Your browser is old and dusty. Try Google Chrome!

Details for ssl1918

ORF ssl1918
Accession NP_440371.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -399 -385 3.53951 0.163
NP_440557.1_3 Reverse -25 -44 9.14423 0.176
NP_441418.1_6 Forward -194 -175 -29.7948 0.238
NP_441453.1_7 Reverse -220 -227 14.1988 0.175
NP_441818.1_9 Forward -381 -362 -10.1286 0.292
NP_440348.1_6 Reverse -10 -29 12.3892 0.103
NP_442287.1_3 Forward -287 -270 14.7877 0.26
NP_442752.1_4 Reverse -185 -192 5.74231 0.171
NP_442752.1_4 Forward -394 -387 5.25066 0.256
NP_440061.1_9 Reverse -383 -397 14.6503 0.0617
NP_440110.1_8 Forward -381 -362 -1.27885 0.238
NP_439979.1_7 Reverse -353 -370 14.1002 0.267
NP_439979.1_9 Forward -383 -365 9.55725 0.243
NP_442062.1_8 Forward -394 -384 8.23984 0.0793
NP_442062.1_8 Reverse -185 -195 4.20827 0.228
NP_440304.1_4 Reverse -368 -378 4.0116 0.281
NP_442602.1_3 Reverse -20 -39 0.687771 0.197
NP_439918.1_3 Forward -223 -204 4.32602 0.264
NP_440856.1_7 Reverse -182 -201 -2.75381 0.192
NP_441083.1_5 Reverse -385 -395 -1.00328 0.289
NP_441434.1_1 Reverse -239 -253 11.1842 0.233
NP_440447.1_5 Reverse -219 -229 16.893 0.277
NP_441713.1_2 Forward -63 -44 16.1257 0.291
NP_441713.1_3 Reverse -369 -388 24.7789 0.0117
NP_441770.1_4 Forward -222 -203 -9.34199 0.25
NP_441716.1_1 Reverse -385 -399 4.03116 0.259
NP_441327.1_3 Forward -118 -99 13.7649 0.202
NP_441327.1_5 Forward -42 -33 12.7828 0.29
NP_441831.1_6 Forward -61 -42 9.93088 0.3
NP_440747.1_10 Forward -397 -385 -2.71429 0.0639
NP_440747.1_10 Reverse -382 -394 -12.5474 0.297
NP_441486.1_1 Forward -197 -183 -5.50694 0.242
NP_440403.1_10 Forward -381 -362 5.89931 0.238
NP_441634.1_8 Forward -396 -382 -1.5737 0.294
NP_440376.1_1 Reverse -185 -194 4.81794 0.149
NP_442687.1_7 Reverse -184 -194 6.27322 0.175
NP_441077.1_6 Forward -166 -150 3.57312 0.268
NP_442485.1_3 Reverse -364 -383 -0.885524 0.254
NP_440642.1_10 Reverse -162 -176 8.16044 0.209
NP_440642.1_10 Reverse -34 -48 1.27731 0.296
NP_441013.1_2 Forward -31 -13 -4.01242 0.295
NP_442483.1_6 Forward -238 -219 15.9282 0.173
NP_440667.1_2 Forward -365 -346 3.34271 0.189
NP_442658.1_1 Reverse -368 -378 11.1893 0.0915
NP_440141.1_3 Reverse -370 -389 8.16093 0.274
NP_442782.1_2 Forward -358 -344 2.16287 0.277
NP_442782.1_2 Reverse -331 -345 0.982901 0.282
NP_440656.1_8 Reverse -203 -222 -8.55534 0.273
NP_440607.1_5 Forward -396 -377 0.786102 0.269
NP_442321.1_4 Reverse -20 -39 -7.27704 0.284
NP_441958.1_5 Reverse -184 -194 -0.0199663 0.178
NP_442911.1_2 Forward -389 -370 -10.1286 0.27
NP_441654.1_7 Forward -343 -324 10.8874 0.299
NP_441041.1_4 Forward -384 -365 -7.37537 0.186
NP_441041.1_7 Forward -41 -29 8.2922 0.139
NP_442004.1_6 Reverse -385 -399 2.75286 0.257
NP_442941.1_3 Reverse -186 -196 5.5849 0.107
NP_440260.1_7 Reverse -24 -43 -4.91709 0.252
NP_440260.1_8 Reverse -327 -345 -7.749 0.3
