Your browser is old and dusty. Try Google Chrome!

Details for ssl1911

ORF ssl1911
Accession NP_440470.1
Symbol gifA
Category glutamine synthetase inactivating factor IF7
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -375 -389 -1.77037 0.272
NP_440557.1_1 Reverse -196 -215 -0.590531 0.27
NP_440795.1_7 Reverse -148 -155 8.8889 0.188
NP_440815.1_2 Reverse -239 -253 13.372 0.234
NP_441453.1_4 Forward -156 -148 11.6225 0.0403
NP_441453.1_7 Forward -306 -299 13.4121 0.23
NP_441623.1_1 Reverse -115 -133 -3.6191 0.262
NP_440637.1_7 Reverse -119 -138 10.7175 0.259
NP_442173.1_1 Reverse -16 -24 5.13263 0.226
NP_443027.1_4 Forward -112 -102 6.76487 0.269
NP_441675.1_4 Forward -115 -96 3.24438 0.277
NP_441054.1_2 Reverse -216 -235 10.5209 0.284
NP_441476.1_5 Forward -223 -204 -6.78538 0.276
NP_442062.1_8 Reverse -15 -25 7.74818 0.0897
NP_442062.1_8 Forward -204 -194 4.69992 0.201
NP_442062.1_8 Reverse -226 -236 4.40493 0.217
NP_442242.1_1 Reverse -222 -241 15.5316 0.29
NP_439918.1_2 Reverse -350 -369 12.6841 0.109
NP_441200.1_4 Reverse -298 -317 6.58763 0.272
NP_441208.1_9 Reverse -204 -218 4.91614 0.282
NP_441925.1_2 Reverse -332 -351 0.294447 0.295
NP_441402.1_9 Forward -211 -192 17.5015 0.255
NP_440856.1_4 Forward -211 -192 -5.40875 0.288
NP_442889.1_8 Forward -69 -55 4.32555 0.27
NP_440447.1_1 Forward -209 -191 2.18243 0.285
NP_441713.1_1 Reverse -189 -208 -15.1435 0.26
NP_441770.1_4 Reverse -201 -220 4.12936 0.12
NP_441327.1_1 Forward -73 -54 9.6916 0.203
NP_441327.1_5 Forward -328 -319 13.9627 0.261
NP_440851.1_6 Reverse -205 -222 -0.0594896 0.288
NP_440747.1_10 Reverse -12 -24 -4.68091 0.115
NP_440747.1_10 Forward -207 -195 -12.1541 0.227
NP_441486.1_1 Reverse -12 -26 -4.7203 0.205
NP_441486.1_1 Forward -246 -232 -5.70361 0.254
NP_440470.1_4 Forward -124 -108 15.9882 0.258
NP_440470.1_6 Forward -68 -52 24.7396 0.0129
NP_440470.1_7 Forward -338 -319 18.8913 0.16
NP_440842.1_6 Forward -181 -162 14.2566 0.171
NP_443018.1_3 Reverse -235 -242 8.39725 0.147
NP_443018.1_3 Forward -155 -148 4.56234 0.241
NP_443018.1_3 Reverse -148 -155 4.46401 0.244
NP_440376.1_1 Forward -204 -195 3.7363 0.195
NP_441588.1_4 Reverse -17 -27 5.68323 0.245
NP_441588.1_4 Reverse -236 -246 5.19158 0.282
NP_442687.1_7 Reverse -194 -204 5.09324 0.221
NP_442687.1_7 Forward -25 -15 4.79825 0.234
NP_441077.1_6 Reverse -241 -257 10.418 0.163
NP_441077.1_6 Forward -86 -70 3.38031 0.271
NP_441846.1_10 Forward -126 -107 -22.6167 0.264
NP_442530.1_2 Reverse -247 -257 14.4347 0.204
NP_440141.1_8 Reverse -299 -318 15.3391 0.151
NP_442544.1_4 Reverse -72 -91 6.19431 0.194
NP_442653.1_1 Forward -92 -73 0.196116 0.29
NP_441127.1_1 Forward -307 -293 10.816 0.242
NP_440984.1_7 Reverse -10 -24 6.48943 0.214
NP_442690.1_1 Forward -104 -85 -5.31042 0.157
NP_442690.1_1 Forward -75 -56 -5.31042 0.157
NP_442690.1_1 Forward -272 -253 -5.40875 0.157
NP_442690.1_1 Reverse -27 -46 -14.1602 0.269
NP_442911.1_2 Reverse -185 -204 -9.24366 0.252
