Your browser is old and dusty. Try Google Chrome!

Details for ssl1923

ORF ssl1923
Accession NP_440366.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -319 -326 5.64398 0.293
NP_441418.1_6 Forward -176 -157 -21.83 0.16
NP_441453.1_4 Reverse -318 -326 7.09925 0.0962
NP_441453.1_4 Forward -327 -319 7.09925 0.0962
NP_441453.1_4 Reverse -140 -148 5.13263 0.179
NP_441453.1_4 Forward -303 -295 4.34598 0.257
NP_442151.1_6 Forward -234 -220 10.0294 0.133
NP_441818.1_1 Reverse -319 -330 9.3996 0.246
NP_440226.1_2 Reverse -244 -262 16.8485 0.111
NP_440996.1_5 Reverse -42 -51 16.8124 0.146
NP_442173.1_1 Forward -326 -318 7.8859 0.134
NP_442173.1_1 Reverse -319 -327 6.01761 0.2
NP_442752.1_4 Forward -327 -320 4.56234 0.265
NP_442975.1_10 Reverse -314 -328 2.06395 0.284
NP_440784.1_7 Forward -326 -319 6.72562 0.161
NP_440784.1_7 Reverse -319 -326 6.43063 0.218
NP_441681.1_9 Forward -228 -214 14.1593 0.19
NP_441145.1_7 Reverse -26 -45 2.45773 0.22
NP_442062.1_8 Reverse -318 -328 11.5831 0.0447
NP_442062.1_8 Forward -327 -317 7.94484 0.0848
NP_441802.1_1 Reverse -341 -360 5.89931 0.269
NP_439918.1_2 Forward -249 -230 -3.93378 0.263
NP_441935.1_10 Forward -250 -231 16.7157 0.287
NP_441594.1_6 Reverse -351 -370 4.81767 0.211
NP_442110.1_2 Forward -161 -148 18.2948 0.0972
NP_442110.1_7 Reverse -318 -332 0.196253 0.266
NP_440769.1_8 Reverse -32 -51 21.3373 0.0296
NP_441083.1_5 Reverse -318 -328 1.55333 0.204
NP_441083.1_5 Forward -327 -317 0.0783647 0.245
NP_441738.1_2 Reverse -320 -327 11.7401 0.0647
NP_441558.1_5 Forward -329 -310 4.42435 0.281
NP_440209.1_1 Forward -327 -319 8.67255 0.0333
NP_440209.1_1 Forward -176 -168 5.42762 0.105
NP_440209.1_1 Forward -149 -141 2.08437 0.286
NP_442889.1_8 Reverse -164 -178 4.8172 0.25
NP_440178.1_7 Reverse -317 -336 -22.6167 0.268
NP_441909.1_2 Forward -230 -211 6.19431 0.124
NP_441327.1_1 Reverse -31 -50 8.24996 0.216
NP_441327.1_4 Reverse -32 -46 15.7325 0.282
NP_442111.1_4 Reverse -166 -180 2.75286 0.266
NP_440906.1_5 Reverse -141 -148 8.20058 0.19
NP_440906.1_5 Forward -326 -319 6.43063 0.223
NP_440906.1_5 Reverse -319 -326 6.3323 0.234
NP_440747.1_10 Forward -330 -318 -11.7607 0.142
NP_440747.1_10 Forward -360 -348 -12.4491 0.282
NP_441486.1_1 Forward -330 -316 12.7826 0.0105
NP_441667.1_5 Forward -235 -221 16.8237 0.254
NP_440470.1_5 Reverse -31 -50 12.4613 0.165
NP_440470.1_5 Forward -51 -32 11.8883 0.169
NP_440470.1_5 Forward -63 -44 8.73709 0.245
NP_440057.1_5 Forward -394 -375 17.0099 0.137