NP_442012.1_1 Reverse -22 -41 2.26107 0.202
NP_442049.1_4 Reverse -376 -395 -6.78538 0.298
NP_442215.1_2 Reverse -382 -398 1.63183 0.13
NP_442215.1_2 Forward -18 -2 -7.41462 0.294
NP_442029.1_6 Forward -399 -380 9.83255 0.182
NP_440576.1_2 Reverse -321 -340 12.8808 0.189
NP_440430.1_6 Reverse -224 -242 17.7902 0.209
NP_442554.1_8 Forward -399 -389 1.84832 0.292
NP_440357.1_3 Reverse -367 -386 -0.688862 0.296
NP_440379.1_5 Reverse -381 -400 -9.63698 0.264
NP_440379.1_5 Reverse -327 -346 -11.4069 0.296
NP_441020.2_6 Forward -196 -179 8.7903 0.188
NP_441015.1_10 Forward -383 -364 -10.3253 0.284
NP_441764.1_6 Forward -280 -269 16.0866 0.293
NP_442868.1_6 Reverse -183 -193 -0.0199663 0.255
NP_442719.1_2 Reverse -280 -298 -10.6013 0.278
NP_440806.1_1 Reverse -81 -99 7.29564 0.273
NP_441612.1_2 Forward -394 -384 9.03335 0.21
NP_442808.1_1 Reverse -257 -267 8.23937 0.0547
NP_441114.1_3 Reverse -386 -395 6.29291 0.285
NP_441114.1_5 Reverse -20 -39 6.29264 0.262
NP_440558.1_2 Forward -382 -363 -3.24547 0.234
NP_440558.1_2 Forward -388 -369 -3.63879 0.237
NP_440558.1_2 Reverse -366 -385 -7.17871 0.289
NP_442593.1_9 Forward -350 -331 15.6875 0.257
NP_441557.1_5 Reverse -185 -194 -0.590259 0.219
NP_441557.1_8 Reverse -357 -367 14.6309 0.183
NP_441739.1_2 Forward -38 -22 3.89277 0.248
NP_441655.1_10 Reverse -25 -43 8.67227 0.157
NP_442494.1_7 Forward -398 -379 0.196116 0.246
NP_442347.1_2 Reverse -271 -280 13.5694 0.056
NP_442347.1_2 Reverse -386 -395 5.80125 0.219
NP_440136.1_1 Forward -361 -345 9.59593 0.24
NP_440136.1_2 Reverse -186 -193 4.16902 0.234
NP_442590.1_10 Forward -200 -181 6.39097 0.245
NP_442998.1_5 Forward -41 -31 11.7798 0.176
NP_440299.1_1 Reverse -13 -26 6.31189 0.146
NP_440299.1_1 Reverse -181 -194 6.0169 0.155
NP_440299.1_1 Forward -398 -385 5.42692 0.176
NP_442334.1_2 Reverse -184 -201 -6.94266 0.275
NP_440256.1_1 Forward -397 -378 0.687771 0.0814
NP_440915.1_6 Reverse -381 -395 -1.96703 0.254
NP_440915.1_6 Forward -369 -355 -2.85201 0.284
NP_440717.1_1 Forward -378 -359 5.60432 0.272
NP_440717.1_3 Reverse -351 -365 10.5204 0.231
NP_440657.1_3 Forward -238 -221 1.21881 0.277
NP_441464.1_10 Reverse -224 -238 9.34103 0.262
NP_440787.1_5 Forward -328 -314 13.1759 0.256
NP_441340.1_9 Forward -42 -32 8.25522 0.256
NP_439976.1_2 Forward -248 -229 11.0117 0.152
NP_439976.1_5 Reverse -107 -121 12.8803 0.257
NP_442251.1_6 Forward -15 -8 8.20058 0.23
NP_442959.1_4 Forward -384 -365 6.58763 0.224
NP_440027.1_3 Forward -394 -376 4.34495 0.262
NP_440027.1_3 Forward -234 -216 1.69003 0.299
NP_443051.1_1 Reverse -184 -193 -1.18024 0.297
NP_440398.1_6 Reverse -251 -270 3.14605 0.294
NP_440408.1_7 Forward -273 -254 15.8307 0.138
NP_440408.1_7 Reverse -369 -388 7.27595 0.29
NP_440372.1_3 Reverse -99 -113 15.6723 0.165
NP_440316.1_10 Forward -366 -356 5.38824 0.299
NP_441803.1_2 Forward -399 -380 3.73603 0.191
