Your browser is old and dusty. Try Google Chrome!

Details for ssl2069

ORF ssl2069
Accession NP_439960.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -350 -364 13.5693 0.168
NP_442711.1_1 Forward -346 -332 11.5043 0.242
NP_441061.1_2 Forward -345 -331 15.7325 0.0328
NP_441061.1_2 Reverse -338 -352 14.7492 0.0392
NP_441061.1_2 Forward -351 -337 1.96621 0.179
NP_441061.1_2 Reverse -165 -179 1.08123 0.195
NP_440795.1_7 Forward -345 -338 14.6904 0.0123
NP_440795.1_7 Reverse -338 -345 14.6904 0.0123
NP_440795.1_7 Forward -172 -165 14.6904 0.0123
NP_440795.1_7 Reverse -165 -172 14.6904 0.0123
NP_442100.1_4 Reverse -8 -27 10.1267 0.278
NP_441418.1_6 Forward -346 -327 -0.787193 0.0111
NP_441418.1_6 Reverse -337 -356 -10.6203 0.0375
NP_441418.1_6 Reverse -164 -183 -19.0768 0.0844
NP_441418.1_6 Forward -173 -154 -21.83 0.16
NP_441418.1_6 Reverse -325 -344 -29.4998 0.228
NP_440815.1_5 Reverse -164 -183 7.96426 0.237
NP_442291.1_5 Forward -174 -158 6.45005 0.0694
NP_442291.1_5 Reverse -336 -352 1.92682 0.136
NP_442291.1_7 Forward -356 -342 12.6843 0.211
NP_441453.1_4 Reverse -337 -345 16.539 0.00633
NP_441453.1_4 Reverse -164 -172 16.539 0.00633
NP_441453.1_4 Forward -346 -338 16.539 0.00633
NP_441453.1_4 Forward -173 -165 16.539 0.00633
NP_442151.1_6 Forward -173 -159 14.4542 0.0349
NP_442151.1_6 Forward -359 -345 11.2093 0.106
NP_442151.1_6 Reverse -337 -351 9.04604 0.159
NP_441818.1_1 Reverse -338 -349 9.79292 0.232
NP_440226.1_1 Forward -346 -327 4.12936 0.202
NP_441630.1_3 Forward -354 -335 -0.0988766 0.285
NP_440259.1_4 Reverse -90 -104 10.4676 0.262
NP_442623.1_3 Forward -345 -326 -17.9951 0.263
NP_442623.1_7 Reverse -107 -118 14.5133 0.286
NP_440150.1_2 Reverse -339 -358 10.7167 0.201
NP_440150.1_6 Reverse -347 -366 5.99764 0.229
NP_440150.1_6 Reverse -334 -353 1.17943 0.295
NP_442173.1_1 Forward -345 -337 15.4574 0.00633
NP_442173.1_1 Forward -172 -164 15.4574 0.00633
NP_442173.1_1 Reverse -338 -346 15.4574 0.00633
NP_442173.1_1 Reverse -165 -173 15.4574 0.00633
NP_442752.1_4 Forward -346 -339 13.8055 0.0199
NP_442752.1_4 Reverse -337 -344 13.8055 0.0199
NP_442752.1_4 Forward -173 -166 13.8055 0.0199
NP_442752.1_4 Reverse -164 -171 13.8055 0.0199
NP_443027.1_4 Reverse -335 -345 13.943 0.0452
NP_443027.1_4 Forward -348 -338 11.0914 0.107
NP_442975.1_10 Reverse -333 -347 21.6317 0.000774
NP_442975.1_10 Reverse -160 -174 10.3237 0.056
NP_442975.1_10 Reverse -130 -144 2.26061 0.28
NP_440784.1_7 Forward -345 -338 15.9687 0.0123
NP_440784.1_7 Reverse -338 -345 15.9687 0.0123
NP_440784.1_7 Forward -172 -165 15.9687 0.0123
NP_440784.1_7 Reverse -165 -172 15.9687 0.0123
NP_442909.1_7 Forward -172 -158 7.47213 0.215
NP_442861.1_4 Forward -384 -365 4.91521 0.253
NP_440061.1_9 Forward -175 -161 14.0603 0.0735
NP_440061.1_9 Reverse -335 -349 11.012 0.117
NP_440061.1_9 Forward -168 -154 8.55376 0.17
NP_440061.1_9 Forward -348 -334 5.1122 0.294
NP_440110.1_4 Forward -184 -165 11.1109 0.104
NP_441476.1_5 Reverse -332 -351 6.4893 0.132
NP_441476.1_5 Forward -351 -332 -7.86702 0.291
NP_440878.1_9 Reverse -147 -166 -1.57384 0.245
NP_440878.1_9 Forward -356 -337 -2.36049 0.26
NP_442062.1_6 Forward -146 -128 19.1937 0.0903
NP_442062.1_8 Forward -346 -336 19.4496 0.000558
NP_442062.1_8 Forward -173 -163 17.6796 0.00193
NP_442062.1_8 Reverse -337 -347 17.3846 0.00193
NP_442062.1_8 Reverse -164 -174 17.3846 0.00193
NP_441859.1_3 Forward -347 -328 10.3234 0.121
NP_441859.1_3 Reverse -336 -355 6.98015 0.168
NP_440304.1_4 Reverse -335 -345 9.91146 0.051
NP_440304.1_4 Reverse -162 -172 9.91146 0.051
NP_440304.1_4 Forward -348 -338 1.84832 0.299
NP_440304.1_4 Forward -175 -165 1.84832 0.299
NP_442242.1_4 Forward -345 -338 14.3954 0.0124
NP_442242.1_4 Reverse -338 -345 14.3954 0.0124
NP_442242.1_4 Forward -172 -165 14.3954 0.0124
NP_442242.1_4 Reverse -165 -172 14.3954 0.0124
NP_440044.1_8 Reverse -165 -184 2.16274 0.155
NP_440044.1_8 Forward -345 -326 -2.65548 0.265
NP_440044.1_8 Forward -172 -153 -3.83545 0.292
NP_442762.1_10 Reverse -145 -164 -11.8003 0.275
NP_439918.1_3 Forward -188 -169 5.30933 0.264
NP_439918.1_3 Reverse -179 -198 2.3594 0.295
NP_441208.1_9 Forward -349 -335 7.76774 0.219
NP_441208.1_9 Reverse -347 -361 5.50613 0.267
NP_441594.1_6 Reverse -328 -347 4.71934 0.214
NP_441594.1_6 Forward -355 -336 3.14605 0.236
NP_440132.1_1 Reverse -162 -180 10.1472 0.223
NP_442110.1_7 Reverse -337 -351 10.3243 0.0684
NP_442110.1_7 Forward -346 -332 1.27789 0.233
NP_440273.1_3 Reverse -33 -52 8.35759 0.19
NP_440856.1_4 Reverse -124 -143 -3.93378 0.243
NP_441083.1_5 Reverse -337 -347 20.3345 0.00053
NP_441083.1_5 Reverse -164 -174 20.3345 0.00053
NP_441083.1_5 Forward -173 -163 19.3512 0.000718
NP_441083.1_5 Forward -346 -336 11.3864 0.0159
NP_439957.1_5 Reverse -285 -304 10.7175 0.273
NP_442827.1_8 Forward -354 -335 -0.29631 0.224
NP_441434.1_1 Forward -299 -285 15.7678 0.186
NP_441434.1_6 Forward -252 -242 15.123 0.277
NP_441738.1_2 Forward -344 -337 15.28 0.0102
NP_441738.1_2 Reverse -339 -346 15.28 0.0102
NP_441738.1_2 Forward -171 -164 15.28 0.0102
NP_441738.1_2 Reverse -166 -173 15.28 0.0102
NP_441738.1_4 Reverse -327 -346 5.40766 0.207
NP_441558.1_5 Forward -175 -156 4.22769 0.286
NP_441558.1_5 Reverse -162 -181 3.93269 0.294
NP_441955.1_8 Reverse -331 -348 6.33202 0.281
NP_440209.1_1 Reverse -337 -345 18.1123 0.00295
NP_440209.1_1 Reverse -164 -172 18.1123 0.00295
NP_440209.1_1 Forward -346 -338 18.1123 0.00295
NP_440209.1_1 Forward -173 -165 18.1123 0.00295
NP_442889.1_8 Reverse -334 -348 13.2736 0.0588
NP_442889.1_8 Reverse -161 -175 10.8154 0.0775
NP_441713.1_1 Forward -179 -160 -16.0285 0.275
NP_440178.1_7 Forward -174 -155 -21.24 0.215
NP_440178.1_7 Forward -347 -328 -21.9284 0.246
NP_440538.1_10 Forward -175 -156 10.3242 0.279
NP_441716.1_1 Reverse -164 -178 10.816 0.0936
NP_441716.1_1 Reverse -337 -351 10.6193 0.0936
NP_441716.1_1 Forward -352 -338 9.04604 0.127
NP_442111.1_4 Forward -347 -333 12.586 0.0422
NP_442111.1_4 Forward -174 -160 8.55439 0.0729
NP_442111.1_4 Reverse -163 -177 7.86607 0.0849
NP_442111.1_4 Reverse -336 -350 5.21113 0.172
NP_441163.1_1 Reverse -156 -173 7.70792 0.238
NP_441163.1_1 Reverse -342 -359 4.65968 0.286
NP_440906.1_5 Forward -345 -338 15.8704 0.0124
NP_440906.1_5 Reverse -338 -345 15.8704 0.0124
NP_440906.1_5 Forward -172 -165 15.8704 0.0124
NP_440906.1_5 Reverse -165 -172 15.8704 0.0124
NP_440906.1_9 Forward -326 -307 12.1917 0.296
NP_440747.1_10 Forward -349 -337 26.5883 0.000317
NP_440747.1_10 Forward -176 -164 24.7201 0.00036
NP_440747.1_10 Reverse -161 -173 5.54551 0.0128
NP_440747.1_10 Reverse -334 -346 -2.02597 0.0196
NP_440747.1_10 Forward -362 -350 -12.3507 0.27
NP_441130.1_10 Forward -348 -334 15.2409 0.034
NP_441130.1_10 Reverse -335 -349 11.0127 0.107
NP_441854.1_10 Reverse -335 -354 2.3594 0.282
NP_441486.1_1 Forward -176 -162 15.4376 0.00596
NP_441486.1_1 Reverse -161 -175 14.8476 0.00628
NP_441486.1_1 Reverse -334 -348 5.01447 0.0398
NP_441486.1_1 Forward -349 -335 -4.22864 0.192
NP_441880.2_10 Forward -172 -154 10.5406 0.197
NP_442634.1_3 Forward -184 -165 13.9616 0.166
NP_442634.1_4 Reverse -335 -349 -2.85201 0.156
NP_442634.1_4 Reverse -162 -176 -2.85201 0.156
NP_442634.1_4 Forward -348 -334 -3.34366 0.161
NP_440403.1_4 Reverse -328 -347 -4.72043 0.213
NP_441014.1_5 Forward -70 -52 9.0656 0.287
NP_441014.1_10 Forward -347 -328 3.14526 0.215
NP_442848.1_1 Reverse -331 -345 5.70279 0.0803
NP_442848.1_1 Forward -352 -338 -1.5737 0.263
NP_442848.1_1 Forward -179 -165 -2.75368 0.263
NP_442848.1_5 Forward -173 -155 -3.81576 0.299
NP_442848.1_9 Forward -352 -333 5.11266 0.202
NP_442848.1_9 Forward -172 -153 2.65439 0.248
NP_441012.1_4 Forward -157 -144 7.78743 0.272
NP_443018.1_3 Forward -345 -338 14.8871 0.0123
NP_443018.1_3 Reverse -338 -345 14.8871 0.0123
NP_443018.1_3 Forward -172 -165 14.8871 0.0123
NP_443018.1_3 Reverse -165 -172 14.8871 0.0123
NP_441634.1_8 Forward -348 -334 24.5823 0.00171
NP_441634.1_8 Forward -67 -53 -2.85201 0.295