NP_443018.1_3 Forward -302 -295 12.5271 0.0523
NP_443018.1_3 Reverse -295 -302 12.5271 0.0523
NP_443018.1_3 Forward -326 -319 5.44732 0.193
NP_443018.1_3 Reverse -319 -326 5.34899 0.212
NP_440376.1_1 Reverse -318 -327 7.86621 0.0583
NP_440376.1_1 Forward -368 -359 2.35967 0.224
NP_440376.1_1 Forward -327 -318 0.393051 0.279
NP_441002.1_6 Forward -361 -342 15.3382 0.122
NP_442687.1_7 Forward -328 -318 5.38824 0.206
NP_442658.1_1 Forward -305 -295 4.7978 0.297
NP_442658.1_1 Forward -214 -204 4.7978 0.297
NP_440662.1_2 Reverse -340 -359 11.0125 0.0553
NP_441958.1_5 Forward -328 -318 1.55333 0.095
NP_441958.1_5 Reverse -317 -327 1.25834 0.108
NP_442057.1_5 Forward -163 -145 12.585 0.229
NP_439905.1_1 Forward -302 -289 13.1956 0.177
NP_440984.1_7 Reverse -289 -303 6.29277 0.219
NP_440934.1_2 Forward -202 -183 -0.39387 0.296
NP_441129.1_3 Reverse -174 -193 -7.17871 0.147
NP_440809.1_9 Forward -243 -225 -8.33898 0.235
NP_442438.1_10 Reverse -343 -357 9.73436 0.0602
NP_442438.1_10 Forward -297 -283 0.0979218 0.239
NP_441550.1_8 Reverse -316 -326 5.87944 0.224
NP_441916.1_7 Forward -327 -317 5.78156 0.12
NP_441916.1_7 Reverse -318 -328 1.455 0.285
NP_440206.1_4 Reverse -355 -374 1.27698 0.289
NP_440569.1_10 Forward -49 -30 7.97315 0.231
NP_441725.1_5 Forward -326 -316 2.53664 0.115
NP_441725.1_5 Reverse -319 -329 1.74999 0.125
NP_441725.1_5 Forward -302 -292 -1.29827 0.299
NP_439966.1_7 Forward -329 -319 6.46942 0.18
NP_442941.1_3 Reverse -319 -329 10.4031 0.018
NP_442941.1_3 Forward -326 -316 -0.609952 0.264
NP_440289.1_2 Reverse -137 -150 7.49244 0.0557
NP_440289.1_2 Forward -330 -317 -2.63565 0.261
NP_440289.1_2 Reverse -315 -328 -5.19226 0.3
NP_440260.1_8 Reverse -213 -231 -2.3408 0.243
NP_441514.1_4 Reverse -30 -49 13.1825 0.269
NP_442281.1_1 Reverse -313 -327 3.04726 0.246
NP_441079.1_7 Reverse -113 -132 5.99684 0.136
NP_441079.1_7 Reverse -32 -51 -7.6711 0.296
NP_001035871.2_7 Forward -210 -200 13.0581 0.231
NP_440437.1_1 Reverse -312 -331 -3.73712 0.244
NP_441644.1_6 Forward -303 -293 7.45273 0.124
NP_441644.1_6 Reverse -318 -328 5.68278 0.18
NP_442215.1_2 Forward -263 -247 -3.77637 0.222
NP_442215.1_2 Reverse -301 -317 -7.21796 0.289
NP_440929.1_1 Forward -230 -220 15.2384 0.276
NP_440929.1_8 Forward -327 -318 7.07956 0.0713
NP_440929.1_8 Reverse -167 -176 6.39124 0.0992
NP_440929.1_8 Reverse -318 -327 0.786375 0.299
NP_442933.1_10 Reverse -318 -327 8.35786 0.0767
NP_442933.1_10 Forward -327 -318 8.1612 0.0885