NP_441572.1_7 Reverse -1 -20 -4.72043 0.243
NP_440267.1_2 Reverse -209 -223 8.55376 0.162
NP_442384.1_10 Reverse -385 -398 8.57408 0.0641
NP_442384.1_10 Forward -194 -181 6.1158 0.11
NP_442035.1_6 Reverse -370 -389 11.7008 0.192
NP_440364.1_6 Reverse -378 -391 13.195 0.29
NP_441018.1_7 Reverse -327 -346 10.5209 0.202
NP_441689.1_5 Forward -196 -186 5.58445 0.23
NP_440344.1_10 Reverse -251 -268 -7.92597 0.12
NP_440344.1_10 Reverse -178 -195 -7.92597 0.12
NP_440531.1_6 Reverse -256 -275 -4.72043 0.286
NP_442123.1_1 Forward -396 -377 11.4058 0.137
NP_441060.1_6 Forward -345 -329 13.0382 0.254
NP_442910.1_1 Reverse -178 -197 -7.08038 0.254
NP_442693.1_7 Forward -376 -357 7.47261 0.282
NP_442102.1_3 Reverse -174 -193 14.9458 0.204
NP_442280.1_10 Reverse -216 -234 6.23363 0.28
NP_441592.1_4 Reverse -331 -350 -2.36049 0.262
NP_440894.1_10 Reverse -253 -272 5.50599 0.229
NP_441894.1_1 Forward -105 -86 -2.65548 0.155
NP_440888.1_2 Reverse -356 -370 7.66879 0.186
NP_440888.1_2 Forward -394 -380 7.17714 0.205
NP_440888.1_2 Reverse -185 -199 5.01387 0.298
NP_442454.1_2 Reverse -78 -97 9.59652 0.291
NP_442454.1_2 Reverse -234 -253 8.16414 0.291
NP_441268.1_7 Reverse -337 -356 11.0117 0.24
NP_442845.1_2 Forward -179 -165 5.21113 0.24
NP_441304.1_10 Forward -183 -174 13.8644 0.23
NP_442710.1_7 Forward -101 -82 -8.56828 0.299
NP_441462.1_2 Reverse -185 -195 -0.609952 0.24
NP_443062.1_1 Reverse -164 -182 4.45062 0.26
NP_442204.1_1 Forward -227 -216 0.550326 0.281
NP_441560.1_10 Reverse -177 -196 5.80098 0.292
NP_440516.1_8 Forward -267 -258 -0.590259 0.283
NP_441052.1_2 Reverse -385 -395 5.09324 0.132
NP_441052.1_2 Forward -394 -384 4.10993 0.166
NP_442864.1_2 Forward -393 -374 10.3242 0.272
NP_441004.1_1 Forward -399 -380 -7.4737 0.198
NP_441004.1_1 Forward -363 -344 -7.76869 0.2
NP_441004.1_2 Forward -368 -349 4.42435 0.195
NP_441004.1_4 Forward -360 -350 8.73149 0.267
NP_442813.1_4 Reverse -219 -238 -1.47551 0.239
NP_442366.1_1 Forward -60 -47 17.8172 0.245
NP_442366.1_5 Reverse -182 -192 10.206 0.282
NP_439949.1_7 Reverse -26 -40 9.73436 0.296
NP_441729.1_1 Forward -344 -325 17.3057 0.212
NP_442694.1_4 Reverse -225 -234 16.126 0.164
NP_441851.1_10 Reverse -184 -194 8.04317 0.124
NP_442856.1_7 Reverse -376 -395 -3.83545 0.251
NP_441668.1_10 Reverse -165 -182 9.28121 0.276
NP_442515.1_1 Reverse -184 -198 0.786239 0.18
NP_441982.1_6 Reverse -204 -213 12.5809 0.274
NP_441046.1_2 Reverse -331 -350 -1.37718 0.288
NP_441349.1_10 Forward -289 -270 -5.11376 0.192
NP_442024.1_4 Reverse -361 -380 11.9958 0.199
NP_440431.1_3 Forward -341 -322 7.27595 0.0886
NP_440431.1_3 Reverse -66 -85 -11.0136 0.28
NP_440588.1_2 Reverse -182 -201 -3.93378 0.2
NP_440943.1_1 Forward -353 -334 14.1591 0.216
NP_442006.1_2 Forward -188 -171 -16.8741 0.265
NP_440078.1_4 Reverse -174 -193 11.4058 0.237
NP_441078.1_4 Reverse -385 -394 5.01461 0.122