NP_441634.1_8 Forward -175 -161 -3.93365 0.295
NP_440376.1_1 Forward -346 -337 19.4693 0.000692
NP_440376.1_1 Reverse -337 -346 19.4693 0.000692
NP_440376.1_1 Forward -173 -164 19.4693 0.000692
NP_440376.1_1 Reverse -164 -173 19.4693 0.000692
NP_440376.1_1 Reverse -56 -65 2.94966 0.213
NP_441588.1_4 Reverse -166 -176 9.02648 0.14
NP_441588.1_4 Forward -344 -334 6.96153 0.178
NP_442687.1_7 Reverse -163 -173 18.5646 0.0028
NP_442687.1_7 Reverse -336 -346 15.8113 0.0125
NP_442687.1_7 Forward -360 -350 10.9931 0.0994
NP_442687.1_7 Forward -347 -337 8.92815 0.0994
NP_442687.1_7 Forward -174 -164 8.92815 0.0994
NP_442687.1_7 Forward -154 -144 4.89658 0.23
NP_441077.1_6 Reverse -220 -236 6.56173 0.239
NP_442485.1_3 Forward -357 -338 -0.4922 0.253
NP_442485.1_3 Forward -348 -329 -4.52377 0.282
NP_441013.1_2 Reverse -139 -157 11.0322 0.163
NP_441013.1_2 Forward -357 -339 -2.24246 0.282
NP_441013.1_2 Forward -363 -345 -5.09406 0.3
NP_441422.1_7 Reverse -335 -352 7.217 0.0992
NP_440533.1_9 Reverse -353 -372 8.84924 0.161
NP_441763.1_10 Reverse -326 -345 6.29183 0.269
NP_442658.1_1 Reverse -335 -345 18.7607 0.00222
NP_442658.1_1 Reverse -162 -172 14.8275 0.0188
NP_442658.1_1 Forward -348 -338 7.94438 0.199
NP_442658.1_1 Forward -175 -165 6.76441 0.214
NP_442198.1_7 Forward -62 -43 11.2084 0.209
NP_440141.1_4 Forward -343 -324 -5.11376 0.296
NP_442782.1_2 Reverse -337 -351 2.2612 0.275
NP_442496.1_5 Forward -100 -82 7.29564 0.256
NP_442205.1_9 Reverse -158 -174 -1.51476 0.264
NP_441414.1_9 Reverse -164 -183 5.11266 0.0483
NP_441414.1_9 Forward -346 -327 -5.50708 0.177
NP_440184.1_5 Reverse -46 -65 11.7008 0.143
NP_441487.1_9 Forward -174 -155 7.17762 0.119
NP_442300.1_5 Reverse -162 -181 14.4541 0.282
NP_439959.1_6 Forward -152 -133 26.0572 0.00285
NP_442937.1_5 Reverse -332 -351 13.7658 0.0872
NP_442937.1_5 Forward -351 -332 12.5858 0.105
NP_442321.1_4 Forward -337 -318 -9.44032 0.298
NP_441958.1_5 Reverse -163 -173 20.5312 0.000966
NP_441958.1_5 Forward -347 -337 12.2714 0.00183
NP_441958.1_5 Reverse -336 -346 12.2714 0.00183
NP_441958.1_5 Forward -174 -164 12.2714 0.00183
NP_441127.1_1 Forward -352 -338 7.86607 0.3
NP_442836.1_5 Reverse -158 -177 5.60432 0.185
NP_440203.1_5 Reverse -167 -177 10.5993 0.218
NP_440984.1_7 Reverse -159 -173 17.3058 0.0267
NP_441377.1_4 Forward -22 -5 20.885 0.0219
NP_439990.1_5 Forward -351 -338 13.884 0.0889
NP_439990.1_5 Reverse -296 -309 8.86907 0.158
NP_442690.1_1 Reverse -228 -247 -17.3068 0.299
NP_442911.1_2 Reverse -327 -346 1.37609 0.0593
NP_442911.1_2 Forward -183 -164 0.58944 0.0657
NP_442911.1_2 Forward -356 -337 -3.24547 0.11
NP_441580.1_6 Reverse -326 -345 -3.24547 0.235
NP_440153.1_5 Forward -172 -158 5.80112 0.191
NP_440153.1_5 Reverse -338 -352 1.67122 0.245
NP_440153.1_5 Forward -345 -331 0.687908 0.291
NP_443055.1_6 Forward -173 -155 6.01657 0.172
NP_440827.1_3 Reverse -332 -351 14.6508 0.201
NP_441129.1_8 Reverse -43 -62 8.55425 0.296
NP_441099.1_5 Forward -356 -337 7.7676 0.0409
NP_441099.1_5 Reverse -327 -346 5.211 0.0469
NP_441099.1_5 Forward -183 -164 -2.85214 0.127
NP_442002.1_9 Reverse -163 -170 14.1004 0.074
NP_442002.1_9 Reverse -336 -343 10.7572 0.185
NP_441294.1_7 Reverse -160 -174 19.7134 0.00264
NP_441294.1_7 Reverse -333 -347 17.2177 0.0101
NP_441646.1_1 Forward -353 -334 3.44104 0.207
NP_441646.1_1 Reverse -330 -349 2.0644 0.221
NP_441646.1_1 Forward -180 -161 -0.295539 0.26
NP_442438.1_10 Forward -351 -337 10.0294 0.0581
NP_442438.1_10 Reverse -332 -346 9.63603 0.0617
NP_442438.1_10 Forward -178 -164 3.8345 0.156
NP_442438.1_10 Forward -339 -325 0.196253 0.236
NP_441000.1_6 Forward -347 -333 -3.44199 0.221
NP_441000.1_6 Reverse -336 -350 -3.93365 0.225
NP_441000.1_6 Reverse -163 -177 -3.93365 0.225
NP_441000.1_6 Forward -174 -160 -5.40861 0.275
NP_442771.1_1 Reverse -335 -353 -5.58572 0.166
NP_440147.1_4 Forward -348 -335 16.8339 0.00906
NP_440147.1_4 Reverse -162 -175 13.294 0.0326
NP_440147.1_4 Forward -175 -162 11.7207 0.0326
NP_440147.1_4 Reverse -335 -348 11.0324 0.0341
NP_440147.1_4 Forward -361 -348 5.82081 0.112
NP_441175.1_7 Reverse -164 -183 12.8808 0.113
NP_441550.1_8 Reverse -162 -172 17.6791 0.00754
NP_441550.1_8 Forward -348 -338 15.1225 0.0132
NP_441550.1_8 Forward -175 -165 14.6309 0.0132
NP_441550.1_8 Reverse -335 -345 10.501 0.066
NP_441916.1_7 Forward -346 -336 18.4663 0.00144
NP_441916.1_7 Forward -173 -163 16.893 0.00407
NP_441916.1_7 Reverse -337 -347 10.3048 0.0261
NP_441916.1_7 Reverse -164 -174 10.3048 0.0261
NP_441916.1_10 Forward -181 -162 2.65439 0.243
NP_441041.1_4 Reverse -164 -183 -0.295539 0.0941
NP_441041.1_4 Forward -346 -327 -1.67217 0.102
NP_441041.1_7 Reverse -334 -346 19.5648 0.00277
NP_441041.1_7 Reverse -161 -173 11.9849 0.0689
NP_441041.1_7 Forward -176 -164 8.58373 0.133
NP_441041.1_7 Forward -349 -337 7.51478 0.162
NP_442642.1_9 Reverse -330 -347 15.5751 0.114
NP_440016.1_9 Forward -352 -333 10.3242 0.262
NP_442396.1_5 Forward -177 -164 10.639 0.106
NP_441547.1_2 Forward -357 -339 6.11567 0.215
NP_442004.1_6 Reverse -337 -351 9.2427 0.14
NP_442004.1_6 Reverse -164 -178 5.30946 0.191
NP_441725.1_4 Forward -351 -337 12.6836 0.0693
NP_441725.1_5 Forward -172 -162 11.7798 0.0247
NP_441725.1_5 Forward -345 -335 9.02648 0.0553
NP_441725.1_5 Reverse -338 -348 2.04498 0.115
NP_441725.1_5 Reverse -165 -175 2.04498 0.115
NP_439966.1_7 Reverse -335 -345 17.4824 0.00636
NP_439966.1_7 Forward -348 -338 15.3192 0.0152
NP_439966.1_7 Forward -175 -165 7.25606 0.15
NP_439966.1_9 Reverse -335 -344 10.7178 0.0863
NP_442941.1_3 Reverse -338 -348 19.2529 0.00262
NP_442941.1_3 Reverse -165 -175 11.0914 0.0116
NP_442941.1_3 Forward -345 -335 2.53664 0.14
NP_442941.1_3 Forward -172 -162 2.53664 0.14
NP_440289.1_2 Reverse -334 -347 19.6855 0.00426
NP_440289.1_2 Reverse -161 -174 4.44418 0.0668
NP_440289.1_2 Forward -176 -163 -2.144 0.251
NP_440289.1_2 Forward -349 -336 -3.61896 0.267
NP_440983.1_5 Reverse -322 -341 -1.08219 0.228
NP_440983.1_5 Reverse -337 -356 -5.9004 0.273
NP_440983.1_9 Forward -355 -336 8.94757 0.206
NP_441076.1_3 Forward -240 -221 17.0099 0.148
NP_440260.1_8 Forward -182 -164 4.24738 0.154
NP_440260.1_8 Forward -355 -337 -4.70074 0.273
NP_442281.1_1 Reverse -332 -346 18.3868 0.00441
NP_442281.1_1 Forward -351 -337 15.2402 0.0132
NP_442281.1_1 Reverse -159 -173 12.782 0.034
NP_442281.1_1 Forward -178 -164 10.3237 0.0595
NP_442281.1_1 Reverse -345 -359 4.62054 0.187
NP_441334.1_7 Reverse -335 -354 -19.2734 0.275
NP_441079.1_3 Forward -133 -114 12.3892 0.215
NP_442575.1_8 Reverse -145 -164 1.86774 0.196
NP_442256.1_2 Reverse -162 -180 -6.37237 0.214
NP_442256.1_2 Forward -175 -157 -7.15901 0.214
NP_442256.1_2 Forward -348 -330 -7.65067 0.214
NP_442012.1_1 Forward -179 -160 20.1573 0.0318
NP_440723.1_8 Reverse -150 -164 19.4691 0.117
NP_441556.1_4 Reverse -325 -344 14.5362 0.165
NP_441556.1_10 Forward -351 -337 13.2393 0.182
NP_440498.1_1 Reverse -155 -173 5.52568 0.102
NP_440375.1_8 Reverse -165 -184 -0.39387 0.266
NP_441644.1_6 Reverse -337 -347 17.3841 0.00127
NP_441644.1_6 Reverse -164 -174 17.3841 0.00127
NP_441644.1_6 Forward -173 -163 15.7125 0.0048
NP_441644.1_6 Forward -346 -336 10.1076 0.0628
NP_441644.1_6 Forward -373 -363 4.99446 0.216
NP_441644.1_6 Reverse -350 -360 4.89613 0.22
NP_440867.1_10 Reverse -149 -168 2.65439 0.283
NP_442215.1_2 Forward -175 -159 10.1866 0.0509
NP_442215.1_2 Reverse -135 -151 5.76173 0.0769
NP_442215.1_2 Forward -168 -152 4.87675 0.0815
NP_442215.1_2 Reverse -162 -178 4.18844 0.0866
NP_442215.1_2 Reverse -335 -351 3.89344 0.0903
NP_442215.1_2 Forward -361 -345 -0.43312 0.167
NP_442215.1_2 Forward -40 -24 -2.98973 0.207
NP_442215.1_2 Forward -244 -228 -7.31629 0.291
NP_440253.1_2 Forward -346 -328 10.1472 0.0415
NP_440253.1_2 Reverse -164 -182 -1.84914 0.252
NP_440929.1_8 Forward -346 -337 19.2726 0.000701
NP_440929.1_8 Reverse -337 -346 19.2726 0.000701
NP_440929.1_8 Forward -173 -164 19.2726 0.000701