NP_440382.1_2 Forward -131 -112 4.62021 0.27
NP_441751.2_8 Reverse -349 -363 -4.7203 0.179
NP_441751.2_8 Reverse -319 -333 -5.50694 0.214
NP_442554.1_8 Forward -302 -292 9.61647 0.0576
NP_442554.1_8 Reverse -319 -329 6.37155 0.12
NP_441762.1_7 Reverse -139 -151 -5.56589 0.217
NP_441762.1_7 Reverse -317 -329 -6.05754 0.268
NP_442142.1_4 Reverse -137 -150 3.7553 0.246
NP_442292.1_1 Reverse -319 -328 8.94785 0.0261
NP_441525.1_1 Reverse -72 -85 16.2439 0.203
NP_442476.1_6 Forward -302 -288 0.0979218 0.274
NP_442016.1_10 Forward -375 -356 7.17762 0.259
NP_443009.1_5 Forward -328 -317 5.26972 0.21
NP_441715.1_4 Reverse -319 -329 5.28991 0.216
NP_440357.1_3 Forward -357 -338 -0.885524 0.296
NP_440620.1_4 Forward -61 -47 16.4362 0.236
NP_442305.1_6 Reverse -153 -163 16.3025 0.202
NP_441468.1_1 Forward -326 -319 6.43063 0.175
NP_441468.1_1 Reverse -319 -326 6.43063 0.175
NP_441468.1_1 Reverse -295 -302 3.97235 0.277
NP_441468.1_1 Forward -302 -295 3.97235 0.277
NP_441618.1_7 Forward -243 -224 12.8206 0.295
NP_441020.2_6 Forward -329 -312 9.57695 0.168
NP_441020.2_6 Forward -371 -354 6.52869 0.262
NP_441673.1_1 Forward -327 -318 1.57302 0.0764
NP_441673.1_1 Reverse -318 -327 1.57302 0.0764
NP_442868.1_6 Forward -329 -319 1.65166 0.205
NP_442868.1_6 Forward -359 -349 0.373358 0.234
NP_441911.1_10 Forward -227 -208 18.1033 0.0604
NP_442808.1_1 Reverse -139 -149 5.87944 0.137
NP_441101.1_1 Forward -157 -139 8.18062 0.291
NP_442050.1_1 Forward -376 -357 8.45592 0.25
NP_442050.1_5 Forward -329 -319 12.4676 0.0617
NP_442050.1_5 Reverse -316 -326 10.8943 0.126
NP_440558.1_2 Forward -366 -347 -4.81876 0.249
NP_441518.1_3 Forward -337 -318 -10.9153 0.252
NP_441878.1_6 Reverse -317 -327 1.55333 0.0937
NP_441878.1_6 Reverse -293 -303 0.57002 0.14
NP_441878.1_6 Reverse -166 -176 -0.0199663 0.163
NP_441557.1_5 Forward -327 -318 9.24284 0.0213
NP_441557.1_5 Reverse -318 -327 0.983037 0.0911
NP_441520.1_5 Reverse -380 -399 15.0441 0.148
NP_441445.1_1 Forward -336 -317 1.76941 0.247
NP_441458.1_10 Forward -312 -293 3.73603 0.24
NP_442183.1_1 Forward -176 -162 5.01447 0.234
NP_440861.1_2 Reverse -380 -399 10.8738 0.27
NP_442347.1_2 Reverse -319 -328 2.94966 0.292
NP_442645.1_2 Forward -365 -346 -19.6667 0.288
NP_440136.1_2 Forward -326 -319 6.52896 0.116
NP_440136.1_2 Reverse -319 -326 6.43063 0.154
NP_442998.1_5 Reverse -343 -353 10.5998 0.207
NP_442998.1_10 Reverse -320 -327 6.0373 0.205
NP_440299.1_1 Reverse -279 -292 7.19687 0.119