NP_441078.1_4 Forward -194 -185 -2.06522 0.295
NP_442729.1_8 Forward -198 -185 9.06573 0.125
NP_442348.1_2 Forward -218 -209 12.2911 0.218
NP_442348.1_2 Reverse -29 -38 12.2911 0.218
NP_442348.1_2 Reverse -28 -37 7.57121 0.28
NP_442443.1_1 Forward -383 -364 -3.73712 0.267
NP_442443.1_4 Forward -99 -89 16.1058 0.155
NP_441094.1_3 Reverse -223 -240 11.7402 0.159
NP_441432.1_9 Reverse -282 -295 12.0888 0.221
NP_441432.1_9 Reverse -80 -93 8.11358 0.294
NP_441945.1_10 Forward -195 -176 7.07928 0.29
NP_442353.1_4 Reverse -379 -398 -0.787962 0.291
NP_440913.1_1 Forward -396 -378 16.1454 0.0953
NP_442727.1_1 Reverse -224 -238 12.586 0.259
NP_442400.1_10 Forward -339 -326 7.51014 0.284
NP_442489.1_7 Reverse -385 -394 5.21127 0.077
NP_442913.1_10 Reverse -376 -395 -2.36049 0.184
NP_440336.1_1 Forward -114 -95 13.0775 0.286
NP_439956.1_7 Reverse -325 -344 5.40766 0.257
NP_441923.1_5 Forward -20 -2 16.6371 0.167
NP_442934.1_9 Forward -332 -314 17.0304 0.169
NP_440459.1_10 Forward -313 -294 14.4541 0.217
NP_440010.1_3 Reverse -358 -377 4.22769 0.175
NP_440010.1_3 Forward -377 -358 -4.81876 0.25
NP_442799.1_8 Forward -340 -321 9.93819 0.201
NP_442699.1_8 Reverse -198 -217 -11.8003 0.238
NP_442045.1_5 Reverse -251 -270 -2.16383 0.294
NP_440875.1_9 Forward -397 -387 7.00932 0.287
NP_440590.1_4 Forward -393 -380 1.00259 0.136
NP_440590.1_4 Forward -266 -253 -5.97891 0.296
NP_442497.1_10 Forward -193 -184 0.589713 0.153
NP_441239.1_9 Reverse -368 -380 9.38042 0.108
NP_441239.1_9 Reverse -197 -209 4.95553 0.234
NP_441951.1_4 Forward -378 -359 5.99764 0.273
NP_442270.1_9 Forward -398 -379 -2.55715 0.178
NP_442643.1_3 Reverse -379 -398 -5.01543 0.261
NP_441017.1_6 Forward -232 -218 11.1104 0.279
NP_442216.1_4 Forward -36 -28 8.1805 0.255
NP_440212.1_9 Forward -101 -82 8.53829 0.146
NP_440212.1_9 Reverse -79 -98 5.65501 0.169
NP_442052.1_7 Forward -383 -369 17.0108 0.153
NP_440462.1_4 Reverse -224 -238 10.1277 0.242
NP_442787.1_9 Forward -69 -50 12.3892 0.296
NP_442402.1_4 Reverse -262 -281 -0.787962 0.189
NP_442402.1_10 Reverse -56 -66 12.1726 0.222
NP_442402.1_10 Forward -35 -25 10.5993 0.287
NP_441848.1_4 Reverse -140 -156 8.50558 0.288
NP_441848.1_4 Forward -103 -87 8.3146 0.288
NP_439942.1_7 Reverse -15 -34 -0.39387 0.228
NP_442923.1_4 Forward -393 -374 2.0644 0.179
NP_442039.1_7 Reverse -180 -190 7.15819 0.279
NP_442039.1_7 Reverse -372 -382 6.8632 0.292
NP_441811.1_4 Reverse -365 -384 7.96426 0.166
NP_442829.1_2 Forward -328 -312 19.4472 0.12
NP_440160.1_5 Forward -336 -326 15.9091 0.267
NP_440914.1_1 Reverse -385 -395 6.76087 0.267
NP_440914.1_1 Forward -234 -224 6.66328 0.269
NP_442533.1_6 Reverse -385 -394 5.89959 0.125
NP_442533.1_6 Forward -194 -185 4.12963 0.191
NP_442533.1_6 Reverse -391 -400 1.57302 0.294
NP_442541.1_10 Reverse -170 -184 5.70218 0.248
NP_442541.1_10 Forward -379 -365 3.93223 0.252
NP_440854.1_5 Reverse -78 -92 14.6219 0.274
