 Reverse -50 -57 12.4288 0.0426
NP_440673.1_3 Forward -333 -326 7.02061 0.274
NP_440673.1_3 Reverse -285 -292 6.3323 0.283
NP_441052.1_2 Reverse -48 -58 10.1081 0.0295
NP_441052.1_2 Forward -57 -47 0.865012 0.256
NP_440992.1_2 Forward -184 -165 9.63589 0.273
NP_442219.1_9 Reverse -49 -58 7.96454 0.0696
NP_440436.1_4 Reverse -49 -58 7.57079 0.124
NP_440436.1_4 Forward -56 -47 6.39082 0.162
NP_441884.1_8 Reverse -325 -344 -13.9635 0.296
NP_441884.1_9 Reverse -45 -64 -25.0749 0.29
NP_440314.1_9 Forward -56 -37 0.786102 0.0952
NP_440314.1_9 Reverse -49 -68 -8.45701 0.248
NP_440314.1_9 Forward -88 -69 -10.0303 0.282
NP_441719.1_4 Forward -56 -49 6.82395 0.0855
NP_441719.1_4 Reverse -49 -56 6.52896 0.188
NP_441719.1_4 Reverse -366 -373 3.77569 0.285
NP_441004.1_1 Reverse -35 -54 -5.9004 0.18
NP_441004.1_1 Reverse -74 -93 -15.6352 0.276
NP_441004.1_1 Reverse -320 -339 -16.7168 0.287
NP_441004.1_4 Reverse -38 -48 9.41981 0.259
NP_441004.1_5 Reverse -37 -51 11.0127 0.241
NP_442366.1_5 Forward -381 -371 12.8609 0.106
NP_442366.1_5 Reverse -362 -372 10.5993 0.251
NP_442854.1_6 Reverse -261 -280 4.42435 0.252
NP_440328.1_4 Reverse -42 -61 2.65439 0.198
NP_441851.1_10 Reverse -47 -57 7.64985 0.135
NP_441851.1_10 Forward -58 -48 6.17489 0.182
NP_441851.1_10 Reverse -364 -374 4.20827 0.282
NP_442011.1_1 Reverse -77 -96 0.392778 0.268
NP_442515.1_1 Reverse -47 -61 8.16106 0.0822
NP_442515.1_1 Forward -90 -76 6.09611 0.101
NP_442515.1_1 Forward -58 -44 2.85119 0.129
NP_441396.1_5 Reverse -318 -327 7.47288 0.252
NP_441046.1_2 Reverse -364 -383 3.6377 0.231
NP_441046.1_2 Forward -389 -370 -2.26216 0.299
NP_441349.1_10 Forward -67 -48 -7.17871 0.245
NP_441349.1_10 Forward -60 -41 -8.65367 0.278
NP_441409.1_6 Forward -63 -44 -0.0988766 0.0673
NP_440432.1_9 Forward -56 -41 4.1098 0.0764
NP_440432.1_9 Forward -75 -60 -5.03498 0.233
NP_439960.1_10 Forward -70 -52 -4.50408 0.293
NP_440933.1_9 Forward -368 -349 21.2381 0.141
NP_440726.1_2 Forward -85 -66 9.24257 0.194
NP_440588.1_2 Forward -66 -47 2.26107 0.122
NP_440588.1_2 Reverse -31 -50 -5.50708 0.252
NP_440195.1_5 Reverse -363 -382 5.89931 0.228
NP_442006.1_2 Forward -184 -167 -8.12263 0.192
NP_442006.1_2 Forward -185 -168 -15.9891 0.235
NP_442006.1_2 Reverse -254 -271 -17.8574 0.283
NP_442006.1_2 Reverse -317 -334 -17.9557 0.285
NP_442006.1_2 Reverse -337 -354 -19.0374 0.297
NP_441003.1_9 Forward -273 -254 11.8975 0.213
NP_441078.1_4 Forward -57 -48 9.93116 0.0203
NP_441078.1_4 Reverse -48 -57 9.83282 0.0226
NP_441078.1_4 Forward -302 -293 4.81794 0.126
NP_441078.1_4 Reverse -80 -89 -1.08191 0.222
NP_441078.1_4 Reverse -293 -302 -1.27858 0.246
NP_440526.1_3 Reverse -130 -141 2.71313 0.267
NP_440526.1_3 Forward -56 -45 1.72983 0.267
NP_441432.1_8 Forward -58 -49 14.0611 0.0258
NP_442320.1_8 Reverse -42 -56 -4.22864 0.151
NP_442344.1_7 Forward -56 -37 -5.60541 0.168