NP_440325.1_1 Forward -81 -62 13.2741 0.225
NP_442064.1_1 Forward -255 -236 -7.86702 0.255
NP_440200.1_7 Reverse -255 -274 4.5998 0.291
NP_440138.1_6 Reverse -217 -236 3.44025 0.245
NP_440850.1_6 Reverse -192 -211 9.73422 0.216
NP_441099.1_5 Reverse -217 -236 -11.1119 0.271
NP_440411.1_10 Reverse -192 -211 8.60263 0.297
NP_440377.1_1 Forward -85 -68 10.6939 0.293
NP_440147.1_4 Reverse -145 -158 -0.767364 0.299
NP_441125.1_6 Reverse -91 -104 13.0973 0.244
NP_441175.1_7 Reverse -195 -214 4.81767 0.296
NP_440345.1_3 Reverse -333 -347 13.667 0.219
NP_440345.1_3 Reverse -318 -332 13.3805 0.219
NP_440569.1_6 Reverse -177 -196 5.50599 0.228
NP_440260.1_8 Reverse -191 -209 -5.68405 0.276
NP_440260.1_8 Reverse -205 -223 -6.66736 0.294
NP_441678.1_9 Forward -236 -217 10.4225 0.17
NP_442281.1_1 Reverse -229 -243 2.26061 0.272
NP_440437.1_1 Forward -210 -191 2.45773 0.133
NP_442982.1_5 Forward -214 -195 -2.0655 0.281
NP_441644.1_6 Reverse -234 -244 3.42118 0.282
NP_442215.1_2 Forward -26 -10 -5.54633 0.251
NP_442215.1_2 Forward -252 -236 -7.21796 0.289
NP_442933.1_10 Forward -24 -15 4.22796 0.267
NP_440891.1_8 Forward -339 -320 14.1715 0.268
NP_442926.1_1 Forward -392 -373 0.0977854 0.24
NP_442554.1_4 Forward -225 -206 6.68596 0.291
NP_442167.1_1 Forward -41 -22 12.3892 0.244
NP_442313.1_5 Reverse -195 -214 3.83436 0.284
NP_442142.1_4 Reverse -12 -25 9.95012 0.083
NP_443009.1_5 Reverse -365 -376 10.7762 0.0738
NP_443009.1_5 Reverse -14 -25 10.2846 0.0792
NP_443009.1_5 Forward -205 -194 4.48308 0.244
NP_441371.1_3 Reverse -201 -219 7.39397 0.277
NP_440183.1_9 Reverse -202 -221 -20.65 0.29
NP_441198.1_8 Forward -377 -367 11.5134 0.202
NP_441198.1_8 Forward -158 -148 11.2205 0.217
NP_440379.1_5 Reverse -191 -210 -1.08219 0.184
NP_440379.1_5 Reverse -218 -237 -11.1119 0.288
NP_441468.1_1 Reverse -148 -155 3.97235 0.277
NP_441876.1_9 Reverse -294 -304 10.3043 0.295
NP_443004.2_2 Forward -99 -80 18.5853 0.135
NP_441637.1_9 Reverse -30 -48 5.52568 0.245
NP_441637.1_9 Reverse -185 -203 -4.30741 0.296
NP_441764.1_1 Forward -105 -86 13.8641 0.116
NP_441764.1_4 Reverse -86 -103 15.0427 0.123
NP_442719.1_2 Reverse -185 -203 -5.29143 0.218
NP_442719.1_2 Forward -33 -15 -9.22465 0.261
NP_442719.1_2 Forward -333 -315 -9.51964 0.266
NP_441612.1_2 Forward -300 -290 8.83972 0.21
NP_442559.1_3 Reverse -231 -250 10.3242 0.231
NP_442227.1_2 Reverse -103 -122 -2.36049 0.272
NP_442808.1_1 Forward -237 -227 0.864583 0.3
NP_440630.1_3 Forward -167 -148 3.44104 0.224
NP_440601.1_9 Reverse -201 -220 11.0125 0.246
NP_441878.1_6 Reverse -146 -156 -7.68978 0.255
NP_442650.1_2 Forward -389 -375 3.14618 0.217
NP_441557.1_5 Reverse -15 -24 -0.885252 0.26
NP_440084.1_8 Forward -59 -45 10.6112 0.266
NP_441739.1_2 Forward -47 -31 4.28609 0.245
NP_442183.1_1 Reverse -366 -380 4.91614 0.239
NP_442347.1_2 Forward -388 -379 6.19458 0.182
NP_442645.1_2 Reverse -7 -26 -17.9951 0.267
NP_442317.1_8 Reverse -70 -89 19.6656 0.134