NP_441799.1_1 Reverse -314 -328 6.29216 0.176
NP_442201.1_10 Reverse -344 -363 -13.6686 0.274
NP_440256.1_1 Forward -330 -311 -5.60541 0.187
NP_440256.1_1 Reverse -175 -194 -8.45701 0.261
NP_441559.1_8 Reverse -354 -368 -5.80194 0.27
NP_442158.1_4 Forward -273 -263 12.5664 0.245
NP_442452.1_3 Forward -233 -214 3.73603 0.261
NP_440695.1_6 Reverse -42 -56 16.9075 0.126
NP_442386.1_9 Forward -304 -295 13.1756 0.0406
NP_442386.1_9 Forward -328 -319 11.799 0.0835
NP_441340.1_5 Forward -326 -319 6.23397 0.132
NP_441340.1_5 Reverse -319 -326 6.13563 0.175
NP_441340.1_5 Reverse -295 -302 4.07068 0.239
NP_441340.1_5 Forward -302 -295 4.07068 0.239
NP_440768.1_2 Forward -97 -78 5.99764 0.106
NP_440586.1_8 Forward -326 -319 9.57686 0.146
NP_440586.1_8 Forward -302 -295 7.61025 0.227
NP_440586.1_8 Reverse -295 -302 7.61025 0.227
NP_442959.1_5 Reverse -114 -133 5.211 0.288
NP_441262.1_3 Forward -327 -320 5.34899 0.181
NP_441262.1_3 Reverse -167 -174 5.34899 0.181
NP_443051.1_1 Forward -328 -319 0.983037 0.125
NP_443051.1_1 Forward -177 -168 0.29472 0.195
NP_443051.1_1 Reverse -317 -326 -0.786921 0.26
NP_441232.1_10 Forward -187 -168 20.4523 0.0177
NP_439937.1_8 Reverse -340 -359 -4.81876 0.286
NP_439937.1_9 Reverse -139 -156 -17.1697 0.294
NP_440372.1_2 Forward -326 -319 6.92228 0.0492
NP_440372.1_2 Reverse -319 -326 6.82395 0.0854
NP_440139.1_1 Reverse -312 -331 3.73524 0.2
NP_440267.1_2 Reverse -162 -176 5.70218 0.259
NP_440364.1_6 Forward -194 -181 13.6867 0.275
NP_441877.1_9 Forward -56 -39 3.18543 0.284
NP_442262.1_10 Forward -302 -295 10.4622 0.145
NP_442262.1_10 Reverse -295 -302 10.4622 0.145
NP_441689.1_5 Forward -329 -319 5.87944 0.197
NP_440344.1_10 Reverse -133 -150 -9.49926 0.147
NP_440531.1_6 Reverse -286 -305 -0.0988766 0.203
NP_441335.1_8 Forward -314 -295 7.7676 0.27
NP_442832.1_2 Reverse -154 -173 13.4708 0.239
NP_441640.1_1 Forward -372 -353 -2.95047 0.287
NP_440297.1_9 Forward -302 -292 9.91146 0.0917
NP_440297.1_9 Forward -326 -316 7.35486 0.126
NP_440297.1_9 Reverse -319 -329 -0.216628 0.282
NP_441896.1_1 Forward -150 -131 13.2733 0.138
NP_441896.1_5 Forward -158 -151 15.3787 0.268
NP_440650.1_8 Forward -163 -144 13.7658 0.211
NP_440888.1_2 Reverse -318 -332 13.372 0.0297
NP_440888.1_2 Forward -357 -343 5.70218 0.267
NP_440888.1_2 Forward -368 -354 5.30886 0.284
NP_441543.1_2 Forward -148 -139 7.47288 0.117
NP_441543.1_2 Reverse -319 -328 7.37455 0.127
NP_441543.1_2 Reverse -168 -177 4.52295 0.234
