Your browser is old and dusty. Try Google Chrome!

Details for ssl1920

ORF ssl1920
Accession NP_440368.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY523l(partial copy): 520871 - 521420]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -368 -354 14.3559 0.141
NP_441453.1_7 Reverse -142 -149 12.9205 0.23
NP_442328.1_2 Reverse -187 -206 5.211 0.289
NP_441098.1_3 Forward -29 -10 -6.02333 0.28
NP_442752.1_4 Reverse -190 -197 7.90559 0.144
NP_440061.1_9 Reverse -344 -358 5.89884 0.266
NP_442062.1_3 Forward -124 -105 -2.0655 0.265
NP_442581.1_1 Forward -38 -24 7.57108 0.262
NP_442974.1_6 Forward -294 -275 19.0748 0.293
NP_440304.1_4 Forward -357 -347 4.10993 0.272
NP_442207.1_9 Reverse -267 -286 8.75091 0.276
NP_441210.1_6 Reverse -227 -246 9.63589 0.267
NP_441208.1_9 Forward -371 -357 10.521 0.185
NP_441082.1_10 Reverse -141 -154 10.344 0.236
NP_441082.1_10 Reverse -294 -307 9.85238 0.237
NP_442827.1_8 Forward -363 -344 3.34192 0.148
NP_442570.1_3 Reverse -133 -152 -1.47551 0.212
NP_440331.1_5 Forward -62 -43 20.649 0.000117
NP_441163.1_4 Forward -155 -136 13.695 0.278
NP_440048.1_8 Forward -263 -244 13.5691 0.27
NP_440747.1_10 Reverse -356 -368 -12.2524 0.254
NP_441847.1_9 Reverse -96 -114 11.1305 0.232
NP_441130.1_10 Reverse -55 -69 5.1128 0.247
NP_440057.1_4 Forward -156 -137 12.5249 0.299
NP_441695.1_4 Forward -211 -193 14.9655 0.17
NP_441695.1_4 Forward -212 -194 11.8189 0.227
NP_442848.1_5 Reverse -352 -370 1.78911 0.276
NP_442848.1_5 Forward -199 -181 -1.75081 0.276
NP_440376.1_1 Forward -368 -359 3.83464 0.19
NP_441857.1_6 Reverse -298 -308 14.7297 0.229
NP_442687.1_7 Forward -356 -346 5.78156 0.188
NP_441077.1_6 Forward -33 -17 2.60905 0.276
NP_442485.1_3 Reverse -192 -211 -5.9004 0.296
NP_442958.1_3 Reverse -190 -209 -2.95047 0.299
NP_440533.1_9 Forward -326 -307 6.58763 0.189
NP_440667.1_2 Reverse -151 -170 -0.39387 0.213
NP_441950.1_7 Reverse -179 -198 -4.03212 0.211
NP_441950.1_8 Reverse -280 -294 5.21113 0.281
NP_441256.1_8 Forward -370 -351 15.9291 0.0902
NP_441256.1_8 Reverse -176 -195 6.39097 0.267
NP_441958.1_5 Forward -356 -346 -2.57657 0.28
NP_442911.1_1 Reverse -62 -75 18.3007 0.159
NP_440858.1_1 Forward -46 -27 17.994 0.00743
NP_442064.1_1 Reverse -279 -298 -13.1769 0.285
NP_443055.1_6 Reverse -345 -363 3.16499 0.2
NP_440993.1_2 Reverse -341 -357 6.05672 0.233
NP_442002.1_9 Forward -356 -349 11.3472 0.185
NP_442567.1_4 Reverse -208 -227 11.2092 0.29
NP_442440.1_4 Forward -274 -255 19.7631 0.124
NP_442231.1_2 Reverse -195 -214 17.2883 0.202
NP_441916.1_7 Forward -368 -358 3.22496 0.223