NP_442590.1_10 Reverse -203 -222 3.24438 0.294
NP_442998.1_5 Reverse -239 -249 11.4848 0.184
NP_442998.1_5 Forward -341 -331 10.2065 0.222
NP_442998.1_5 Forward -300 -290 7.35486 0.295
NP_440709.1_1 Forward -93 -74 7.96345 0.109
NP_441559.1_8 Reverse -190 -204 3.53951 0.143
NP_441559.1_8 Forward -209 -195 -0.000409212 0.171
NP_441559.1_8 Reverse -361 -375 -5.40861 0.261
NP_440915.1_6 Forward -379 -365 -1.18038 0.224
NP_440733.1_2 Reverse -27 -45 16.2356 0.105
NP_441464.1_8 Reverse -366 -380 9.5377 0.189
NP_440570.1_5 Reverse -217 -236 -3.83545 0.296
NP_441340.1_5 Forward -155 -148 11.0522 0.0749
NP_440327.1_3 Reverse -129 -148 13.2741 0.286
NP_442240.1_1 Forward -319 -300 4.32522 0.273
NP_441027.1_1 Reverse -120 -134 10.1271 0.299
NP_440586.1_8 Reverse -235 -242 7.21693 0.27
NP_442251.1_6 Reverse -16 -23 8.69224 0.199
NP_439937.1_9 Forward -205 -188 -0.0601847 0.109
NP_439937.1_9 Reverse -314 -331 -11.9582 0.269
NP_440439.1_1 Forward -207 -194 -0.472371 0.221
NP_442783.1_2 Reverse -201 -220 9.53756 0.266
NP_440378.1_6 Forward -194 -175 16.1257 0.21
NP_440819.1_5 Forward -219 -211 17.424 0.185
NP_439977.1_6 Forward -220 -202 18.112 0.241
NP_440267.1_2 Forward -209 -195 8.16044 0.173
NP_442384.1_10 Reverse -195 -208 5.13249 0.137
NP_441877.1_9 Forward -40 -23 1.31714 0.299
NP_442262.1_10 Reverse -235 -242 10.7572 0.124
NP_442262.1_10 Forward -155 -148 7.90559 0.266
NP_440531.1_6 Reverse -201 -220 -2.0655 0.244
NP_441060.1_4 Forward -200 -182 9.16393 0.186
NP_441060.1_4 Reverse -339 -357 6.01734 0.241
NP_442910.1_1 Forward -139 -120 1.57275 0.131
NP_441965.1_10 Forward -378 -362 6.35172 0.179
NP_442750.1_1 Reverse -20 -39 10.3234 0.255
NP_442529.1_4 Reverse -168 -187 7.37428 0.289
NP_442378.1_1 Reverse -74 -91 16.4601 0.22
NP_440894.1_10 Reverse -188 -207 2.0644 0.298
NP_442067.1_4 Reverse -198 -217 1.96607 0.299
NP_440999.1_9 Reverse -191 -205 6.19444 0.101
NP_440803.1_3 Reverse -191 -210 4.916 0.259
NP_439969.1_3 Reverse -190 -209 -0.295539 0.271
NP_441543.1_2 Forward -65 -56 4.32629 0.26
NP_442845.1_2 Forward -249 -235 3.63784 0.282
NP_441551.1_4 Forward -378 -359 14.1591 0.206
NP_440710.1_1 Reverse -131 -149 -7.45401 0.238
NP_440220.1_4 Forward -41 -22 -0.0996487 0.257
NP_440148.1_1 Reverse -27 -46 -3.3438 0.219
NP_442204.1_5 Forward -246 -227 6.98095 0.139
NP_442428.1_5 Reverse -148 -155 4.36568 0.271
NP_442428.1_7 Forward -37 -18 8.55425 0.213
NP_440603.1_5 Reverse -192 -211 11.2092 0.183
NP_440673.1_3 Reverse -17 -24 11.3472 0.085
NP_441714.1_3 Reverse -8 -26 14.768 0.169
NP_442219.1_8 Forward -135 -116 6.71761 0.291
NP_440436.1_4 Reverse -16 -25 10.4224 0.0777
NP_440436.1_4 Forward -23 -14 4.42421 0.265
NP_441321.1_5 Forward -218 -199 9.93088 0.21
NP_440314.1_1 Reverse -74 -93 27.9255 0.000618
NP_440314.1_1 Forward -89 -70 25.9588 0.00119
NP_441004.1_1 Forward -389 -370 -14.5535 0.268
NP_442813.1_2 Forward -108 -89 6.68596 0.191
NP_442813.1_4 Forward -319 -300 -1.27885 0.239