NP_441469.1_8 Reverse -293 -302 11.3078 0.173
NP_441469.1_8 Forward -304 -295 5.60459 0.258
NP_442337.1_8 Forward -169 -150 4.42435 0.21
NP_442578.1_7 Reverse -168 -175 5.34899 0.2
NP_442578.1_7 Reverse -319 -326 5.25066 0.251
NP_442578.1_7 Forward -326 -319 5.15232 0.291
NP_441462.1_2 Forward -327 -317 10.1081 0.0132
NP_441929.1_6 Reverse -333 -352 12.1925 0.261
NP_443062.1_1 Reverse -294 -312 4.45062 0.26
NP_443062.1_6 Forward -335 -316 1.76941 0.268
NP_440939.1_2 Reverse -304 -323 17.699 0.188
NP_442204.1_1 Forward -180 -169 2.02529 0.266
NP_440516.1_8 Forward -327 -318 -0.000272808 0.156
NP_440516.1_8 Reverse -140 -149 -0.196935 0.185
NP_441785.1_1 Reverse -318 -332 13.2231 0.231
NP_440104.1_8 Forward -203 -189 15.6336 0.296
NP_442428.1_5 Forward -326 -319 6.43063 0.148
NP_442428.1_5 Reverse -319 -326 6.3323 0.193
NP_442428.1_5 Forward -302 -295 4.36568 0.271
NP_442428.1_5 Reverse -295 -302 4.36568 0.271
NP_440603.1_3 Forward -374 -355 5.89931 0.265
NP_440673.1_2 Forward -43 -24 7.75569 0.292
NP_440673.1_3 Forward -153 -146 8.98723 0.203
NP_441052.1_2 Reverse -318 -328 1.94665 0.221
NP_441052.1_2 Reverse -354 -364 -0.314959 0.273
NP_442219.1_9 Reverse -319 -328 14.8477 0.0272
NP_440436.1_4 Reverse -319 -328 7.86578 0.119
NP_440436.1_4 Forward -148 -139 5.30919 0.209
NP_440436.1_4 Forward -326 -317 5.21086 0.214
NP_440436.1_4 Reverse -295 -304 4.42421 0.265
NP_441884.1_9 Reverse -137 -156 -23.01 0.284
NP_440314.1_9 Reverse -141 -160 -5.01543 0.216
NP_441669.1_2 Forward -397 -383 15.6336 0.279
NP_442577.1_10 Reverse -259 -278 3.14526 0.285
NP_441719.1_4 Forward -326 -319 6.92228 0.0565
NP_441719.1_4 Reverse -319 -326 6.82395 0.0855
NP_441719.1_4 Reverse -168 -175 3.97235 0.231
NP_442366.1_3 Reverse -317 -335 -0.275845 0.188
NP_440728.1_1 Reverse -42 -61 10.3234 0.286
NP_441851.1_10 Forward -328 -318 14.4347 0.016
NP_441851.1_10 Reverse -293 -303 5.78156 0.2
NP_442515.1_1 Forward -328 -314 3.63784 0.115
NP_442515.1_1 Reverse -145 -159 3.63784 0.115
NP_441409.1_6 Forward -155 -136 -8.06369 0.162
NP_440432.1_9 Forward -326 -311 4.79811 0.0644
NP_439960.1_8 Forward -303 -284 10.2259 0.264
NP_440726.1_9 Reverse -160 -179 18.6815 0.0187
NP_441124.1_5 Reverse -111 -121 11.9577 0.239
NP_442168.1_5 Reverse -168 -187 -2.95047 0.272
NP_440040.1_8 Forward -138 -119 7.11373 0.206
NP_441078.1_4 Reverse -318 -327 0.393051 0.205
NP_441078.1_4 Forward -327 -318 0.393051 0.205
NP_441078.1_4 Forward -149 -140 -1.57357 0.266