NP_440929.1_8 Reverse -164 -173 19.2726 0.000701
NP_442933.1_10 Forward -346 -337 17.601 0.00325
NP_442933.1_10 Reverse -337 -346 17.601 0.00325
NP_442933.1_10 Forward -173 -164 17.601 0.00325
NP_442933.1_10 Reverse -164 -173 17.601 0.00325
NP_440576.1_9 Forward -59 -40 20.2548 0.128
NP_441751.2_8 Reverse -338 -352 14.9459 0.0119
NP_441751.2_8 Reverse -165 -179 8.65272 0.0325
NP_441751.2_8 Forward -345 -331 -3.83532 0.156
NP_442926.1_1 Forward -358 -339 -4.6221 0.278
NP_442554.1_8 Reverse -338 -348 16.2046 0.0065
NP_442554.1_8 Forward -345 -335 16.008 0.0065
NP_442554.1_8 Reverse -165 -175 15.3197 0.00882
NP_442554.1_8 Forward -172 -162 14.238 0.0144
NP_442554.1_8 Forward -358 -348 4.0116 0.2
NP_442554.1_8 Reverse -145 -155 3.22496 0.235
NP_441762.1_7 Forward -347 -335 12.4287 0.0142
NP_441762.1_7 Reverse -163 -175 8.9871 0.0142
NP_441762.1_7 Reverse -336 -348 2.39892 0.0676
NP_441762.1_7 Forward -174 -162 0.333971 0.0747
NP_442142.1_4 Forward -349 -336 16.0466 0.0264
NP_442142.1_4 Reverse -334 -347 13.8833 0.0324
NP_442142.1_4 Reverse -340 -353 8.86849 0.106
NP_442142.1_4 Forward -176 -163 5.52525 0.188
NP_442142.1_4 Reverse -262 -275 3.06699 0.268
NP_442142.1_4 Forward -156 -143 2.96866 0.269
NP_442142.1_4 Reverse -161 -174 2.772 0.278
NP_442292.1_1 Reverse -338 -347 18.486 0.00229
NP_442292.1_1 Reverse -165 -174 18.486 0.00229
NP_442292.1_1 Forward -345 -336 9.63616 0.0183
NP_442292.1_1 Forward -172 -163 9.53783 0.0183
NP_440039.1_9 Reverse -326 -345 11.2092 0.284
NP_440254.1_1 Reverse -253 -272 12.9791 0.0772
NP_442476.1_6 Reverse -338 -352 0.687908 0.247
NP_440895.1_6 Forward -352 -339 17.6205 0.0643
NP_442381.1_8 Reverse -334 -353 3.93269 0.0708
NP_441711.1_4 Reverse -328 -347 8.55425 0.144
NP_443009.1_5 Forward -347 -336 18.3477 0.00265
NP_443009.1_5 Forward -174 -163 15.7911 0.0107
NP_443009.1_5 Reverse -163 -174 11.1696 0.066
NP_443009.1_5 Forward -65 -54 4.18809 0.259
NP_442408.2_1 Forward -173 -154 -2.85214 0.241
NP_441715.1_4 Reverse -338 -348 17.3846 0.0106
NP_441715.1_4 Forward -345 -335 9.32148 0.097
NP_441715.1_4 Reverse -165 -175 7.94484 0.107
NP_440357.1_3 Reverse -162 -181 0.196116 0.285
NP_440881.1_6 Reverse -302 -321 19.9606 0.0882
NP_440183.1_9 Reverse -146 -165 -17.0118 0.276
NP_441198.1_8 Reverse -162 -172 12.5877 0.12
NP_440379.1_5 Reverse -334 -353 -9.73531 0.264
NP_440464.1_10 Reverse -165 -175 13.0082 0.169
NP_441468.1_1 Forward -345 -338 15.8704 0.0124
NP_441468.1_1 Reverse -338 -345 15.8704 0.0124
NP_441468.1_1 Forward -172 -165 15.8704 0.0124
NP_441468.1_1 Reverse -165 -172 15.8704 0.0124
NP_442099.1_1 Reverse -338 -356 13.3922 0.274
NP_441020.2_6 Reverse -162 -179 11.1502 0.127
NP_441020.2_6 Forward -348 -331 10.1669 0.151
NP_441015.1_10 Forward -351 -332 -5.01543 0.215
NP_441015.1_10 Forward -152 -133 -7.67036 0.27
NP_441015.1_10 Reverse -338 -357 -9.44032 0.282
NP_441673.1_1 Forward -346 -337 20.8459 0.000698
NP_441673.1_1 Reverse -337 -346 20.8459 0.000698
NP_441673.1_1 Forward -173 -164 20.8459 0.000698
NP_441673.1_1 Reverse -164 -173 20.8459 0.000698
NP_441731.1_3 Forward -354 -335 -3.73712 0.284
NP_441731.1_3 Forward -367 -348 -6.29373 0.29
NP_441876.1_9 Reverse -136 -146 12.1726 0.267
NP_441826.1_2 Reverse -331 -345 10.9143 0.0428
NP_441826.1_2 Forward -352 -338 6.88276 0.0899
NP_441826.1_2 Reverse -158 -172 4.52282 0.102
NP_441826.1_2 Forward -179 -165 2.35953 0.129
NP_441826.1_2 Forward -159 -145 -3.93365 0.29
NP_441826.1_2 Reverse -344 -358 -4.7203 0.299
NP_441637.1_9 Forward -212 -194 -2.53746 0.292
NP_442868.1_6 Forward -348 -338 19.2529 0.00563
NP_442868.1_6 Forward -175 -165 9.81313 0.038
NP_442868.1_6 Reverse -162 -172 9.12481 0.0539
NP_442868.1_6 Reverse -335 -345 8.53483 0.0555
NP_441056.1_1 Reverse -337 -356 11.0125 0.0567
NP_441612.1_2 Reverse -337 -347 8.54929 0.21
NP_441612.1_2 Reverse -164 -174 8.54929 0.21
NP_443058.1_7 Forward -347 -328 8.55425 0.206
NP_442361.1_3 Reverse -331 -344 8.67241 0.285
NP_442808.1_1 Reverse -336 -346 18.4657 0.00201
NP_442808.1_1 Reverse -163 -173 8.73102 0.0481
NP_442808.1_1 Forward -347 -337 8.63269 0.0481
NP_442808.1_1 Forward -174 -164 8.63269 0.0481
NP_442808.1_1 Reverse -373 -383 2.43787 0.266
NP_441101.1_10 Forward -350 -331 3.44104 0.173
NP_440871.1_2 Forward -194 -175 13.1758 0.267
NP_440145.1_3 Forward -183 -164 7.57094 0.0466
NP_442542.1_2 Reverse -335 -348 19.0955 0.0177
NP_442050.1_1 Reverse -352 -371 6.68596 0.282
NP_442050.1_5 Forward -348 -338 14.3359 0.0206
NP_442050.1_5 Reverse -335 -345 8.23937 0.234
NP_442050.1_5 Forward -175 -165 7.64939 0.243
NP_442050.1_5 Reverse -162 -172 6.96107 0.27
NP_442342.1_9 Reverse -335 -351 2.02515 0.294
NP_440558.1_2 Forward -355 -336 -0.787193 0.204
NP_440558.1_2 Reverse -315 -334 -1.67217 0.217
NP_441048.1_4 Reverse -343 -362 8.06259 0.289
NP_442789.1_4 Forward -187 -168 -7.27704 0.292
NP_441518.1_3 Reverse -327 -346 -6.68705 0.142
NP_441878.1_6 Reverse -163 -173 20.2362 0.0046
NP_441878.1_6 Forward -347 -337 10.4031 0.0176
NP_441878.1_6 Reverse -336 -346 10.4031 0.0176
NP_441878.1_6 Forward -174 -164 10.4031 0.0176
NP_441878.1_6 Reverse -349 -359 1.65166 0.0795
NP_441878.1_6 Forward -154 -144 0.57002 0.14
NP_441878.1_6 Forward -353 -343 -0.0199663 0.163
NP_441878.1_6 Reverse -156 -166 -6.50981 0.191
NP_441036.1_8 Reverse -336 -346 17.7779 0.000554
NP_441036.1_8 Reverse -163 -173 8.4365 0.174
NP_441036.1_8 Forward -347 -337 8.33817 0.174
NP_441036.1_8 Forward -174 -164 8.33817 0.174
NP_442650.1_2 Reverse -337 -351 9.2427 0.13
NP_441557.1_5 Forward -346 -337 19.9609 0.000699
NP_441557.1_5 Reverse -337 -346 19.9609 0.000699
NP_441557.1_5 Forward -173 -164 19.9609 0.000699
NP_441557.1_5 Reverse -164 -173 19.9609 0.000699
NP_442356.1_1 Reverse -310 -329 8.25926 0.268
NP_441445.1_1 Reverse -155 -174 3.93269 0.204
NP_441445.1_1 Forward -220 -201 3.34271 0.215
NP_441445.1_1 Forward -182 -163 2.45773 0.233
NP_442066.2_4 Forward -346 -327 -2.36049 0.211
NP_442066.2_9 Reverse -333 -346 8.37742 0.185
NP_442419.1_2 Forward -351 -332 -0.885524 0.246
NP_441308.1_8 Reverse -335 -345 9.22315 0.226
NP_440101.1_3 Reverse -332 -351 2.94938 0.242
NP_441458.1_10 Forward -355 -336 13.3725 0.0856
NP_442183.1_1 Forward -346 -332 20.6491 0.00378
NP_442183.1_1 Reverse -337 -351 5.21113 0.226
NP_442166.1_3 Forward -144 -125 -11.1119 0.279
NP_442166.1_7 Forward -58 -44 12.8809 0.175
NP_442397.1_9 Reverse -337 -356 5.40766 0.246
NP_441574.1_1 Forward -346 -327 -1.27885 0.216
NP_442347.1_2 Reverse -338 -347 12.4878 0.056
NP_442347.1_2 Reverse -165 -174 12.4878 0.056
NP_442347.1_2 Forward -345 -336 11.1111 0.056
NP_442347.1_2 Forward -172 -163 3.34298 0.284
NP_442645.1_2 Forward -181 -162 -3.63879 0.0496
NP_442645.1_2 Forward -354 -335 -5.70374 0.0728
NP_442645.1_2 Reverse -335 -354 -8.752 0.133
NP_442645.1_2 Reverse -156 -175 -14.4552 0.175
NP_442888.1_9 Forward -346 -327 13.9625 0.233
NP_441037.1_4 Reverse -162 -172 17.3558 0.0127
NP_441037.1_4 Reverse -335 -345 16.2838 0.0168
NP_441037.1_4 Forward -175 -165 7.9999 0.237
NP_442594.1_7 Reverse -153 -172 3.73524 0.297
NP_442508.1_8 Reverse -43 -60 10.2653 0.272
NP_441633.1_3 Forward -348 -335 20.5705 0.00512
NP_441633.1_3 Forward -175 -162 10.639 0.0286
NP_441633.1_3 Forward -361 -348 3.75586 0.0699
NP_441633.1_3 Reverse -335 -348 -3.71729 0.177
NP_441633.1_3 Reverse -162 -175 -5.97891 0.236
NP_442764.1_8 Reverse -184 -203 6.19431 0.235
NP_440136.1_2 Forward -345 -338 15.9687 0.0123
NP_440136.1_2 Reverse -338 -345 15.9687 0.0123
NP_440136.1_2 Forward -172 -165 15.9687 0.0123
NP_440136.1_2 Reverse -165 -172 15.9687 0.0123
NP_442590.1_10 Reverse -337 -356 10.3242 0.183
NP_442590.1_10 Forward -173 -154 8.25926 0.212
NP_442590.1_10 Forward -71 -52 4.42435 0.276
NP_442590.1_10 Forward -365 -346 4.32602 0.276
NP_442590.1_10 Reverse -144 -163 3.93269 0.283
NP_442998.1_5 Forward -12 -2 12.3697 0.174
NP_442998.1_10 Forward -344 -337 15.5754 0.0102
NP_442998.1_10 Reverse -339 -346 15.5754 0.0102
NP_442998.1_10 Forward -171 -164 15.5754 0.0102