NP_441482.1_7 Reverse -179 -193 -10.8168 0.216
NP_441028.1_6 Reverse -271 -281 3.8145 0.281
NP_441028.1_6 Forward -192 -182 3.8145 0.281
NP_441527.1_4 Forward -340 -321 -5.68219 0.206
NP_441527.1_4 Forward -178 -159 -12.8441 0.294
NP_440007.1_9 Reverse -381 -395 1.08123 0.29
NP_442728.1_7 Forward -235 -221 20.5508 0.0738
NP_442588.1_6 Forward -226 -207 7.66927 0.173
NP_440886.1_7 Forward -268 -258 5.68278 0.168
NP_440828.1_1 Reverse -355 -374 4.12856 0.219
NP_440828.1_1 Forward -244 -225 0.686995 0.261
NP_442382.1_6 Reverse -372 -385 15.9639 0.285
NP_442717.1_4 Forward -34 -15 1.27776 0.296
NP_440907.2_8 Forward -193 -183 5.78111 0.188
NP_441401.1_4 Forward -326 -313 16.0472 0.133
NP_441962.1_9 Reverse -379 -398 5.211 0.28
NP_440114.1_8 Reverse -114 -133 11.1109 0.287
NP_442323.1_7 Reverse -343 -362 1.08032 0.292
NP_440422.1_10 Reverse -308 -327 8.2744 0.212
NP_440422.1_10 Reverse -286 -305 5.75726 0.263
NP_442930.1_1 Forward -247 -237 11.7793 0.257
NP_442867.1_8 Reverse -171 -190 10.4225 0.208
NP_441489.1_3 Forward -336 -322 10.4202 0.232
NP_442936.1_10 Forward -161 -147 9.07246 0.269
NP_441885.1_2 Reverse -375 -394 11.7008 0.281
NP_441885.1_5 Reverse -185 -195 0.373358 0.164
NP_441885.1_5 Reverse -385 -395 -0.904945 0.241
NP_441275.1_3 Reverse -236 -250 18.0925 0.105
NP_441207.1_7 Forward -329 -315 9.06177 0.282
NP_440216.1_9 Forward -171 -162 12.9794 0.213
NP_440216.1_9 Forward -227 -218 10.1278 0.286
NP_442371.1_1 Reverse -25 -35 13.4509 0.206
NP_442015.1_10 Forward -398 -385 -0.472371 0.268
NP_442015.1_10 Reverse -181 -194 -0.669033 0.277
NP_441226.1_7 Forward -193 -186 8.88855 0.165
NP_441226.1_7 Forward -372 -365 6.82361 0.246
NP_441111.1_7 Forward -193 -185 -0.570565 0.233
NP_442252.1_3 Forward -274 -256 11.6222 0.169
NP_440416.1_9 Reverse -368 -387 -17.9951 0.25
NP_443052.1_9 Reverse -368 -387 -4.32711 0.257
NP_443052.1_9 Forward -389 -370 -6.49039 0.283
NP_442226.1_8 Forward -213 -203 13.353 0.263
NP_440988.1_10 Forward -380 -366 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCCCTGGGCATCGACAGTGGTGCCAGTGCCGTCCGGAGCTGGGGTAATGTTTTGGGCCAGAACATTGCCAGAAAAACTAGACGAACAAGCCAGTAAAGCTAGGCAAAAGAGGCGTAAACTGGGGTTCAACACGGCTATCAGGGGTGAAATTAACAATATTTCCACCACAAAGCCCAGGGAAGGGACTTTTTGGCCAGTCCATTATAGCGGTCCCCCAGGTGGAATTAGGCATGGAAAAGAACGAATTATTTTAGTACTTCAGATAGTTCTTTGCTTCCTAGACGGCTAAATTTAACTCAGAAAAGCAAAAAGTGTTTTATTTGAGCATCCGTTTTCGGGAAACTAGTTAAGATGTGGAAGGGAAAATTCCCCCAGATATGGTTCTAGATCACTCTTGGA

CDS

GTGTTATTTACAGGCACGGCTATGGAAAATATTGTCAATAATGTGGAAGAGTATCTGTTATCGAGGGAAGAACGGATTCTCCAGGTGCGTAACTTGGTAGAAACCCTCCGGGCCGCCGAAGAAATTGCCAAGCAGGGGTATTTAATTACCAGTTCGGAGTTGGCTGACTTGATGGATATTAACCCCAGTGCCGTCACCAGTCGGGGGGATCATTGGTCATGGCGTAACTGGGTCGTTTCCAGGGTGAGAAGGGAAGGGAACCAAATCCTCTGGCAGTTGGAGCGGGTAGACTAA

Protein

MLFTGTAMENIVNNVEEYLLSREERILQVRNLVETLRAAEEIAKQGYLITSSELADLMDINPSAVTSRGDHWSWRNWVVSRVRREGNQILWQLERVD