NP_440526.1_3 Reverse -319 -330 0.64819 0.273
NP_441432.1_8 Forward -328 -319 7.37455 0.0992
NP_442320.1_8 Reverse -134 -148 -4.03198 0.142
NP_442320.1_8 Forward -333 -319 -4.81863 0.188
NP_442320.1_8 Reverse -312 -326 -5.80194 0.249
NP_441732.1_2 Reverse -136 -152 -16.7561 0.195
NP_440313.1_5 Reverse -262 -280 11.1298 0.28
NP_440199.1_10 Forward -330 -320 7.35486 0.231
NP_442489.1_2 Forward -338 -319 12.8808 0.137
NP_442489.1_7 Forward -327 -318 0.884706 0.145
NP_442489.1_7 Reverse -318 -327 0.884706 0.145
NP_442489.1_7 Forward -176 -167 -1.86856 0.259
NP_440559.1_1 Forward -326 -317 7.96454 0.0739
NP_440559.1_1 Reverse -319 -328 7.86621 0.0856
NP_441659.2_8 Reverse -318 -328 6.37155 0.0774
NP_441659.2_8 Forward -303 -293 1.94665 0.22
NP_441659.2_8 Forward -327 -317 0.373358 0.268
NP_440860.1_8 Forward -157 -138 13.1758 0.296
NP_441022.1_1 Forward -210 -201 12.4095 0.232
NP_441022.1_1 Reverse -200 -209 12.4095 0.232
NP_441022.1_1 Forward -63 -54 11.6421 0.274
NP_441807.1_10 Reverse -353 -372 22.3206 0.013
NP_440779.1_5 Reverse -318 -335 -4.97604 0.12
NP_440779.1_5 Forward -176 -159 -14.8091 0.274
NP_442346.1_5 Forward -150 -140 7.74818 0.159
NP_442346.1_5 Forward -328 -318 6.8632 0.188
NP_442346.1_5 Reverse -317 -327 6.27322 0.208
NP_442346.1_5 Reverse -293 -303 6.07655 0.216
NP_442346.1_5 Forward -86 -76 5.68323 0.234
NP_442934.1_8 Reverse -38 -57 7.57094 0.266
NP_441833.1_4 Forward -326 -319 6.52896 0.0924
NP_441833.1_4 Reverse -319 -326 6.43063 0.125
NP_441329.1_1 Forward -56 -37 3.96249 0.3
NP_441895.1_1 Forward -379 -360 11.7992 0.000999
NP_441895.1_7 Forward -343 -324 29.7937 0.0000187
NP_441112.1_6 Forward -337 -318 -4.22878 0.296
NP_442162.1_9 Forward -326 -319 6.82395 0.0927
NP_442162.1_9 Reverse -319 -326 6.72562 0.116
NP_440788.1_2 Reverse -118 -137 8.35759 0.227
NP_442943.1_1 Reverse -32 -47 5.59392 0.21
NP_440204.1_1 Forward -248 -229 6.88262 0.278
NP_442140.1_3 Reverse -295 -305 11.0914 0.0836
NP_442140.1_3 Forward -302 -292 7.74818 0.13
NP_441609.1_1 Reverse -45 -64 -2.45882 0.29
NP_441813.1_5 Forward -329 -319 6.46988 0.0908
NP_441813.1_5 Reverse -316 -326 5.78156 0.109
NP_440590.1_4 Reverse -319 -332 -4.9956 0.272
NP_440567.1_1 Reverse -168 -182 0.88457 0.228
NP_442497.1_10 Forward -326 -317 8.55452 0.0294
NP_442497.1_10 Reverse -319 -328 0.884706 0.128
NP_440821.1_4 Forward -329 -319 8.82982 0.0395
NP_440821.1_4 Reverse -316 -326 1.55333 0.133
NP_440821.1_4 Reverse -165 -175 -0.314959 0.251