NP_442998.1_10 Reverse -166 -173 15.5754 0.0102
NP_440299.1_1 Forward -350 -337 20.2748 0.00128
NP_440299.1_1 Forward -177 -164 18.6032 0.00369
NP_440299.1_1 Reverse -333 -346 11.4251 0.0489
NP_440299.1_1 Reverse -160 -173 7.09854 0.121
NP_440299.1_1 Forward -157 -144 2.47701 0.288
NP_441799.1_1 Reverse -160 -174 18.2885 0.00852
NP_441799.1_1 Forward -177 -163 10.1271 0.0797
NP_441799.1_1 Forward -350 -336 9.14375 0.0988
NP_441007.1_10 Reverse -332 -345 3.16588 0.182
NP_441007.1_10 Forward -351 -338 1.29759 0.203
NP_441007.1_10 Reverse -159 -172 -0.275709 0.273
NP_441007.1_10 Forward -178 -165 -0.865694 0.295
NP_442334.1_2 Forward -129 -112 -7.63097 0.297
NP_442201.1_10 Reverse -153 -172 -5.50708 0.165
NP_442333.2_5 Reverse -339 -358 -14.0619 0.271
NP_440256.1_1 Forward -349 -330 15.9291 0.00634
NP_440256.1_1 Forward -176 -157 -9.047 0.273
NP_440087.1_1 Reverse -155 -174 -5.40875 0.249
NP_442007.1_8 Forward -174 -156 8.57317 0.297
NP_441559.1_8 Forward -351 -337 3.04785 0.143
NP_441559.1_8 Reverse -332 -346 -6.19526 0.275
NP_441559.1_8 Forward -363 -349 -6.68692 0.279
NP_441559.1_8 Reverse -139 -153 -7.57189 0.295
NP_441270.1_5 Reverse -295 -314 13.4822 0.214
NP_440915.1_6 Reverse -333 -347 15.9292 0.0183
NP_440915.1_6 Forward -350 -336 10.6193 0.0301
NP_440915.1_6 Forward -177 -163 8.75105 0.0507
NP_440915.1_6 Reverse -46 -60 -1.67204 0.243
NP_440915.1_6 Reverse -140 -154 -1.8687 0.251
NP_441179.1_9 Reverse -142 -152 16.3025 0.236
NP_440717.1_1 Forward -345 -326 14.2574 0.159
NP_442866.1_1 Forward -364 -345 -1.08219 0.202
NP_440748.1_5 Forward -343 -324 -1.47551 0.267
NP_441464.1_8 Forward -173 -159 9.73436 0.189
NP_441939.1_3 Reverse -338 -357 9.14423 0.153
NP_441939.1_3 Forward -345 -326 5.30933 0.28
NP_441199.1_6 Reverse -333 -352 0.687771 0.237
NP_441494.1_6 Forward -333 -320 6.31247 0.289
NP_439985.1_7 Reverse -158 -177 3.83436 0.26
NP_441417.1_5 Reverse -253 -272 10.0292 0.262
NP_442993.1_1 Reverse -113 -129 -0.629782 0.0783
NP_442993.1_1 Forward -173 -157 -7.11963 0.146
NP_440677.1_1 Reverse -328 -347 13.0775 0.135
NP_440677.1_6 Forward -368 -349 7.17762 0.298
NP_442386.1_9 Reverse -336 -345 15.7322 0.0144
NP_442386.1_9 Forward -347 -338 13.8639 0.0289
NP_442386.1_9 Forward -174 -165 13.8639 0.0289
NP_442386.1_9 Reverse -163 -172 6.39082 0.219
NP_440570.1_5 Forward -362 -343 1.76941 0.234
NP_441750.1_4 Forward -350 -331 0.786102 0.291
NP_441340.1_5 Forward -345 -338 15.6737 0.0124
NP_441340.1_5 Reverse -338 -345 15.6737 0.0124
NP_441340.1_5 Forward -172 -165 15.6737 0.0124
NP_441340.1_5 Reverse -165 -172 15.6737 0.0124
NP_441271.1_3 Forward -67 -49 14.768 0.143
NP_441947.1_3 Forward -98 -80 17.3254 0.172
NP_441947.1_10 Reverse -335 -353 2.77242 0.276
NP_442484.1_2 Forward -357 -338 11.2092 0.102
NP_440168.1_8 Reverse -331 -350 13.2741 0.153
NP_440168.1_9 Forward -348 -329 -5.80207 0.296
NP_442240.1_1 Forward -354 -335 11.0117 0.192
NP_440161.1_3 Forward -138 -119 10.8159 0.225
NP_440586.1_8 Forward -345 -338 13.2151 0.026
NP_440586.1_8 Forward -172 -165 13.2151 0.026
NP_440586.1_8 Reverse -338 -345 13.2151 0.026
NP_440586.1_8 Reverse -165 -172 13.2151 0.026
NP_440586.1_8 Forward -152 -145 5.8403 0.283
NP_440586.1_9 Forward -353 -334 8.94757 0.263
NP_442251.1_6 Forward -345 -338 15.2804 0.0124
NP_442251.1_6 Reverse -338 -345 15.2804 0.0124
NP_442251.1_6 Forward -172 -165 15.2804 0.0124
NP_442251.1_6 Reverse -165 -172 15.2804 0.0124
NP_440192.1_5 Reverse -300 -319 3.6377 0.271
NP_440684.1_9 Reverse -158 -172 9.14437 0.221
NP_440684.1_9 Forward -179 -165 6.98109 0.283
NP_441262.1_3 Reverse -337 -344 14.7888 0.0223
NP_441262.1_3 Reverse -164 -171 14.7888 0.0223
NP_441262.1_3 Forward -346 -339 14.7888 0.0223
NP_441262.1_3 Forward -173 -166 14.7888 0.0223
NP_440027.1_3 Forward -173 -155 4.63995 0.255
NP_440027.1_3 Reverse -343 -361 1.98502 0.295
NP_440027.1_8 Reverse -141 -160 5.2102 0.282
NP_443051.1_1 Reverse -163 -172 18.0926 0.00402
NP_443051.1_1 Reverse -336 -345 10.4228 0.00754
NP_443051.1_1 Forward -347 -338 10.4228 0.00754
NP_443051.1_1 Forward -174 -165 10.4228 0.00754
NP_439937.1_8 Reverse -335 -354 -0.39387 0.24
NP_439937.1_9 Forward -347 -330 -8.41828 0.176
NP_441595.1_5 Reverse -157 -175 8.27895 0.222
NP_440408.1_7 Reverse -337 -356 15.3391 0.165
NP_440408.1_7 Reverse -144 -163 14.4541 0.165
NP_440408.1_7 Forward -352 -333 8.16093 0.282
NP_440626.1_1 Forward -345 -326 9.43841 0.258
NP_440439.1_1 Forward -349 -336 9.16406 0.0465
NP_440439.1_1 Reverse -334 -347 2.47756 0.133
NP_440439.1_1 Forward -176 -163 2.2809 0.136
NP_440439.1_1 Forward -362 -349 -0.964025 0.244
NP_442239.1_8 Reverse -151 -170 6.58763 0.263
NP_442239.1_8 Reverse -343 -362 5.40766 0.276
NP_440372.1_2 Forward -345 -338 16.3621 0.0124
NP_440372.1_2 Reverse -338 -345 16.3621 0.0124
NP_440372.1_2 Forward -172 -165 16.3621 0.0124
NP_440372.1_2 Reverse -165 -172 16.3621 0.0124
NP_441181.1_6 Forward -345 -327 6.41066 0.219
NP_441181.1_6 Reverse -338 -356 4.05072 0.254
NP_440316.1_10 Forward -353 -343 15.418 0.168
NP_440316.1_10 Reverse -156 -166 6.46988 0.257
NP_441803.1_2 Forward -351 -332 12.1925 0.0634
NP_441803.1_2 Reverse -338 -357 3.14605 0.197
NP_441803.1_2 Forward -178 -159 1.47442 0.23
NP_441803.1_2 Reverse -171 -190 -0.295539 0.272
NP_439977.1_5 Forward -352 -333 5.50599 0.15
NP_439977.1_5 Reverse -331 -350 5.211 0.15
NP_440139.1_1 Reverse -158 -177 6.78348 0.139
NP_441572.1_7 Reverse -158 -177 -0.39387 0.18
NP_441572.1_7 Reverse -344 -363 -3.04881 0.206
NP_441572.1_7 Reverse -331 -350 -3.04881 0.206
NP_441572.1_7 Reverse -151 -170 -3.24547 0.208
NP_442384.1_10 Reverse -337 -350 20.8655 0.00194
NP_442384.1_10 Reverse -164 -177 16.4406 0.00838
NP_442384.1_10 Forward -173 -160 10.639 0.0428
NP_442384.1_10 Reverse -350 -363 10.1474 0.047
NP_442384.1_10 Reverse -144 -157 6.90245 0.092
NP_442384.1_10 Forward -346 -333 2.2809 0.23
NP_442035.1_6 Reverse -370 -389 8.65258 0.232
NP_442114.1_4 Forward -346 -335 12.1534 0.107
NP_440364.1_6 Forward -353 -340 13.785 0.275
NP_441877.1_7 Reverse -332 -351 9.14342 0.2
NP_441018.1_7 Reverse -333 -352 8.84924 0.239
NP_441018.1_7 Forward -356 -337 8.75091 0.241
NP_441018.1_7 Reverse -297 -316 6.19431 0.297
NP_442790.1_4 Forward -355 -336 1.57275 0.0795
NP_442790.1_4 Reverse -328 -347 -9.44032 0.184
NP_442262.1_10 Forward -345 -338 14.1988 0.0123
NP_442262.1_10 Reverse -338 -345 14.1988 0.0123
NP_442262.1_10 Forward -172 -165 14.1988 0.0123
NP_442262.1_10 Reverse -165 -172 14.1988 0.0123
NP_441689.1_5 Forward -348 -338 5.78111 0.197
NP_441689.1_5 Forward -175 -165 5.78111 0.197
NP_440163.1_10 Reverse -331 -341 9.81313 0.222
NP_440344.1_10 Reverse -330 -347 27.0799 0.000536
NP_440344.1_10 Forward -353 -336 -9.10594 0.139
NP_440531.1_6 Reverse -64 -83 0.392778 0.193
NP_440531.1_6 Reverse -156 -175 -3.73712 0.27
NP_440531.1_6 Reverse -329 -348 -4.03212 0.273
NP_442123.1_3 Forward -346 -327 10.4225 0.291
NP_442123.1_10 Reverse -295 -314 10.1275 0.275
NP_442910.1_1 Forward -180 -161 13.8641 0.0484
NP_440189.1_2 Forward -354 -335 3.14605 0.268
NP_440562.1_10 Forward -182 -164 6.41066 0.284
NP_441965.1_10 Reverse -334 -350 11.9566 0.107
NP_441965.1_10 Reverse -161 -177 3.40179 0.265
NP_440297.1_9 Forward -172 -162 9.61647 0.0917
NP_440297.1_9 Reverse -338 -348 -0.118297 0.282
NP_440297.1_9 Reverse -165 -175 -0.118297 0.282
NP_440297.1_9 Reverse -145 -155 -0.118297 0.282
NP_440297.1_9 Forward -345 -335 -0.216628 0.282
NP_441592.1_4 Reverse -164 -183 3.14605 0.185
NP_441592.1_4 Reverse -337 -356 0.786102 0.227
NP_440650.1_6 Forward -364 -345 7.07928 0.296
NP_440894.1_2 Forward -394 -375 -3.63879 0.296
NP_440894.1_10 Reverse -332 -351 5.50599 0.229
NP_440999.1_2 Forward -196 -177 14.8474 0.163
NP_440999.1_9 Reverse -333 -347 23.6974 0.0055
NP_440999.1_9 Forward -363 -349 3.93283 0.12
NP_440999.1_9 Forward -350 -336 1.08123 0.171
NP_440888.1_2 Forward -346 -332 18.2885 0.00261
NP_440888.1_2 Reverse -337 -351 16.0269 0.00832
NP_440888.1_2 Forward -328 -314 8.75042 0.149