NP_439966.1_7 Forward -157 -147 4.40448 0.273
NP_441514.1_4 Forward -124 -105 15.027 0.226
NP_442281.1_1 Reverse -354 -368 6.19383 0.133
NP_442256.1_8 Forward -191 -172 16.2232 0.248
NP_442012.1_1 Reverse -353 -372 -0.787193 0.267
NP_441081.1_4 Forward -305 -286 7.07928 0.205
NP_442982.1_5 Forward -378 -359 -3.44213 0.298
NP_442215.1_2 Reverse -324 -340 -2.98973 0.207
NP_442215.1_2 Forward -311 -295 -4.36636 0.232
NP_442215.1_2 Forward -371 -355 -7.11963 0.286
NP_442029.1_6 Reverse -185 -204 3.93269 0.274
NP_442313.1_3 Reverse -164 -183 9.3409 0.224
NP_440919.1_1 Forward -360 -341 -6.1954 0.258
NP_443009.1_5 Reverse -358 -369 3.99143 0.268
NP_440379.1_5 Reverse -250 -269 -9.44032 0.264
NP_440464.1_10 Reverse -191 -201 12.0532 0.262
NP_439939.1_4 Reverse -100 -119 1.47442 0.199
NP_441015.1_10 Reverse -185 -204 0.0977854 0.167
NP_441015.1_10 Reverse -193 -212 -11.0136 0.29
NP_442253.1_5 Reverse -302 -319 0.137172 0.203
NP_441876.1_9 Forward -217 -207 14.1392 0.267
NP_442745.1_5 Reverse -126 -145 12.0942 0.288
NP_441764.1_8 Forward -76 -66 16.0002 0.284
NP_442719.1_2 Reverse -18 -36 -7.35637 0.232
NP_442719.1_2 Reverse -27 -45 -9.7163 0.267
NP_442719.1_2 Forward -222 -204 -11.7812 0.296
NP_440785.1_2 Forward -45 -26 6.58763 0.223
NP_441612.1_2 Reverse -339 -349 7.29072 0.256
NP_442808.1_1 Forward -300 -290 4.01116 0.212
NP_442775.1_6 Reverse -266 -285 14.1591 0.268
NP_441882.1_6 Reverse -129 -148 -1.7705 0.232
NP_442542.1_2 Forward -357 -344 7.00078 0.197
NP_441114.1_3 Reverse -225 -234 13.2744 0.231
NP_442576.1_2 Reverse -93 -112 20.8456 0.0448
NP_441878.1_6 Forward -369 -359 1.65166 0.0795
NP_442721.1_3 Reverse -352 -371 14.2574 0.249
NP_442397.1_9 Reverse -346 -365 1.57275 0.283
NP_440540.1_2 Reverse -192 -211 6.58763 0.271
NP_442998.1_5 Reverse -4 -14 12.1731 0.176
NP_442998.1_5 Forward -37 -27 11.8781 0.176
NP_442998.1_5 Forward -36 -26 10.6981 0.206
NP_440899.1_8 Forward -108 -89 -5.70374 0.231
NP_442334.1_2 Forward -365 -348 -5.1727 0.2
NP_441559.1_8 Reverse -354 -368 -4.81863 0.238
NP_442860.1_7 Reverse -83 -101 10.1562 0.283
NP_440915.1_6 Reverse -200 -214 0.88457 0.151
NP_440915.1_6 Reverse -355 -369 -2.95034 0.287
NP_442158.1_4 Reverse -138 -148 14.533 0.176
NP_442158.1_4 Reverse -330 -340 13.4514 0.234
NP_440695.1_6 Forward -15 -1 10.4114 0.265
NP_440695.1_6 Forward -111 -97 9.44178 0.285
NP_442386.1_10 Reverse -183 -196 4.24752 0.265
NP_441404.1_8 Reverse -112 -126 13.1753 0.271
NP_441340.1_9 Forward -76 -66 15.3893 0.194
NP_442950.1_1 Forward -24 -5 0.392778 0.206
NP_440586.1_8 Forward -286 -279 7.1186 0.272