NP_440821.1_4 Reverse -138 -148 -0.41329 0.257
NP_441239.1_1 Forward -138 -119 10.5209 0.263
NP_441239.1_9 Reverse -292 -304 11.1504 0.0648
NP_441239.1_9 Forward -305 -293 10.2654 0.0834
NP_441239.1_9 Reverse -165 -177 3.77555 0.276
NP_441951.1_9 Forward -362 -343 -0.983855 0.283
NP_442669.1_1 Reverse -28 -47 21.3373 0.000724
NP_442349.1_9 Forward -361 -343 6.01734 0.112
NP_440868.1_4 Forward -180 -168 4.75886 0.111
NP_440868.1_4 Forward -153 -141 0.825626 0.199
NP_442402.1_4 Forward -348 -329 -9.14605 0.285
NP_441084.1_6 Reverse -292 -306 12.8346 0.152
NP_441084.1_6 Forward -223 -209 10.7015 0.231
NP_442039.1_7 Forward -331 -321 9.32148 0.257
NP_442837.1_3 Reverse -319 -326 6.3323 0.237
NP_442837.1_3 Forward -326 -319 6.3323 0.237
NP_442053.1_1 Forward -176 -167 6.19458 0.139
NP_442053.1_1 Reverse -318 -327 5.60459 0.176
NP_440505.1_3 Forward -329 -319 6.8632 0.169
NP_440505.1_7 Forward -162 -143 6.68596 0.162
NP_441102.1_2 Reverse -34 -53 6.58763 0.298
NP_440914.1_1 Reverse -318 -328 6.76087 0.267
NP_441011.1_8 Forward -326 -317 12.0944 0.0517
NP_441011.1_8 Reverse -295 -304 5.01461 0.289
NP_442533.1_1 Forward -372 -353 -10.817 0.235
NP_442533.1_6 Forward -327 -318 5.89959 0.125
NP_442533.1_6 Reverse -294 -303 4.62128 0.179
NP_439944.1_9 Reverse -319 -329 16.598 0.0106
NP_439944.1_9 Forward -326 -316 6.27322 0.188
NP_439944.1_9 Forward -148 -138 5.5849 0.239
NP_441697.1_5 Reverse -113 -132 -8.26048 0.258
NP_441697.1_5 Forward -50 -31 -9.97933 0.278
NP_442664.1_3 Forward -166 -152 17.4042 0.223
NP_441106.1_1 Forward -177 -168 6.09625 0.101
NP_441106.1_1 Reverse -139 -148 5.3096 0.162
NP_441106.1_1 Forward -304 -295 4.32629 0.227
NP_440480.1_8 Forward -301 -288 15.7522 0.29
NP_441286.1_1 Forward -328 -316 5.25052 0.0259
NP_441286.1_1 Reverse -317 -329 -6.74586 0.278
NP_440886.1_7 Forward -150 -140 3.42118 0.282
NP_440767.1_7 Reverse -343 -362 11.7008 0.165
NP_441753.1_10 Reverse -336 -355 0.687771 0.287
NP_441021.1_1 Forward -175 -156 -11.8003 0.274
NP_441463.1_2 Reverse -35 -53 4.59949 0.18
NP_441626.1_2 Forward -326 -319 6.52896 0.137
NP_441626.1_2 Reverse -319 -326 6.23397 0.172
NP_441626.1_6 Reverse -344 -362 6.1149 0.267
NP_442615.1_1 Reverse -309 -327 -7.55234 0.296
NP_441065.1_3 Forward -47 -28 15.0441 0.23
NP_441836.1_2 Reverse -342 -361 -1.37718 0.217
NP_440082.1_5 Forward -89 -70 16.7566 0.256
NP_440467.1_5 Reverse -342 -361 18.879 0.144
NP_440114.1_10 Forward -303 -289 7.17775 0.243
NP_442090.1_2 Reverse -369 -388 9.21455 0.281