NP_440888.1_2 Reverse -164 -178 7.27547 0.202
NP_440888.1_2 Reverse -56 -70 7.17714 0.205
NP_440600.1_4 Reverse -329 -347 -7.35568 0.291
NP_442147.1_7 Reverse -155 -174 11.3075 0.233
NP_440491.1_1 Reverse -334 -353 12.8619 0.139
NP_440052.1_4 Forward -75 -56 10.3242 0.239
NP_442033.1_10 Reverse -335 -354 -6.58872 0.186
NP_441949.1_4 Reverse -311 -330 4.42435 0.286
NP_442077.1_9 Reverse -235 -254 -6.58872 0.29
NP_441543.1_2 Forward -345 -336 18.486 0.00236
NP_441543.1_2 Reverse -338 -347 16.9127 0.00359
NP_441543.1_2 Reverse -165 -174 16.9127 0.00359
NP_441543.1_2 Forward -172 -163 9.34117 0.0818
NP_441543.1_5 Forward -164 -145 -2.26216 0.245
NP_442845.1_2 Forward -352 -338 9.43936 0.174
NP_442845.1_2 Reverse -337 -351 6.98109 0.199
NP_442845.1_2 Reverse -158 -172 5.40779 0.233
NP_442845.1_2 Forward -179 -165 4.91614 0.249
NP_441178.1_6 Reverse -141 -160 7.4718 0.26
NP_441178.1_6 Forward -168 -149 5.30853 0.268
NP_441918.1_7 Reverse -163 -182 0.786102 0.288
NP_441918.1_10 Forward -351 -333 12.7038 0.28
NP_440982.1_1 Forward -165 -146 5.50519 0.294
NP_441469.1_8 Reverse -336 -345 16.126 0.00797
NP_441469.1_8 Reverse -163 -172 13.3727 0.073
NP_441469.1_8 Forward -347 -338 6.48957 0.227
NP_441469.1_8 Forward -174 -165 6.48957 0.227
NP_443064.1_6 Forward -173 -163 13.8273 0.0796
NP_443064.1_6 Reverse -337 -347 12.5669 0.0796
NP_443064.1_6 Reverse -164 -174 12.5669 0.0796
NP_442337.1_8 Forward -390 -371 1.47442 0.238
NP_441306.1_10 Forward -57 -43 11.4053 0.263
NP_442578.1_7 Forward -345 -338 14.5921 0.026
NP_442578.1_7 Forward -172 -165 14.5921 0.026
NP_442578.1_7 Reverse -338 -345 14.5921 0.026
NP_442578.1_7 Reverse -165 -172 14.5921 0.026
NP_440710.1_1 Forward -181 -163 -9.32229 0.297
NP_441462.1_2 Forward -173 -163 20.1379 0.000967
NP_441462.1_2 Forward -346 -336 11.5831 0.00406
NP_441462.1_2 Reverse -337 -347 11.5831 0.00406
NP_441462.1_2 Reverse -164 -174 11.5831 0.00406
NP_441462.1_2 Forward -359 -349 -1.29827 0.299
NP_441621.1_7 Reverse -335 -349 6.58777 0.068
NP_441621.1_7 Forward -348 -334 -3.44199 0.188
NP_441621.1_7 Reverse -162 -176 -4.81863 0.246
NP_443062.1_1 Forward -346 -328 18.0041 0.023
NP_443062.1_1 Reverse -164 -182 4.54812 0.258
NP_443062.1_6 Forward -181 -162 9.43923 0.126
NP_443062.1_6 Forward -354 -335 2.26107 0.258
NP_441601.1_4 Reverse -140 -159 6.78429 0.162
NP_442204.1_1 Forward -350 -339 11.5634 0.0565
NP_442204.1_1 Forward -157 -146 2.81194 0.266
NP_442204.1_2 Forward -356 -337 10.5209 0.223
NP_442204.1_5 Reverse -327 -346 3.14605 0.196
NP_441560.1_8 Forward -351 -332 17.356 0.0478
NP_441560.1_10 Reverse -329 -348 8.45592 0.247
NP_441351.1_8 Reverse -335 -354 6.19431 0.202
NP_440516.1_8 Forward -346 -337 16.9127 0.00442
NP_440516.1_8 Reverse -337 -346 16.9127 0.00442
NP_440516.1_8 Forward -173 -164 16.9127 0.00442
NP_440516.1_8 Reverse -164 -173 16.9127 0.00442
NP_441785.1_1 Forward -346 -332 16.0349 0.113
NP_442428.1_5 Forward -345 -338 15.8704 0.0124
NP_442428.1_5 Reverse -338 -345 15.8704 0.0124
NP_442428.1_5 Forward -172 -165 15.8704 0.0124
NP_442428.1_5 Reverse -165 -172 15.8704 0.0124
NP_440818.1_1 Reverse -367 -386 -5.21209 0.295
NP_441267.1_1 Forward -179 -160 4.71934 0.227
NP_442120.1_10 Reverse -331 -350 -15.0452 0.289
NP_441867.1_2 Reverse -147 -166 -14.5535 0.288
NP_440603.1_9 Reverse -338 -357 5.89931 0.278
NP_440673.1_3 Forward -344 -337 12.4288 0.0426
NP_440673.1_3 Forward -171 -164 12.4288 0.0426
NP_440673.1_3 Reverse -339 -346 12.4288 0.0426
NP_440673.1_3 Reverse -166 -173 12.4288 0.0426
NP_440673.1_7 Reverse -326 -345 3.93269 0.193
NP_440865.1_9 Forward -352 -333 -8.45701 0.264
NP_441052.1_2 Reverse -337 -347 19.9412 0.00106
NP_441052.1_2 Reverse -164 -174 19.9412 0.00106
NP_441052.1_2 Forward -346 -336 10.5014 0.0285
NP_441052.1_2 Forward -173 -163 10.4031 0.0285
NP_441052.1_2 Forward -119 -109 -0.118297 0.266
NP_442219.1_8 Reverse -333 -352 6.62097 0.292
NP_442219.1_9 Reverse -338 -347 17.7976 0.00718
NP_442219.1_9 Reverse -165 -174 17.7976 0.00718
NP_442219.1_9 Forward -345 -336 8.35786 0.0681
NP_442219.1_9 Forward -172 -163 8.25953 0.0681
NP_440436.1_4 Forward -345 -336 18.1905 0.00233
NP_440436.1_4 Reverse -338 -347 17.2072 0.00233
NP_440436.1_4 Reverse -165 -174 17.2072 0.00233
NP_440436.1_4 Forward -172 -163 15.9289 0.00508
NP_441884.1_8 Forward -347 -328 -5.80207 0.196
NP_441884.1_9 Reverse -334 -353 -3.3438 0.0594
NP_441884.1_9 Forward -355 -336 -20.8467 0.211
NP_441884.1_9 Forward -349 -330 -23.6983 0.284
NP_441884.1_9 Reverse -161 -180 -24.8783 0.29
NP_442086.1_3 Reverse -165 -184 6.58763 0.285
NP_442864.1_2 Reverse -338 -357 14.6508 0.224
NP_442864.1_3 Reverse -103 -122 11.2092 0.181
NP_440314.1_9 Forward -172 -153 10.2259 0.0289
NP_441719.1_4 Forward -345 -338 16.3621 0.0124
NP_441719.1_4 Reverse -338 -345 16.3621 0.0124
NP_441719.1_4 Forward -172 -165 16.3621 0.0124
NP_441719.1_4 Reverse -165 -172 16.3621 0.0124
NP_441733.1_10 Reverse -334 -347 10.639 0.106
NP_441733.1_10 Forward -349 -336 7.39411 0.153
NP_441733.1_10 Forward -176 -163 5.62415 0.21
NP_441733.1_10 Reverse -52 -65 3.5592 0.295
NP_441004.1_1 Forward -159 -140 -5.50708 0.176
NP_441004.1_1 Reverse -344 -363 -8.26035 0.2
NP_441004.1_1 Forward -352 -333 -12.0953 0.244
NP_441004.1_1 Reverse -151 -170 -14.2585 0.265
NP_442366.1_3 Reverse -336 -354 7.39397 0.0747
NP_442366.1_3 Forward -154 -136 3.06741 0.117
NP_442366.1_3 Reverse -163 -181 1.78911 0.141
NP_442366.1_3 Forward -347 -329 0.314141 0.173
NP_442366.1_3 Forward -218 -200 0.117479 0.178
NP_442366.1_5 Reverse -161 -171 17.2858 0.0141
NP_442366.1_5 Forward -176 -166 14.0409 0.0497
NP_442366.1_5 Forward -67 -57 10.6976 0.245
NP_440129.1_10 Reverse -330 -344 13.8643 0.0534
NP_442873.1_3 Forward -354 -335 7.17681 0.219
NP_440296.1_6 Forward -298 -280 12.3204 0.295
NP_442206.1_4 Forward -172 -153 6.68596 0.259
NP_442206.1_10 Reverse -164 -179 6.27308 0.178
NP_442206.1_10 Forward -346 -331 2.33984 0.202
NP_442206.1_10 Reverse -350 -365 -0.216765 0.287
NP_440328.1_4 Reverse -158 -177 6.98095 0.126
NP_440328.1_4 Forward -179 -160 -1.18052 0.299
NP_443054.1_2 Forward -348 -334 19.7641 0.0121
NP_443054.1_2 Reverse -155 -169 2.16287 0.245
NP_443054.1_2 Reverse -341 -355 0.687908 0.256
NP_443054.1_2 Forward -175 -161 -0.590395 0.299
NP_442308.1_4 Forward -179 -160 2.16274 0.267
NP_442308.1_4 Forward -352 -333 0.294447 0.276
NP_441851.1_10 Reverse -163 -173 17.4829 0.0027
NP_441851.1_10 Reverse -336 -346 16.008 0.00552
NP_441851.1_10 Forward -347 -337 15.8113 0.00552
NP_441851.1_10 Forward -174 -164 15.8113 0.00552
NP_441851.1_10 Forward -65 -55 4.79825 0.247
NP_442622.1_8 Forward -173 -155 -18.8604 0.285
NP_442011.1_1 Forward -174 -155 10.4225 0.16
NP_442856.1_7 Forward -355 -336 5.211 0.131
NP_442856.1_7 Reverse -155 -174 1.27776 0.172
NP_441668.1_4 Reverse -19 -38 -2.45882 0.288
NP_442515.1_1 Forward -174 -160 12.6843 0.0333
NP_442515.1_1 Reverse -318 -332 -1.5737 0.257
NP_442515.1_1 Forward -347 -333 -2.36035 0.273
NP_442515.1_1 Reverse -201 -215 -3.83532 0.298
NP_442515.1_1 Reverse -163 -177 -5.01529 0.298
NP_441396.1_5 Forward -70 -61 9.24284 0.21
NP_440593.1_3 Reverse -332 -351 1.27776 0.19
NP_440593.1_3 Reverse -320 -339 -2.75381 0.228
NP_440593.1_9 Forward -349 -335 11.3077 0.24
NP_440165.1_5 Forward -347 -328 2.3594 0.112
NP_441046.1_2 Reverse -359 -378 -2.36049 0.299
NP_440940.1_7 Reverse -327 -345 3.36165 0.274
NP_441349.1_10 Reverse -154 -173 -1.08219 0.0988
NP_441349.1_10 Forward -183 -164 -5.70374 0.21
NP_441349.1_10 Forward -356 -337 -8.65367 0.278
NP_442314.1_4 Reverse -151 -169 8.57394 0.267
NP_440432.1_9 Forward -345 -330 0.569883 0.159
NP_442843.1_1 Reverse -145 -164 -10.9153 0.282
NP_439960.1_4 Forward -160 -141 17.6982 0.125
NP_439960.1_6 Reverse -337 -356 6.88262 0.3
NP_439960.1_10 Forward -353 -335 24.5036 0.0187
NP_440474.1_8 Forward -345 -331 9.43874 0.16
NP_441477.1_10 Reverse -343 -361 1.59244 0.256
NP_440431.1_7 Forward -394 -375 2.0644 0.215
NP_442450.1_5 Reverse -162 -172 17.3846 0.0267