NP_442959.1_5 Forward -124 -105 8.94757 0.224
NP_440027.1_3 Forward -160 -142 2.57501 0.289
NP_443051.1_5 Reverse -94 -113 4.81767 0.267
NP_439937.1_8 Forward -301 -282 -4.91709 0.286
NP_442294.1_5 Reverse -246 -256 17.5813 0.232
NP_440819.1_5 Forward -37 -29 7.59091 0.272
NP_440267.1_2 Reverse -354 -368 7.66879 0.194
NP_441604.1_4 Reverse -140 -159 -5.80207 0.287
NP_441877.1_7 Forward -304 -285 5.2102 0.218
NP_442790.1_4 Forward -364 -345 -6.1954 0.144
NP_441689.1_5 Reverse -344 -354 5.19112 0.282
NP_440234.1_3 Forward -152 -133 14.9458 0.176
NP_440189.1_2 Reverse -338 -357 3.34271 0.268
NP_442280.1_10 Reverse -132 -150 7.01283 0.268
NP_442277.1_4 Reverse -350 -369 1.08032 0.286
NP_442845.1_2 Forward -369 -355 4.91614 0.249
NP_441834.1_6 Forward -160 -141 15.3391 0.201
NP_443064.1_6 Forward -199 -189 9.65817 0.205
NP_442337.1_8 Reverse -130 -149 5.01433 0.21
NP_442337.1_8 Reverse -141 -160 2.45773 0.217
NP_440220.1_4 Reverse -97 -116 -1.37794 0.264
NP_440148.1_1 Forward -54 -35 1.37609 0.219
NP_441929.1_3 Reverse -5 -24 2.75272 0.266
NP_442204.1_1 Reverse -355 -366 1.4353 0.271
NP_442120.1_10 Forward -354 -335 -12.6852 0.275
NP_442120.1_10 Forward -259 -240 -16.1268 0.296
NP_441052.1_2 Reverse -359 -369 2.14332 0.216
NP_442864.1_7 Reverse -197 -215 9.75391 0.274
NP_441004.1_1 Reverse -186 -205 -11.4069 0.238
NP_441004.1_1 Forward -395 -376 -15.7335 0.277
NP_441004.1_2 Forward -366 -347 -3.73712 0.283
NP_441004.1_4 Forward -358 -348 9.91146 0.259
NP_442813.1_4 Reverse -139 -158 -8.45701 0.299
NP_442873.1_5 Forward -205 -186 7.4718 0.277
NP_440296.1_10 Forward -371 -352 -13.0786 0.269
NP_440328.1_4 Reverse -353 -372 1.47442 0.224
NP_441851.1_10 Forward -369 -359 4.89658 0.24
NP_441668.1_4 Forward -378 -359 -2.75381 0.294
NP_440593.1_3 Forward -292 -273 -5.70374 0.264
NP_441982.1_6 Forward -38 -29 11.6259 0.288
NP_441046.1_2 Reverse -273 -292 -1.7705 0.292
NP_441409.1_6 Reverse -51 -70 -8.752 0.174
NP_442843.1_1 Forward -118 -99 -10.522 0.278
NP_440588.1_2 Reverse -350 -369 -5.01543 0.236
NP_442006.1_3 Reverse -193 -211 -6.96235 0.298
NP_440483.1_1 Reverse -199 -218 -1.57384 0.208
NP_442243.1_1 Forward -156 -138 2.37835 0.204
NP_441570.1_1 Reverse -284 -302 -15.5171 0.231
NP_441078.1_4 Reverse -359 -368 -1.96689 0.282
NP_441663.1_8 Reverse -353 -372 -3.73712 0.295
NP_442348.1_2 Reverse -183 -192 10.6195 0.259
NP_440707.1_9 Forward -371 -352 0.786102 0.293
NP_442443.1_1 Forward -371 -352 -1.7705 0.243
NP_441432.1_9 Reverse -39 -52 15.9671 0.121
NP_441432.1_9 Reverse -64 -77 9.37402 0.28