NP_442698.1_10 Reverse -341 -360 -1.27885 0.297
NP_441552.1_3 Forward -334 -315 17.0099 0.126
NP_439910.1_2 Reverse -310 -327 -12.2525 0.0788
NP_439910.1_2 Reverse -132 -149 -22.6756 0.285
NP_442867.1_8 Forward -195 -176 14.9458 0.159
NP_441332.1_4 Reverse -30 -49 7.66927 0.234
NP_442509.1_9 Forward -327 -317 7.64939 0.21
YP_003858595.1_5 Reverse -368 -387 15.0441 0.0144
NP_441440.1_8 Forward -191 -178 14.1789 0.299
NP_441885.1_5 Reverse -318 -328 1.65166 0.106
NP_441885.1_5 Forward -327 -317 0.668351 0.133
NP_443000.1_3 Reverse -184 -203 12.589 0.248
NP_443000.1_7 Forward -329 -319 7.64985 0.0734
NP_443000.1_7 Reverse -316 -326 5.5849 0.128
NP_442932.1_10 Forward -166 -147 14.2574 0.099
NP_440091.1_1 Forward -331 -319 7.02048 0.0892
NP_440091.1_1 Reverse -136 -148 6.72548 0.0921
NP_441397.1_8 Reverse -377 -390 15.8179 0.142
NP_443010.1_10 Reverse -137 -154 5.47654 0.204
NP_441105.1_3 Forward -72 -53 -7.76869 0.259
NP_440216.1_1 Forward -327 -313 -4.13031 0.1
NP_440216.1_1 Forward -368 -354 -12.2918 0.256
NP_440216.1_9 Forward -301 -292 5.89959 0.289
NP_440172.1_1 Forward -327 -317 9.12481 0.0586
NP_440172.1_2 Forward -259 -240 17.699 0.149
NP_441226.1_7 Forward -326 -319 11.5435 0.0757
NP_441226.1_7 Reverse -179 -186 6.52862 0.253
NP_440198.1_10 Reverse -187 -206 9.3409 0.296
NP_441111.1_7 Reverse -319 -327 9.1642 0.0184
NP_441111.1_7 Forward -326 -318 -0.570565 0.233
NP_441111.1_7 Reverse -168 -176 -0.570565 0.233
NP_441766.1_2 Forward -327 -318 8.45619 0.0593
NP_441766.1_9 Reverse -360 -379 1.47442 0.246
NP_443052.1_8 Reverse -157 -176 -10.7186 0.214
NP_443052.1_8 Reverse -308 -327 -11.0136 0.221
NP_442116.1_6 Reverse -32 -49 6.83207 0.271
NP_442154.1_1 Forward -84 -66 -13.5505 0.217
NP_440261.1_5 Forward -302 -289 -4.50394 0.151
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATACTCAATGCTATTTTTTACATGCCCAGAACGGGGTGTGCCTGGCGACTTCTGCCCCATGATTTTCCTAAATGGCGAACGCTCTATGGTTATTTTCAGCCATGGCACGAAGATGGTACAAGGATTTTATTTTCTGGGTGGAGAATACTTTTGGTTGGACTTTGAATGTGGTCAGCAAAAAGCAGGGACACAAAGGCTTTGAAGTCCTACCCCGCCGTTGGGTAGTCGAGCGCACCTTTGCTTGGTTTGGTCGCTATCGTCGTTTAAGAAAGAATTATGAAATTTACCTACCACTAGTGAGACAATGCTCTATGTCGCCATGATTAGTCTCATGGTTCAAAAGCTTGCTTAAAACTTTTCAAACATTTTCTAAGGTCGTCAAAGTGAAGCCTTAATCCTA

CDS

GTGTTGCGTCTGTTAAACCGTCGCTTAGGTGGATTGCCCGCAGTTCAAGTGCAACAAGTTCAGAAACTATCGATCGCCGAGTTAGAGGATTTGGGGGAAGCACTATTGGATTTCACCGAGACGGCCGACCTAGAAGTGTATTTAGAGAAGTTTGGATAA

Protein

MLRLLNRRLGGLPAVQVQQVQKLSIAELEDLGEALLDFTETADLEVYLEKFG