NP_442450.1_5 Forward -175 -165 7.55152 0.13
NP_440588.1_2 Forward -355 -336 7.7676 0.048
NP_440588.1_2 Forward -182 -163 -0.197208 0.15
NP_440588.1_2 Reverse -155 -174 -5.9004 0.264
NP_440588.1_2 Forward -368 -349 -6.1954 0.273
NP_440588.1_2 Reverse -135 -154 -6.68705 0.289
NP_440195.1_5 Reverse -158 -177 2.55606 0.276
NP_442006.1_2 Reverse -155 -172 -16.7758 0.264
NP_441003.1_9 Reverse -141 -160 9.93088 0.213
NP_441003.1_9 Forward -361 -342 6.09597 0.254
NP_441570.1_1 Forward -346 -328 0.609134 0.0379
NP_441570.1_1 Reverse -337 -355 -8.53565 0.115
NP_441570.1_1 Reverse -164 -182 -8.83064 0.122
NP_441570.1_2 Reverse -358 -376 7.09898 0.267
NP_441078.1_4 Forward -346 -337 19.6659 0.0007
NP_441078.1_4 Reverse -337 -346 19.6659 0.0007
NP_441078.1_4 Forward -173 -164 19.6659 0.0007
NP_441078.1_4 Reverse -164 -173 19.6659 0.0007
NP_441078.1_4 Reverse -350 -359 -1.96689 0.282
NP_442729.1_5 Forward -154 -144 8.4365 0.248
NP_442729.1_8 Reverse -333 -346 8.47575 0.125
NP_441663.1_7 Forward -349 -330 5.40766 0.238
NP_442443.1_1 Reverse -149 -168 -6.1954 0.293
NP_441091.1_5 Reverse -333 -352 7.07928 0.204
NP_440526.1_3 Forward -345 -334 11.7595 0.0646
NP_440526.1_3 Reverse -338 -349 8.02298 0.126
NP_440526.1_3 Reverse -165 -176 8.02298 0.126
NP_440526.1_3 Forward -358 -347 1.6315 0.267
NP_440526.1_3 Forward -172 -161 1.6315 0.267
NP_441432.1_8 Forward -347 -338 16.8143 0.00595
NP_441432.1_8 Forward -174 -165 16.8143 0.00595
NP_441432.1_8 Reverse -163 -172 8.35786 0.0755
NP_441432.1_8 Reverse -336 -345 8.25953 0.0755
NP_442320.1_8 Reverse -331 -345 14.4542 0.0132
NP_442320.1_8 Forward -352 -338 -2.26202 0.0871
NP_442344.1_7 Forward -172 -153 4.32602 0.0638
NP_441732.1_2 Forward -350 -334 -6.33298 0.0495
NP_441732.1_2 Forward -177 -161 -7.51295 0.0859
NP_441732.1_2 Reverse -160 -176 -7.61128 0.0861
NP_441732.1_2 Reverse -333 -349 -15.1828 0.145
NP_441732.1_2 Reverse -172 -188 -16.7561 0.195
NP_440497.1_6 Forward -158 -139 1.27776 0.239
NP_440629.1_6 Forward -179 -160 14.75 0.162
NP_442003.1_4 Forward -172 -153 10.3242 0.288
NP_440760.1_1 Reverse -337 -356 1.37609 0.0249
NP_440760.1_1 Forward -173 -154 -20.2567 0.222
NP_442797.1_7 Forward -353 -335 2.57575 0.238
NP_442797.1_7 Reverse -49 -67 -1.45582 0.299
NP_440461.1_3 Reverse -156 -175 17.3057 0.145
NP_441945.1_10 Forward -160 -141 12.3892 0.216
NP_442353.1_4 Reverse -158 -177 1.86696 0.24
NP_440913.1_1 Forward -348 -330 3.65739 0.295
NP_442400.1_10 Reverse -196 -209 8.0831 0.279
NP_440713.1_4 Forward -356 -337 14.2574 0.0896
NP_442489.1_7 Forward -346 -337 20.1576 0.000695
NP_442489.1_7 Reverse -337 -346 20.1576 0.000695
NP_442489.1_7 Forward -173 -164 20.1576 0.000695
NP_442489.1_7 Reverse -164 -173 20.1576 0.000695
NP_442489.1_7 Reverse -350 -359 -1.47524 0.203
NP_440757.1_7 Reverse -48 -66 -0.275845 0.269
NP_440565.1_2 Forward -170 -156 15.4196 0.292
NP_442079.1_7 Forward -345 -326 -0.0988766 0.29
NP_440559.1_1 Reverse -338 -347 17.4043 0.00658
NP_440559.1_1 Reverse -165 -174 17.4043 0.00658
NP_440559.1_1 Forward -172 -163 17.306 0.00658
NP_440559.1_1 Forward -345 -336 8.75118 0.0586
NP_441659.2_8 Forward -173 -163 19.3512 0.000966
NP_441659.2_8 Reverse -337 -347 18.1713 0.00133
NP_441659.2_8 Reverse -164 -174 18.1713 0.00133
NP_441659.2_8 Forward -346 -336 11.9764 0.0147
NP_441659.2_8 Forward -166 -156 1.35667 0.242
NP_442913.1_10 Reverse -155 -174 16.9124 0.0136
NP_442913.1_10 Reverse -328 -347 2.0644 0.132
NP_442913.1_10 Reverse -355 -374 -4.22878 0.23
NP_442849.1_1 Forward -131 -117 16.8142 0.198
NP_442008.1_2 Reverse -161 -180 5.11266 0.228
NP_441800.1_3 Forward -351 -333 4.14905 0.289
NP_442776.1_6 Forward -121 -102 13.5691 0.138
NP_440779.1_5 Forward -346 -329 -5.76269 0.152
NP_442346.1_5 Reverse -163 -173 17.9746 0.00128
NP_442346.1_5 Forward -347 -337 16.6963 0.00248
NP_442346.1_5 Forward -174 -164 16.6963 0.00248
NP_442346.1_5 Forward -154 -144 14.1397 0.0164
NP_442346.1_5 Reverse -336 -346 9.02648 0.118
NP_440545.1_3 Forward -177 -160 6.52869 0.0551
NP_440545.1_3 Forward -350 -333 6.43035 0.0557
NP_440545.1_3 Reverse -160 -177 4.6604 0.0679
NP_440545.1_3 Reverse -333 -350 0.137172 0.144
NP_440545.1_3 Reverse -360 -377 -6.746 0.287
NP_440025.1_1 Forward -350 -331 11.2092 0.157
NP_440831.1_3 Forward -355 -336 9.68776 0.188
NP_440831.1_3 Reverse -155 -174 8.13453 0.233
NP_440831.1_3 Forward -176 -157 5.41637 0.28
NP_440486.1_6 Forward -359 -340 7.96426 0.253
NP_440459.1_2 Forward -361 -344 15.6735 0.11
NP_440459.1_2 Reverse -142 -159 14.1002 0.119
NP_440459.1_2 Forward -168 -151 7.61033 0.285
NP_441653.1_2 Reverse -326 -345 9.61754 0.146
NP_441653.1_2 Forward -357 -338 2.94981 0.28
NP_440010.1_4 Reverse -321 -340 1.76863 0.227
NP_440010.1_4 Reverse -327 -346 -2.26292 0.279
NP_440010.1_10 Reverse -152 -171 6.39097 0.226
NP_442603.1_7 Reverse -337 -351 10.717 0.125
NP_441888.1_7 Reverse -332 -346 12.0943 0.0743
NP_441888.1_7 Forward -351 -337 3.8345 0.225
NP_441502.1_3 Forward -348 -329 18.289 0.112
NP_441833.1_4 Forward -345 -338 15.9687 0.0124
NP_441833.1_4 Reverse -338 -345 15.9687 0.0124
NP_441833.1_4 Forward -172 -165 15.9687 0.0124
NP_441833.1_4 Reverse -165 -172 15.9687 0.0124
NP_441329.1_6 Forward -104 -85 2.24364 0.231
NP_442162.1_9 Forward -345 -338 16.2637 0.0124
NP_442162.1_9 Reverse -338 -345 16.2637 0.0124
NP_442162.1_9 Forward -172 -165 16.2637 0.0124
NP_442162.1_9 Reverse -165 -172 16.2637 0.0124
NP_440671.1_4 Forward -352 -338 12.586 0.105
NP_440772.1_8 Reverse -331 -350 8.75091 0.258
NP_442045.1_5 Forward -355 -336 -1.27885 0.29
NP_442140.1_3 Forward -345 -335 17.4829 0.0159
NP_442140.1_3 Forward -172 -162 13.5497 0.0542
NP_442140.1_3 Reverse -165 -175 12.2714 0.0632
NP_442140.1_3 Reverse -338 -348 10.3048 0.0902
NP_442140.1_3 Forward -152 -142 7.64985 0.133
NP_442140.1_4 Forward -385 -366 20.6481 0.0474
NP_440875.1_9 Forward -344 -334 17.619 0.0104
NP_440875.1_9 Reverse -339 -349 8.37203 0.233
NP_440875.1_9 Reverse -352 -362 7.496 0.262
NP_441813.1_5 Forward -348 -338 18.1713 0.00743
NP_441813.1_5 Reverse -335 -345 10.0098 0.0208
NP_441813.1_5 Reverse -162 -172 8.82982 0.0367
NP_441813.1_5 Forward -175 -165 8.63316 0.0367
NP_441227.1_3 Forward -66 -47 12.8808 0.0683
NP_440590.1_4 Forward -345 -332 14.6706 0.0106
NP_440590.1_4 Reverse -338 -351 12.8023 0.013
NP_440590.1_4 Forward -172 -159 1.29759 0.127
NP_440590.1_4 Reverse -165 -178 -5.97891 0.296
NP_440567.1_1 Forward -345 -331 15.5359 0.017
NP_440567.1_1 Reverse -165 -179 14.2576 0.0187
NP_440567.1_1 Forward -172 -158 7.07942 0.0779
NP_440567.1_1 Reverse -338 -352 6.88276 0.08
NP_442497.1_10 Forward -172 -163 19.8626 0.00532
NP_442497.1_10 Forward -345 -336 10.4228 0.0087
NP_442497.1_10 Reverse -338 -347 10.4228 0.0087
NP_442497.1_10 Reverse -165 -174 10.4228 0.0087
NP_440821.1_4 Reverse -335 -345 18.7612 0.00422
NP_440821.1_4 Reverse -162 -172 10.9931 0.0146
NP_440821.1_4 Forward -348 -338 9.41981 0.0286
NP_440821.1_4 Forward -175 -165 9.41981 0.0286
NP_441239.1_9 Reverse -335 -347 16.0669 0.0175
NP_441239.1_9 Reverse -162 -174 10.7571 0.0723
NP_441239.1_9 Forward -348 -336 7.80712 0.148
NP_441239.1_9 Reverse -142 -154 7.02048 0.173
NP_441239.1_9 Forward -175 -163 6.92215 0.173
NP_441239.1_9 Reverse -348 -360 5.54551 0.217
NP_441951.1_9 Reverse -248 -267 5.211 0.254
NP_441727.1_3 Reverse -330 -349 4.42435 0.262
NP_441892.1_1 Reverse -328 -345 8.39697 0.0804
NP_441892.1_1 Reverse -155 -172 5.84037 0.0995
NP_441892.1_1 Forward -162 -145 2.89044 0.133
NP_441892.1_1 Forward -355 -338 0.727158 0.163
NP_441892.1_1 Reverse -341 -358 -4.28772 0.258
NP_440665.1_1 Reverse -322 -341 -8.06369 0.237
NP_440604.1_6 Forward -346 -327 -2.85214 0.225
NP_440604.1_6 Reverse -164 -183 -4.03212 0.236
NP_442193.1_8 Reverse -334 -353 11.405 0.267
NP_440740.1_2 Reverse -302 -321 10.8159 0.258
NP_442270.1_9 Forward -357 -338 -5.70374 0.207
NP_442270.1_9 Reverse -153 -172 -11.0136 0.266
NP_440219.1_4 Forward -251 -238 18.256 0.157