NP_441732.1_2 Forward -306 -290 10.8749 0.0141
NP_440313.1_5 Forward -296 -278 17.3246 0.214
NP_440313.1_5 Forward -42 -24 13.293 0.214
NP_442003.1_4 Reverse -49 -68 13.2741 0.257
NP_440760.1_1 Reverse -369 -388 -13.8652 0.115
NP_440760.1_1 Reverse -48 -67 -21.7317 0.243
NP_442797.1_7 Forward -96 -78 7.09898 0.198
NP_442751.1_2 Reverse -328 -347 2.55527 0.285
NP_440713.1_4 Forward -67 -48 4.22769 0.231
NP_442489.1_2 Forward -68 -49 3.83436 0.229
NP_442489.1_7 Reverse -48 -57 10.5211 0.0102
NP_442489.1_7 Forward -57 -48 10.4228 0.0151
NP_442489.1_7 Reverse -369 -378 5.3096 0.0708
NP_440565.1_2 Forward -231 -217 15.905 0.292
NP_440559.1_1 Forward -56 -47 14.5527 0.0154
NP_440559.1_1 Reverse -49 -58 7.76787 0.0918
NP_440559.1_1 Forward -377 -368 4.71961 0.217
NP_441659.2_8 Reverse -48 -58 15.0247 0.00732
NP_441659.2_8 Forward -57 -47 9.81313 0.0269
NP_442913.1_10 Reverse -39 -58 6.19431 0.0645
NP_441040.1_2 Forward -355 -336 -7.67036 0.221
NP_441040.1_2 Forward -58 -39 -12.5869 0.259
NP_441040.1_2 Reverse -166 -185 -13.5702 0.284
NP_440708.1_6 Forward -273 -254 -10.4236 0.278
NP_442346.1_5 Reverse -47 -57 8.1415 0.146
NP_442346.1_5 Forward -58 -48 7.55152 0.165
NP_442346.1_5 Forward -379 -369 5.87989 0.225
NP_442346.1_5 Reverse -254 -264 5.38824 0.248
NP_442346.1_5 Reverse -368 -378 5.19158 0.256
NP_440545.1_3 Forward -93 -76 -6.64766 0.285
NP_441856.1_3 Reverse -64 -83 0.196116 0.216
NP_440831.1_3 Forward -66 -47 7.06668 0.265
NP_440010.1_10 Reverse -275 -294 1.86774 0.292
NP_442603.1_7 Reverse -48 -62 14.0603 0.0733
NP_443022.1_3 Forward -230 -211 13.8641 0.258
NP_441050.1_7 Reverse -300 -318 7.39397 0.269
NP_440449.1_6 Forward -264 -246 8.15857 0.206
NP_441833.1_4 Reverse -49 -56 6.52896 0.0924
NP_441833.1_4 Forward -56 -49 6.23397 0.163
NP_442162.1_9 Forward -56 -49 12.9205 0.0282
NP_442162.1_9 Reverse -49 -56 12.9205 0.0282
NP_441915.1_4 Forward -264 -245 6.58682 0.293
NP_442199.1_5 Reverse -361 -380 -4.42544 0.228
NP_442140.1_3 Reverse -49 -59 8.23984 0.122
NP_442723.1_1 Forward -273 -254 1.76863 0.292
NP_441813.1_5 Reverse -46 -56 15.2213 0.0118
NP_441813.1_5 Forward -59 -49 8.4365 0.0432
NP_441813.1_5 Forward -91 -81 -0.609952 0.261
NP_441813.1_5 Forward -376 -366 -0.806614 0.285
NP_441259.1_8 Forward -54 -35 14.1583 0.247
NP_440590.1_4 Reverse -49 -62 3.95252 0.0658
NP_440590.1_4 Forward -56 -43 2.47756 0.0879
NP_440590.1_4 Reverse -366 -379 -5.88057 0.293
NP_442497.1_10 Forward -56 -47 10.1278 0.0166
NP_442497.1_10 Forward -88 -79 0.589713 0.153
NP_442497.1_10 Reverse -49 -58 0.589713 0.153
NP_440821.1_4 Reverse -46 -56 1.16001 0.141
NP_440821.1_4 Reverse -78 -88 0.275027 0.19
NP_440821.1_4 Forward -59 -49 -0.314959 0.251
NP_441239.1_9 Reverse -46 -58 11.347 0.0627
NP_441239.1_9 Forward -266 -254 6.03717 0.202
NP_441239.1_9 Reverse -367 -379 3.08724 0.296