NP_440760.1_1 Forward -335 -316 -18.3884 0.213
NP_442489.1_7 Forward -368 -359 5.3096 0.0708
NP_442008.1_2 Forward -371 -352 17.0107 0.0705
NP_442008.1_2 Forward -211 -192 3.83436 0.245
NP_440545.1_3 Forward -372 -355 -0.354483 0.152
NP_441126.1_6 Reverse -96 -110 13.8515 0.283
NP_440459.1_2 Reverse -344 -361 12.1336 0.158
NP_441653.1_2 Reverse -193 -212 6.332 0.234
NP_442900.1_8 Reverse -371 -390 8.75091 0.248
NP_442311.1_8 Reverse -197 -216 9.63589 0.278
NP_441329.1_6 Forward -36 -17 -0.143661 0.266
NP_441329.1_6 Forward -34 -15 -2.53096 0.294
NP_441895.1_10 Forward -40 -21 39.0369 0.000000369
NP_440204.1_4 Reverse -165 -184 10.7175 0.138
NP_440156.1_4 Reverse -25 -35 14.8275 0.176
NP_442568.1_8 Forward -33 -19 15.8309 0.192
NP_440624.1_5 Reverse -95 -113 10.9452 0.202
NP_442669.1_1 Forward -66 -47 26.4505 0.0000917
NP_441874.1_1 Reverse -172 -186 11.0127 0.25
NP_440863.1_1 Forward -37 -23 14.3865 0.236
NP_440833.1_6 Reverse -101 -115 7.17714 0.285
NP_442216.1_4 Reverse -218 -226 8.08217 0.255
NP_440354.1_5 Forward -371 -352 4.916 0.204
NP_440675.1_1 Forward -372 -353 12.9791 0.177
NP_442340.1_3 Forward -349 -330 -11.1119 0.299
NP_441249.1_8 Reverse -157 -176 1.0811 0.284
NP_441474.1_1 Forward -212 -193 -1.8696 0.267
NP_442402.1_4 Reverse -351 -370 -1.8696 0.194
NP_442402.1_4 Reverse -19 -38 -9.34271 0.288
NP_442402.1_10 Reverse -28 -38 13.9425 0.182
NP_442402.1_10 Reverse -18 -28 11.091 0.269
NP_441848.1_4 Forward -41 -25 12.8027 0.195
NP_442882.1_8 Reverse -152 -171 5.70265 0.295
NP_442039.1_7 Forward -40 -30 8.33817 0.263
NP_441926.1_3 Forward -355 -339 2.91013 0.251
NP_440160.1_9 Reverse -326 -345 7.27595 0.3
NP_441102.1_1 Forward -252 -233 11.8975 0.122
NP_441252.1_6 Forward -358 -351 11.9372 0.25
NP_441203.1_1 Reverse -347 -366 -3.3438 0.0693
NP_442532.1_1 Forward -131 -117 10.7939 0.236
NP_440914.1_1 Forward -232 -222 6.17532 0.293
NP_442533.1_1 Forward -372 -353 -15.8318 0.257
NP_442533.1_1 Reverse -137 -156 -17.4051 0.288
NP_442533.1_6 Reverse -359 -368 7.07956 0.0964
NP_442533.1_6 Forward -213 -204 1.37636 0.3
NP_440661.1_6 Reverse -146 -165 1.67108 0.279
NP_442541.1_10 Reverse -353 -367 2.65393 0.254
NP_442322.1_4 Forward -199 -182 -8.41828 0.286
NP_440816.1_2 Forward -37 -18 6.82221 0.27
NP_441028.1_6 Reverse -29 -39 7.15773 0.23
NP_441527.1_4 Forward -32 -13 -9.50187 0.259
NP_441527.1_4 Forward -34 -15 -12.1756 0.285
NP_440007.1_9 Reverse -296 -310 0.786239 0.29
NP_441347.1_9 Reverse -62 -75 13.7951 0.17
NP_441930.1_1 Reverse -73 -92 5.70265 0.266
NP_442213.1_5 Reverse -140 -159 -1.57384 0.293