NP_442643.1_3 Forward -159 -140 7.07928 0.0976
NP_440833.1_6 Reverse -239 -253 8.94708 0.267
NP_440354.1_5 Forward -176 -157 1.37609 0.279
NP_442052.1_8 Reverse -162 -172 12.7631 0.253
NP_440546.1_4 Forward -173 -163 12.8578 0.0572
NP_440546.1_4 Forward -346 -336 11.8882 0.0679
NP_440546.1_4 Reverse -337 -347 10.046 0.109
NP_440546.1_4 Reverse -164 -174 10.046 0.109
NP_440546.1_4 Forward -153 -143 9.27034 0.146
NP_440546.1_4 Reverse -50 -60 6.45857 0.296
NP_441230.1_5 Reverse -332 -351 5.60432 0.182
NP_440462.1_6 Reverse -335 -345 17.9746 0.00578
NP_440462.1_6 Forward -348 -338 9.61647 0.0429
NP_440462.1_6 Reverse -162 -172 1.455 0.294
NP_440462.1_6 Forward -175 -165 1.35667 0.294
NP_440868.1_4 Forward -177 -165 13.2153 0.022
NP_440868.1_4 Reverse -160 -172 8.79043 0.0582
NP_440868.1_4 Forward -350 -338 8.00379 0.0602
NP_440868.1_4 Reverse -333 -345 2.98891 0.142
NP_441582.1_5 Forward -175 -156 10.9134 0.154
NP_442402.1_4 Forward -127 -108 3.24359 0.153
NP_442402.1_4 Forward -270 -251 -1.57461 0.194
NP_442402.1_9 Reverse -153 -172 8.35759 0.291
NP_442258.1_2 Reverse -146 -165 6.09597 0.0613
NP_442258.1_2 Reverse -152 -171 -4.6221 0.27
NP_442460.1_7 Forward -358 -339 1.37609 0.249
NP_441843.2_9 Reverse -181 -199 12.7291 0.205
NP_442923.1_4 Forward -80 -61 0.392778 0.196
NP_442039.1_4 Forward -345 -338 15.1821 0.0124
NP_442039.1_4 Reverse -338 -345 15.1821 0.0124
NP_442039.1_4 Forward -172 -165 15.1821 0.0124
NP_442039.1_4 Reverse -165 -172 15.1821 0.0124
NP_442039.1_7 Forward -99 -89 6.96153 0.286
NP_440008.1_9 Forward -352 -333 20.7473 0.0373
NP_440825.1_7 Reverse -165 -175 12.9096 0.152
NP_440825.1_7 Forward -172 -162 11.8361 0.2
NP_442837.1_3 Forward -345 -338 15.7721 0.0124
NP_442837.1_3 Reverse -338 -345 15.7721 0.0124
NP_442837.1_3 Forward -172 -165 15.7721 0.0124
NP_442837.1_3 Reverse -165 -172 15.7721 0.0124
NP_439994.1_3 Reverse -336 -355 10.3896 0.221
NP_442053.1_1 Forward -346 -337 18.3876 0.0007
NP_442053.1_1 Reverse -337 -346 18.3876 0.0007
NP_442053.1_1 Forward -173 -164 18.3876 0.0007
NP_442053.1_1 Reverse -164 -173 18.3876 0.0007
NP_440505.1_3 Forward -348 -338 18.3679 0.00213
NP_440505.1_3 Reverse -335 -345 14.1397 0.0235
NP_440505.1_3 Forward -175 -165 9.22315 0.122
NP_440505.1_7 Reverse -157 -176 11.3075 0.146
NP_440505.1_7 Forward -191 -172 -2.95047 0.298
NP_440207.2_8 Reverse -338 -357 17.7974 0.258
NP_441203.1_1 Reverse -338 -357 -20.3551 0.297
NP_442532.1_7 Forward -346 -332 6.88276 0.171
NP_441408.2_7 Reverse -335 -354 9.83255 0.0989
NP_440914.1_1 Reverse -337 -347 17.5935 0.000537
NP_440914.1_1 Reverse -164 -174 17.5935 0.000537
NP_440914.1_1 Forward -346 -336 8.6151 0.186
NP_440914.1_1 Forward -173 -163 8.51751 0.186
NP_441011.1_8 Forward -345 -336 16.9127 0.00602
NP_441011.1_8 Forward -172 -163 14.356 0.0249
NP_441011.1_8 Reverse -338 -347 8.25953 0.144
NP_441011.1_8 Reverse -165 -174 8.25953 0.144
NP_442533.1_6 Forward -346 -337 17.2076 0.00137
NP_442533.1_6 Reverse -337 -346 17.2076 0.00137
NP_442533.1_6 Forward -173 -164 17.2076 0.00137
NP_442533.1_6 Reverse -164 -173 17.2076 0.00137
NP_442533.1_6 Reverse -350 -359 10.7178 0.0523
NP_442533.1_6 Forward -153 -144 4.62128 0.179
NP_442533.1_6 Reverse -343 -352 4.0313 0.194
NP_442533.1_6 Forward -159 -150 1.57302 0.294
NP_442232.1_3 Forward -354 -335 -6.98204 0.194
NP_442232.1_3 Forward -376 -357 -15.7335 0.296
NP_442322.1_4 Forward -167 -150 -8.8116 0.286
NP_442229.1_1 Forward -175 -161 7.47213 0.196
NP_443016.1_1 Forward -179 -160 16.6174 0.0218
NP_441482.1_7 Forward -352 -338 8.84938 0.0162
NP_441482.1_7 Reverse -331 -345 -10.2268 0.209
NP_441482.1_7 Forward -179 -165 -10.7185 0.213
NP_439944.1_9 Reverse -338 -348 10.5014 0.0887
NP_439944.1_9 Reverse -165 -175 10.5014 0.0887
NP_439944.1_9 Forward -345 -335 10.4031 0.0887
NP_439944.1_9 Forward -172 -162 8.82982 0.101
NP_441028.1_6 Reverse -87 -97 4.7978 0.277
NP_441028.1_6 Reverse -180 -190 4.10949 0.278
NP_440116.1_5 Reverse -161 -178 2.89044 0.252
NP_440116.1_8 Forward -172 -153 2.75272 0.0854
NP_440116.1_8 Forward -345 -326 -9.73531 0.287
NP_440115.1_6 Forward -349 -339 16.008 0.0325
NP_440115.1_6 Forward -176 -166 9.32148 0.115
NP_440115.1_6 Reverse -161 -171 8.63316 0.128
NP_439965.1_1 Forward -355 -336 3.34271 0.0999
NP_441680.1_4 Reverse -142 -161 2.85105 0.224
NP_441347.1_5 Forward -352 -338 9.04542 0.278
NP_441059.1_2 Forward -196 -177 -6.88371 0.268
NP_443045.1_9 Forward -166 -148 9.55647 0.239
NP_441602.1_3 Forward -351 -332 15.2408 0.0525
NP_441602.1_3 Forward -364 -345 -3.14714 0.241
NP_441972.1_5 Forward -345 -326 -3.14714 0.197
NP_441106.1_1 Reverse -336 -345 18.191 0.0028
NP_441106.1_1 Reverse -163 -172 9.73449 0.0311
NP_441106.1_1 Forward -347 -338 9.63616 0.0311
NP_441106.1_1 Forward -174 -165 9.63616 0.0311
NP_441420.1_1 Forward -174 -155 -2.75381 0.288
NP_440429.1_2 Forward -351 -332 9.24257 0.272
NP_440429.1_4 Reverse -157 -176 14.5524 0.25
NP_439903.1_6 Reverse -334 -353 5.40686 0.183
NP_441286.1_1 Forward -174 -162 15.4769 0.00418
NP_441286.1_1 Forward -347 -335 14.7886 0.00418
NP_441286.1_1 Reverse -163 -175 3.48056 0.0467
NP_441286.1_1 Reverse -336 -348 3.38223 0.0467
NP_440670.1_8 Forward -346 -337 18.3876 0.000699
NP_440670.1_8 Reverse -337 -346 18.3876 0.000699
NP_440670.1_8 Forward -173 -164 18.3876 0.000699
NP_440670.1_8 Reverse -164 -173 18.3876 0.000699
NP_441930.1_2 Reverse -156 -166 14.828 0.19
NP_440886.1_7 Reverse -336 -346 17.7774 0.0011
NP_440886.1_7 Reverse -163 -173 8.04271 0.0805
NP_440886.1_7 Forward -347 -337 7.94438 0.0805
NP_440886.1_7 Forward -174 -164 7.94438 0.0805
NP_440886.1_7 Reverse -140 -150 7.15773 0.103
NP_440886.1_7 Forward -167 -157 5.38779 0.185
NP_442614.1_2 Reverse -337 -351 8.06273 0.255
NP_442614.1_2 Forward -173 -159 7.17775 0.275
NP_442614.1_2 Reverse -164 -178 7.07942 0.275
NP_439995.1_5 Reverse -327 -346 6.09597 0.276
NP_442072.1_9 Reverse -163 -181 -10.9939 0.0789
NP_442072.1_9 Forward -347 -329 -13.3539 0.11
NP_442072.1_9 Reverse -156 -174 -22.6953 0.253
NP_442072.1_9 Forward -360 -342 -23.2853 0.288
NP_442401.1_2 Forward -174 -155 7.96345 0.254
NP_441753.1_10 Reverse -328 -347 4.42435 0.198
NP_442022.1_4 Reverse -301 -320 17.6007 0.133
NP_440907.2_8 Forward -345 -335 17.4824 0.00685
NP_440907.2_8 Forward -172 -162 16.2041 0.0161
NP_440907.2_8 Reverse -165 -175 7.64939 0.117
NP_440907.2_8 Forward -63 -53 4.10949 0.278
NP_441021.1_1 Reverse -338 -357 5.70265 0.0704
NP_441021.1_1 Forward -345 -326 -8.752 0.2
NP_441021.1_1 Reverse -165 -184 -9.44032 0.216
NP_441463.1_3 Reverse -327 -346 16.1257 0.0178
NP_441463.1_3 Forward -183 -164 -1.96717 0.147
NP_441463.1_6 Reverse -317 -331 5.93276 0.287
NP_441626.1_2 Forward -345 -338 15.7721 0.0124
NP_441626.1_2 Reverse -338 -345 15.7721 0.0124
NP_441626.1_2 Forward -172 -165 15.7721 0.0124
NP_441626.1_2 Reverse -165 -172 15.7721 0.0124
NP_441626.1_6 Reverse -333 -351 10.2448 0.207
NP_442365.1_7 Forward -350 -331 7.37428 0.0969
NP_442362.1_7 Reverse -153 -171 14.2771 0.22
NP_440107.1_5 Forward -66 -47 1.0811 0.178
NP_440107.1_5 Forward -353 -334 -0.295539 0.178
NP_440107.1_5 Reverse -336 -355 -0.4922 0.178
NP_442794.1_1 Forward -350 -338 20.0002 0.00523
NP_442794.1_1 Forward -177 -165 12.232 0.0721
NP_442615.1_1 Forward -182 -164 9.36059 0.0254
NP_442615.1_1 Reverse -155 -173 5.52568 0.0379
NP_442615.1_1 Reverse -41 -59 -7.45401 0.291
NP_441962.1_4 Forward -351 -332 18.3873 0.0137
NP_441962.1_4 Reverse -338 -357 -11.1119 0.238
NP_441962.1_4 Reverse -345 -364 -12.1936 0.253
NP_441962.1_4 Reverse -332 -351 -13.1769 0.271
NP_441962.1_9 Reverse -344 -363 8.84924 0.258
NP_441742.1_7 Forward -362 -343 21.1406 0.2
NP_440387.1_1 Reverse -164 -180 21.593 0.00219
NP_440387.1_1 Forward -346 -330 8.41667 0.0282
NP_440387.1_1 Reverse -337 -353 5.6634 0.0311
NP_440387.1_1 Forward -173 -157 -0.138127 0.135
NP_441431.1_2 Reverse -161 -175 14.6503 0.061
NP_441431.1_2 Forward -62 -48 10.5204 0.159
NP_441431.1_2 Reverse -334 -348 8.84875 0.204
NP_441431.1_2 Forward -176 -162 8.55376 0.211