NP_441892.1_1 Reverse -246 -263 -2.22277 0.219
NP_442044.1_1 Forward -307 -288 -11.8003 0.271
NP_442325.1_8 Forward -399 -380 15.8436 0.29
NP_441508.1_4 Forward -241 -227 13.7625 0.293
NP_441017.1_6 Forward -162 -148 12.0937 0.227
NP_440833.1_6 Reverse -377 -391 14.7486 0.146
NP_440354.1_5 Forward -338 -319 1.67108 0.272
NP_440412.1_2 Reverse -26 -45 7.47261 0.281
NP_440546.1_4 Forward -57 -47 13.8273 0.0459
NP_440546.1_4 Reverse -48 -58 7.42815 0.241
NP_441230.1_5 Reverse -43 -62 -0.197208 0.28
NP_440462.1_6 Reverse -46 -56 6.76487 0.102
NP_442340.1_3 Forward -110 -91 -8.55534 0.249
NP_442611.1_1 Forward -57 -38 0.294447 0.259
NP_440868.1_4 Forward -61 -49 17.0502 0.0124
NP_440868.1_4 Forward -378 -366 0.825626 0.199
NP_440868.1_10 Reverse -47 -65 23.4219 0.0406
NP_442402.1_10 Reverse -212 -222 14.0409 0.182
NP_442039.1_4 Forward -56 -49 11.6422 0.0747
NP_441926.1_3 Forward -57 -41 2.8118 0.256
NP_442837.1_3 Forward -373 -366 8.79057 0.165
NP_442837.1_3 Forward -56 -49 6.0373 0.25
NP_442837.1_3 Reverse -49 -56 6.0373 0.25
NP_440160.1_5 Reverse -52 -62 15.5158 0.267
NP_442053.1_1 Reverse -48 -57 16.6177 0.00257
NP_442053.1_1 Forward -57 -48 8.65285 0.0741
NP_440505.1_3 Forward -59 -49 16.7946 0.00614
NP_442360.1_2 Forward -186 -173 19.2915 0.187
NP_440207.2_7 Reverse -294 -313 16.3224 0.268
NP_441252.1_6 Reverse -223 -230 11.9372 0.25
NP_440308.1_6 Forward -185 -166 1.27776 0.296
NP_442532.1_1 Forward -395 -381 17.0132 0.215
NP_440914.1_1 Reverse -48 -58 15.6417 0.00456
NP_440914.1_1 Reverse -267 -277 7.44401 0.237
NP_440914.1_1 Reverse -103 -113 7.15123 0.249
NP_440914.1_1 Reverse -369 -379 6.07773 0.297
NP_441699.1_2 Forward -45 -26 12.8808 0.252
NP_441011.1_8 Forward -56 -47 10.8161 0.094
NP_441011.1_8 Forward -131 -122 9.14451 0.135
NP_442533.1_1 Reverse -62 -81 -16.6185 0.273
NP_442533.1_1 Reverse -63 -82 -17.5035 0.289
NP_442533.1_6 Reverse -48 -57 14.2577 0.0132
NP_442533.1_6 Forward -57 -48 7.47288 0.0898
NP_442533.1_6 Forward -378 -369 5.70292 0.132
NP_442533.1_6 Reverse -255 -264 4.52295 0.179
NP_442533.1_6 Reverse -338 -347 2.26134 0.266
NP_442533.1_6 Forward -49 -40 1.37636 0.3
NP_442541.1_10 Forward -264 -250 8.3571 0.219
NP_442322.1_4 Forward -84 -67 0.333137 0.21
NP_443016.1_1 Reverse -72 -91 -4.91709 0.238
NP_441482.1_7 Reverse -42 -56 -11.8985 0.286
NP_442269.1_10 Forward -68 -49 3.53937 0.248
NP_441697.1_5 Reverse -377 -396 -11.0297 0.29
NP_441028.1_6 Forward -74 -64 13.2542 0.159
NP_441028.1_6 Reverse -212 -222 3.8145 0.281
NP_440116.1_8 Forward -56 -37 5.99764 0.0605
NP_440116.1_8 Reverse -49 -68 -2.45882 0.134
NP_440115.1_6 Forward -60 -50 15.0247 0.0505
NP_440115.1_6 Reverse -323 -333 13.5497 0.0699
NP_440007.1_9 Reverse -44 -58 0.392915 0.298
NP_441602.1_3 Forward -62 -43 -2.55715 0.233
NP_441602.1_3 Forward -383 -364 -3.63879 0.251
NP_441420.1_1 Forward -58 -39 3.04771 0.166