NP_441021.1_1 Reverse -347 -366 -9.83364 0.223
NP_441463.1_6 Reverse -344 -358 5.64286 0.287
NP_442211.1_9 Forward -165 -146 8.84924 0.156
NP_441836.1_10 Forward -45 -26 8.16093 0.197
NP_440114.1_10 Forward -355 -341 8.55439 0.2
NP_441425.1_2 Reverse -103 -122 15.6107 0.184
NP_439988.1_3 Forward -209 -195 8.06273 0.266
NP_439988.1_10 Forward -35 -16 10.942 0.213
NP_442680.1_5 Reverse -88 -107 -0.904675 0.297
NP_441984.1_6 Reverse -348 -360 14.1986 0.258
NP_440660.1_7 Reverse -146 -165 -3.04881 0.298
NP_441253.1_8 Forward -373 -359 12.4072 0.209
YP_003858595.1_6 Reverse -17 -36 23.4997 0.000638
NP_442514.1_5 Forward -351 -332 -6.68779 0.27
NP_442514.1_5 Reverse -346 -365 -8.35941 0.285
NP_442341.1_9 Forward -311 -297 5.01387 0.284
NP_441173.1_9 Reverse -30 -38 14.3753 0.161
NP_440423.1_6 Reverse -196 -215 -20.65 0.263
NP_442932.1_9 Forward -48 -29 3.44104 0.298
NP_443060.1_5 Reverse -318 -337 10.6184 0.175
NP_442354.1_8 Forward -365 -346 5.50599 0.299
NP_439962.1_4 Forward -214 -195 -6.09707 0.28
NP_442495.1_4 Forward -364 -354 17.5813 0.0771
NP_440149.1_10 Reverse -346 -365 -12.1936 0.285
NP_441105.1_3 Reverse -348 -367 0.491109 0.124
NP_442373.1_2 Reverse -189 -208 -11.7019 0.297
NP_440216.1_1 Forward -368 -354 -11.8985 0.228
NP_440216.1_9 Forward -148 -139 15.536 0.128
NP_440216.1_9 Forward -340 -331 7.17789 0.286
NP_440172.1_1 Forward -355 -345 3.81494 0.216
NP_441226.1_7 Forward -212 -205 5.64364 0.286
NP_440416.1_9 Reverse -352 -371 -9.93197 0.135
NP_440416.1_9 Reverse -283 -302 -14.0619 0.173
NP_443052.1_9 Forward -211 -192 2.94938 0.166
NP_443052.1_9 Forward -214 -195 -4.72043 0.26
NP_440261.1_7 Reverse -140 -159 -6.29373 0.266
NP_440988.1_10 Forward -295 -281 9.54584 0.202
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCCGGCCTTTCGTAACAACCTAAGAAAACTGGTGGATGGCCTGGGGCAATTGGTTTCCTCCACGGAAAATCTCCAAGACCGAGTTTACACTGCCCACACCCTGGAACGCAGTGGCCAACAATTACGCTTTCAGCTTGATCATCAACAGCAATTAGCTTTGTACTATGAACAATGGGGAGTTATTAACCCCGTCCCCGCTTCCGGCTCACCAAGTCCCCAAATTCAAACTCCTAAGATTAAACCACCCCAGCCCAAGGAAAATCAGGGTAAATAATGATAATTAAATGGGAAATTTTCCAGCTTTTTCTATCAGGACTTACGCAAAAGAAAACTTAAGAGCGCGTTTGAAAAGTAGGCATAATTGGGAAAAATGGTGAAGAATATAGAATTTTCACCATA

CDS

ATGATACCGAGAGAATTTTACAGCAGCGACATCACTGATAGCCAGTGGCAATTGGTAGAACCTCATTTACCCAAAGCAAAAACTGGGGGAAGAAAACGGAAAACTAGTCTGAGGGAGATACTCAATGCTATTTTTTACATGCCCAGAACGGGGTGTGCCTGGCGACTTCTGCCCCATGATTTTCCTAAATGGCGAACGCTCTATGGTTATTTTCAGCCATGGCACGAAGATGGTACAAGGATTTTATTTTCTGGGTGGAGAATACTTTTGGTTGGACTTTGA

Protein

MIPREFYSSDITDSQWQLVEPHLPKAKTGGRKRKTSLREILNAIFYMPRTGCAWRLLPHDFPKWRTLYGYFQPWHEDGTRILFSGWRILLVGL