NP_441431.1_2 Forward -349 -335 7.57046 0.238
NP_441488.1_2 Forward -185 -166 19.0757 0.0685
NP_441488.1_7 Forward -352 -333 5.40766 0.157
NP_441488.1_8 Forward -351 -337 10.0287 0.146
NP_441836.1_1 Forward -357 -338 11.7915 0.29
NP_441836.1_2 Reverse -331 -350 0.392778 0.202
NP_441836.1_2 Reverse -138 -157 -1.7705 0.223
NP_441993.1_1 Forward -352 -333 8.47633 0.146
NP_441993.1_1 Reverse -158 -177 4.38312 0.221
NP_441993.1_1 Reverse -337 -356 4.18821 0.223
NP_441993.1_1 Forward -346 -327 2.23906 0.261
NP_441993.1_1 Forward -159 -140 0.874656 0.29
NP_441993.1_7 Reverse -165 -179 18.0925 0.247
NP_441174.1_2 Forward -349 -335 17.6008 0.0437
NP_440114.1_10 Forward -173 -159 15.5359 0.0249
NP_440114.1_10 Forward -346 -332 6.58777 0.263
NP_442437.1_8 Reverse -326 -345 6.58763 0.242
NP_440293.1_3 Reverse -148 -167 1.67108 0.207
NP_440293.1_3 Forward -354 -335 -2.0655 0.239
NP_440766.1_4 Forward -350 -336 8.75105 0.0871
NP_440766.1_4 Reverse -333 -347 8.45605 0.0871
NP_439988.1_7 Reverse -336 -350 11.7987 0.292
NP_440422.1_10 Forward -214 -195 8.17758 0.212
NP_441237.1_9 Forward -172 -162 17.188 0.00445
NP_441237.1_9 Reverse -165 -175 14.828 0.0242
NP_442743.1_5 Reverse -338 -357 9.24257 0.148
NP_440457.1_1 Forward -350 -338 7.61046 0.101
NP_440457.1_1 Reverse -333 -345 5.34885 0.141
NP_440457.1_1 Reverse -153 -165 4.16888 0.171
NP_440457.1_1 Reverse -160 -172 2.98891 0.204
NP_440457.1_1 Forward -177 -165 2.10393 0.217
NP_440457.1_1 Reverse -51 -63 1.51394 0.236
NP_440213.1_4 Reverse -297 -316 17.7819 0.217
NP_440798.1_6 Forward -172 -159 23.2254 0.00412
NP_440798.1_6 Reverse -165 -178 3.26421 0.151
NP_441801.1_4 Reverse -367 -377 2.7333 0.262
NP_440801.1_10 Forward -157 -138 3.93269 0.297
NP_440142.1_7 Reverse -365 -384 10.2259 0.203
NP_440473.1_1 Forward -176 -157 16.4634 0.106
NP_440473.1_9 Reverse -153 -172 -4.13045 0.177
NP_440473.1_9 Reverse -326 -345 -7.76869 0.238
NP_442509.1_9 Forward -173 -163 17.3841 0.00128
NP_442509.1_9 Forward -346 -336 16.2041 0.00739
NP_442509.1_9 Reverse -337 -347 8.14104 0.192
NP_442509.1_9 Reverse -164 -174 8.14104 0.192
NP_441253.1_8 Forward -178 -164 16.7557 0.119
NP_442514.1_5 Forward -167 -148 -9.14605 0.294
NP_440554.1_4 Forward -345 -335 13.943 0.0218
NP_440554.1_4 Reverse -338 -348 8.92815 0.0646
NP_441885.1_5 Reverse -337 -347 20.9245 0.000538
NP_441885.1_5 Reverse -164 -174 20.9245 0.000538
NP_441885.1_5 Forward -346 -336 11.4848 0.00668
NP_441885.1_5 Forward -173 -163 11.3864 0.00668
NP_440478.1_10 Reverse -335 -349 17.3058 0.107
NP_442310.1_1 Forward -354 -335 12.5858 0.234
NP_442341.1_7 Forward -347 -333 22.0257 0.00401
NP_442341.1_7 Reverse -336 -350 9.2427 0.0751
NP_442341.1_7 Forward -174 -160 6.6861 0.12
NP_442341.1_7 Forward -360 -346 5.89945 0.142
NP_442341.1_7 Reverse -163 -177 4.12949 0.2
NP_442341.1_9 Reverse -162 -176 10.8154 0.133
NP_442341.1_9 Forward -175 -161 8.3571 0.171
NP_441756.1_5 Reverse -333 -352 11.1109 0.116
NP_441173.1_9 Forward -199 -191 10.9338 0.242
NP_442395.2_4 Reverse -336 -355 11.5033 0.0907
NP_442395.2_4 Forward -347 -328 -0.39464 0.291
NP_440423.1_6 Reverse -329 -348 -14.0619 0.224
NP_443000.1_7 Forward -348 -338 19.9412 0.00223
NP_443000.1_7 Forward -175 -165 10.3048 0.0345
NP_443000.1_7 Reverse -335 -345 2.04498 0.226
NP_443000.1_7 Reverse -162 -172 2.04498 0.226
NP_440507.2_3 Reverse -328 -347 11.7 0.173
NP_441842.1_10 Reverse -330 -344 19.7641 0.0142
NP_441842.1_10 Reverse -157 -171 6.09611 0.299
NP_440275.1_3 Reverse -335 -345 17.9746 0.0082
NP_440275.1_3 Forward -348 -338 15.123 0.0182
NP_440275.1_3 Reverse -162 -172 9.91146 0.046
NP_440275.1_3 Forward -175 -165 8.04317 0.0602
NP_442932.1_9 Reverse -158 -177 5.211 0.268
NP_440091.1_1 Reverse -333 -345 12.6253 0.0353
NP_440091.1_1 Forward -177 -165 1.41561 0.197
NP_441307.1_6 Reverse -337 -356 8.35759 0.217
NP_443046.1_9 Reverse -251 -269 8.17984 0.168
NP_440679.1_10 Reverse -352 -371 -14.4552 0.234
NP_441359.1_5 Forward -362 -343 7.27595 0.186
NP_442451.1_2 Forward -354 -335 7.86593 0.101
NP_442451.1_2 Reverse -311 -330 -9.34199 0.259
NP_441635.1_1 Forward -241 -222 8.92807 0.236
NP_441122.1_1 Forward -177 -162 4.89645 0.28
NP_439962.1_4 Forward -354 -335 8.75091 0.134
NP_439962.1_4 Reverse -149 -168 -8.55534 0.296
NP_440175.1_4 Reverse -335 -354 -10.1286 0.171
NP_442495.1_4 Reverse -148 -158 14.1397 0.173
NP_440149.1_8 Reverse -337 -356 8.75091 0.0586
NP_440149.1_8 Reverse -319 -338 -1.37718 0.159
NP_441105.1_3 Forward -357 -338 2.55606 0.102
NP_441105.1_3 Reverse -133 -152 -0.885524 0.143
NP_441105.1_3 Forward -164 -145 -1.27885 0.147
NP_441105.1_3 Reverse -326 -345 -4.72043 0.204
NP_441105.1_3 Reverse -314 -333 -7.96535 0.263
NP_442373.1_2 Reverse -148 -167 2.16274 0.162
NP_440216.1_1 Forward -173 -159 16.5192 0.00277
NP_440216.1_1 Reverse -337 -351 -0.590395 0.0284
NP_440216.1_1 Reverse -164 -178 -1.18038 0.0301
NP_440216.1_1 Forward -346 -332 -1.5737 0.034
NP_440216.1_6 Reverse -330 -346 4.68009 0.189
NP_440216.1_9 Forward -254 -245 14.0611 0.184
NP_440216.1_9 Reverse -372 -381 11.4061 0.267
NP_440172.1_1 Forward -173 -163 16.303 0.00854
NP_440172.1_1 Reverse -337 -347 15.0247 0.00945
NP_440172.1_1 Reverse -164 -174 15.0247 0.00945
NP_440172.1_1 Forward -346 -336 8.73149 0.0586
NP_442015.1_10 Forward -350 -337 21.1604 0.00329
NP_442015.1_10 Reverse -160 -173 11.4257 0.0372
NP_442015.1_10 Forward -177 -164 10.1474 0.0402
NP_442015.1_10 Reverse -333 -346 3.95252 0.178
NP_442329.1_8 Forward -165 -146 9.53756 0.17
NP_441226.1_7 Forward -345 -338 14.4934 0.0123
NP_441226.1_7 Reverse -338 -345 14.4934 0.0123
NP_441226.1_7 Forward -172 -165 14.4934 0.0123
NP_441226.1_7 Reverse -165 -172 14.4934 0.0123
NP_441757.1_3 Forward -174 -155 2.0644 0.159
NP_441111.1_7 Forward -345 -337 18.7023 0.00294
NP_441111.1_7 Forward -172 -164 18.7023 0.00294
NP_441111.1_7 Reverse -338 -346 18.7023 0.00294
NP_441111.1_7 Reverse -165 -173 18.7023 0.00294
NP_442379.1_10 Forward -180 -163 17.8367 0.0226
NP_441766.1_2 Forward -346 -337 17.5026 0.00297
NP_441766.1_2 Reverse -337 -346 17.5026 0.00297
NP_441766.1_2 Forward -173 -164 17.5026 0.00297
NP_441766.1_2 Reverse -164 -173 17.5026 0.00297
NP_442252.1_3 Reverse -330 -348 8.7706 0.248
NP_440416.1_9 Forward -180 -161 2.26107 0.0409
NP_440416.1_9 Reverse -330 -349 -3.24547 0.0741
NP_440416.1_9 Forward -353 -334 -7.4737 0.102
NP_440416.1_9 Forward -354 -335 -8.94866 0.123
NP_440416.1_9 Forward -160 -141 -11.8986 0.155
NP_440416.1_9 Reverse -137 -156 -15.0452 0.184
NP_440416.1_9 Reverse -342 -361 -15.3402 0.189
NP_443052.1_8 Reverse -154 -173 -0.197208 0.0684
NP_443052.1_8 Reverse -327 -346 -8.35868 0.173
NP_442403.1_8 Forward -344 -325 -1.08219 0.256
NP_440591.1_9 Forward -353 -335 12.6055 0.0935
NP_442154.1_1 Reverse -302 -320 -15.5171 0.22
NP_442154.1_1 Forward -345 -327 -15.9105 0.228
NP_441430.1_6 Reverse -332 -351 15.3391 0.145
NP_440261.1_5 Forward -172 -159 7.09911 0.0316
NP_440261.1_5 Reverse -338 -351 -2.63565 0.0924
NP_440261.1_5 Reverse -145 -158 -4.60227 0.158
NP_440261.1_5 Forward -345 -332 -10.5021 0.201
NP_440261.1_5 Reverse -165 -178 -10.5021 0.201
NP_440988.1_10 Reverse -335 -349 5.67333 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCTTGGACAATTCTCTGTCTTTCCTGGGCCGTTACATCCCGGTCATCGGCCCTGGCGATCGCCGCTGTGAGGGTCATTTCCATCAGTACCACACCGGCCAGAAAATAGCTAATTTGTTTGATGGTATCCATTGTGGTTAGTTTCTCCAAGGAAAGTTTGAGCAAGACATTAGTTTTTTCAACTTAGAGCGTTATTGTCAATTTACCAAACCGGGGGTTAACAGCTTGGCGATCGCCCACTGCCCCGGGCCATGGTTGGGGACAAACGATTGGTTAACAGAGGTCATCCACCAAAGGATTAAGATGGGAAACAAGTACCTGGCATAGGTATTAATGGGGGACCCCACCGCTGAGCAGAAATCAGTCCCCGACCTGAGTATCTGGATTGTGTGCAAATTGT

CDS

ATGAAAACTTTATTACTAACCTGGCTGGATCGTATTTTGATTGCCGATGTATTCCTGGTGCTGCTGGGCTTTTTCTGGTTTGCCATCGCTGTGGTGGGGGAATCCACTGGTATTCCTTTGGGCTATCAAATCTGGCAAAAACTTTGGTTGCCCCTATTCAATCCCGCCATTAGTATTCTGATTTTGGGTGCCGTCAGCAGTTGGGGAATCAAAAAACTTTCCCAATGGTTCACCACTAAACAAGGGGGTTAG

Protein

MKTLLLTWLDRILIADVFLVLLGFFWFAIAVVGESTGIPLGYQIWQKLWLPLFNPAISILILGAVSSWGIKKLSQWFTTKQGG