NP_439903.1_6 Forward -273 -254 1.08032 0.255
NP_442306.1_10 Forward -62 -43 -11.4069 0.129
NP_441286.1_1 Forward -58 -46 6.03717 0.0258
NP_441286.1_1 Forward -379 -367 -4.28759 0.154
NP_441286.1_1 Forward -90 -78 -5.86088 0.229
NP_441286.1_1 Reverse -47 -59 -6.35254 0.26
NP_440670.1_8 Forward -57 -48 18.0926 0.00136
NP_440670.1_8 Reverse -48 -57 15.831 0.00494
NP_441479.1_9 Forward -184 -166 13.8838 0.273
NP_440886.1_7 Reverse -47 -57 6.76441 0.114
NP_442614.1_2 Reverse -48 -62 12.9793 0.139
NP_442614.1_2 Forward -57 -43 6.19444 0.291
NP_440404.1_10 Forward -168 -155 15.9415 0.281
NP_440513.1_6 Reverse -38 -57 9.34008 0.27
NP_441021.1_1 Forward -275 -256 -7.27704 0.182
NP_441021.1_1 Forward -377 -358 -12.6852 0.293
NP_441463.1_3 Forward -142 -123 -3.44213 0.176
NP_441626.1_2 Forward -56 -49 12.2322 0.0511
NP_441626.1_2 Forward -88 -81 11.1505 0.0716
NP_441626.1_2 Reverse -49 -56 5.93897 0.231
NP_440107.1_2 Forward -62 -43 10.7175 0.299
NP_442615.1_1 Reverse -39 -57 -6.96235 0.271
NP_441962.1_4 Reverse -364 -383 -13.0786 0.268
NP_441962.1_4 Reverse -36 -55 -13.6686 0.277
NP_441431.1_2 Reverse -366 -380 7.86545 0.231
NP_441836.1_2 Forward -63 -44 -5.50708 0.283
NP_441836.1_2 Reverse -332 -351 -5.9004 0.288
NP_440114.1_10 Forward -57 -43 17.6992 0.00953
NP_442437.1_8 Forward -346 -327 11.6025 0.164
NP_441510.2_6 Forward -59 -40 12.0933 0.295
NP_440293.1_3 Reverse -71 -90 -3.24547 0.244
NP_440293.1_3 Forward -386 -367 -4.03212 0.257
NP_440293.1_9 Forward -269 -255 9.60484 0.285
NP_440632.1_6 Forward -142 -124 24.8969 0.00633
NP_440632.1_7 Forward -96 -77 22.5172 0.00731
NP_440766.1_4 Reverse -331 -345 3.24451 0.151
NP_439988.1_3 Reverse -68 -82 10.816 0.219
NP_439910.1_2 Reverse -115 -132 -22.479 0.25
NP_440457.1_1 Forward -61 -49 3.38223 0.196
NP_440457.1_1 Reverse -44 -56 -0.649339 0.271
NP_440213.1_5 Forward -275 -256 9.24257 0.275
NP_440798.1_6 Forward -56 -43 3.5592 0.15
NP_440801.1_9 Forward -266 -252 14.2897 0.257
NP_441984.1_6 Reverse -249 -261 16.4603 0.173
NP_442509.1_9 Forward -57 -47 14.6309 0.0263
NP_442936.1_10 Reverse -227 -241 10.2209 0.252
NP_442514.1_5 Reverse -247 -266 0.981987 0.178
NP_442514.1_5 Forward -101 -82 -3.04956 0.222
NP_442514.1_5 Reverse -167 -186 -4.22953 0.238
NP_442514.1_5 Forward -335 -316 -7.47443 0.276
NP_442514.1_5 Forward -315 -296 -8.16275 0.285
NP_440554.1_4 Reverse -49 -59 5.97822 0.128
NP_442862.1_3 Forward -77 -60 5.54538 0.271
NP_441885.1_5 Reverse -48 -58 11.0914 0.00874
NP_441885.1_5 Forward -57 -47 9.12481 0.0238
NP_441885.1_5 Forward -302 -292 -0.806614 0.228
NP_442341.1_7 Reverse -47 -61 4.81781 0.177
NP_442341.1_7 Reverse -292 -306 2.5562 0.252
NP_441756.1_5 Forward -52 -33 -4.72043 0.295
NP_441173.1_9 Reverse -213 -221 12.0154 0.214
NP_440191.1_6 Forward -24 -10 15.1948 0.294
NP_440423.1_6 Reverse -40 -59 -14.6519 0.229
NP_443000.1_7 Forward -59 -49 10.2065 0.0355
NP_443000.1_7 Reverse -46 -56 1.84832 0.228
NP_441842.1_1 Reverse -50 -63 19.6848 0.0117
NP_441842.1_10 Reverse -319 -333 7.86607 0.241
NP_440275.1_3 Forward -59 -49 12.5664 0.0316
NP_440275.1_3 Reverse -46 -56 7.35486 0.0755
NP_440275.1_3 Reverse -333 -343 5.48657 0.145
NP_440275.1_3 Forward -91 -81 4.79825 0.172
NP_440175.1_7 Reverse -164 -182 9.07034 0.282
NP_440641.1_7 Forward -134 -115 8.55425 0.272
NP_442495.1_3 Reverse -169 -187 12.6055 0.259
NP_440149.1_8 Reverse -369 -388 -5.60541 0.23
NP_440149.1_10 Reverse -41 -60 -11.2103 0.285
NP_440216.1_1 Forward -57 -43 16.2242 0.00307
NP_440216.1_1 Reverse -48 -62 -1.77037 0.0383
NP_440216.1_1 Reverse -80 -94 -12.2918 0.256
NP_440216.1_9 Reverse -257 -266 8.25953 0.286
NP_440172.1_1 Reverse -48 -58 12.0747 0.0322
NP_440172.1_1 Forward -57 -47 6.56821 0.102
NP_440172.1_1 Forward -275 -265 2.24165 0.279
NP_442371.1_1 Forward -222 -212 12.4676 0.249
NP_440167.1_3 Reverse -38 -57 10.5209 0.233
NP_442015.1_10 Forward -61 -48 2.18257 0.199
NP_442015.1_10 Reverse -44 -57 1.19926 0.21
NP_441226.1_7 Forward -56 -49 12.7234 0.0312
NP_441226.1_7 Reverse -49 -56 11.5435 0.0757
NP_441111.1_7 Forward -56 -48 8.96754 0.0463
NP_441111.1_7 Reverse -49 -57 8.86921 0.0589
NP_441111.1_7 Forward -88 -80 -0.570565 0.233
NP_440244.1_1 Forward -187 -168 -8.16202 0.287
NP_441766.1_2 Reverse -48 -57 13.9627 0.0114
NP_441766.1_2 Forward -57 -48 7.76787 0.0714
NP_442417.1_9 Forward -57 -38 18.9773 0.246
NP_440416.1_1 Forward -57 -38 7.66927 0.0584
NP_440416.1_9 Forward -271 -252 -9.63698 0.133
NP_440416.1_9 Forward -96 -77 -13.6686 0.169
NP_440416.1_9 Forward -64 -45 -16.8151 0.223
NP_443052.1_8 Reverse -38 -57 4.81767 0.0414
NP_443052.1_8 Reverse -359 -378 3.53937 0.0482
NP_441940.1_2 Reverse -74 -93 10.1275 0.291
NP_441579.1_4 Forward -189 -170 12.2908 0.15
NP_440261.1_5 Reverse -49 -62 2.96921 0.0655
NP_440261.1_5 Forward -88 -75 -0.669033 0.0655
NP_440261.1_5 Forward -334 -321 -2.73398 0.0924
NP_440261.1_5 Forward -56 -43 -2.73398 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGAGAAAAAAAGTGAAGTTTTGGCCATCGATCCCTCACTCACATTTTCGTCTAGCCCTGGTCGCATCGGTTGCCCCCAGGAACAATTACTGTGCCTAGGAGATACCCAGCAACCAAATTGGCAGGCCATTCTCTTTGCCCTGGCCCGGTTGAGTTACATAGAAAAAATCTTGCCCCACTGGGGAGAATAGAAGCCCCTATTTGACAAATGTTTCTGGCCAAGGGACAGGGGAAGCATCTAGTGCAAGGGATACCTTTCCGTTAAGATGGTTAACGCTGAACAATTGAGCGCATTGCTAACCAGGCGGCCCTGCGACAGCCCCAAGCTGTCCCCCGTTTTGCTGGCGATCGGCCGTTGACCCAGCACGAAAACTCTTCTTTTATAGTTAAAGGTATTGTA

CDS

ATGAATCAGGAAATTTTTGAAAAAGTAAAAAAAATCGTCGTGGAACAGTTGGAAGTGGATCCTGACAAAGTGACCCCCGATGCCACCTTTGCCGAAGATTTAGGGGCTGATTCCCTCGATACAGTGGAATTGGTCATGGCCCTGGAAGAAGAGTTTGATATTGAAATTCCCGATGAAGTGGCGGAAACCATTGATACCGTGGGCAAAGCCGTTGAGCATATCGAAAGTAAATAA

Protein

MNQEIFEKVKKIVVEQLEVDPDKVTPDATFAEDLGADSLDTVELVMALEEEFDIEIPDEVAETIDTVGKAVEHIESK