NP_442813.1_4 Forward -359 -340 -1.47551 0.239
NP_442366.1_3 Forward -25 -7 4.05072 0.101
NP_442366.1_5 Forward -246 -236 11.2876 0.197
NP_442206.1_10 Forward -389 -374 3.12649 0.191
NP_442206.1_10 Reverse -147 -162 0.176559 0.269
NP_441851.1_2 Reverse -19 -38 6.58763 0.181
NP_441851.1_10 Forward -376 -366 11.2881 0.0765
NP_441851.1_10 Reverse -14 -24 5.5849 0.207
NP_441157.1_1 Forward -42 -28 14.3553 0.136
NP_441542.1_4 Forward -282 -268 5.50613 0.264
NP_442515.1_1 Reverse -191 -205 1.27789 0.165
NP_441982.1_6 Reverse -21 -30 12.7718 0.274
NP_441982.1_6 Forward -220 -211 12.4854 0.275
NP_441982.1_6 Forward -329 -320 12.1034 0.288
NP_440463.1_8 Forward -317 -298 5.75726 0.277
NP_442689.1_8 Forward -71 -54 0.628827 0.191
NP_442689.1_8 Forward -268 -251 -5.76269 0.276
NP_440432.1_9 Reverse -367 -382 -2.97003 0.177
NP_442843.1_1 Forward -382 -363 -11.8986 0.295
NP_441994.1_1 Reverse -332 -346 16.6684 0.195
NP_441124.1_5 Forward -78 -68 11.4803 0.254
NP_440431.1_3 Reverse -14 -33 -0.590531 0.144
NP_442168.1_6 Reverse -98 -117 7.47261 0.23
NP_440195.1_4 Reverse -248 -267 5.01433 0.29
NP_440943.1_1 Reverse -186 -205 8.94757 0.29
NP_442006.1_2 Reverse -341 -358 -10.1876 0.197
NP_441570.1_1 Forward -389 -371 -2.14413 0.0626
NP_441078.1_4 Reverse -195 -204 -1.96689 0.282
NP_442348.1_2 Reverse -315 -324 12.2911 0.218
NP_442348.1_2 Reverse -314 -323 7.57121 0.28
NP_442443.1_1 Reverse -201 -220 0.491109 0.218
NP_442443.1_4 Reverse -244 -254 16.1058 0.155
NP_440526.1_3 Forward -23 -12 4.58141 0.267
NP_440759.1_6 Reverse -240 -259 11.3075 0.0717
NP_441805.1_2 Reverse -270 -289 -4.32711 0.275
NP_441057.1_4 Reverse -205 -223 4.9357 0.211
NP_442489.1_7 Reverse -15 -24 -1.77023 0.247
NP_442489.1_7 Forward -204 -195 -1.86856 0.259
NP_440559.1_1 Forward -23 -14 4.71961 0.217
NP_441659.2_8 Forward -24 -14 3.12662 0.172
NP_440786.1_9 Forward -86 -67 13.3725 0.288
NP_441022.1_1 Forward -37 -28 15.0954 0.183
NP_441022.1_1 Reverse -27 -36 12.4095 0.232
NP_441022.1_1 Forward -192 -183 10.8747 0.284
NP_442913.1_10 Forward -210 -191 3.83436 0.0985
NP_441040.1_2 Reverse -198 -217 -16.2252 0.294
NP_442346.1_5 Reverse -146 -156 9.12481 0.118
NP_441856.1_3 Reverse -192 -211 -3.83545 0.3
NP_440025.1_3 Reverse -34 -48 9.64265 0.294
NP_440025.1_4 Reverse -198 -217 14.8474 0.222
NP_441786.1_10 Reverse -299 -318 8.55425 0.233
NP_440010.1_10 Reverse -222 -241 3.83436 0.25
NP_440449.1_6 Forward -244 -226 12.7299 0.113
NP_440170.1_6 Forward -236 -217 17.2074 0.125
NP_440671.1_5 Reverse -109 -123 13.4703 0.293
NP_442404.1_9 Forward -201 -187 13.372 0.263
NP_442943.1_1 Forward -84 -69 14.303 0.0893
NP_442943.1_1 Reverse -68 -83 3.67984 0.26
NP_442140.1_3 Forward -155 -145 7.94484 0.124
NP_442089.1_1 Forward -182 -163 -0.787193 0.261
NP_441239.1_9 Reverse -198 -210 2.98891 0.3
NP_442044.1_1 Forward -209 -190 -4.32711 0.177
NP_442270.1_9 Forward -229 -210 -3.54046 0.184
NP_440833.1_6 Forward -326 -312 10.6187 0.242
NP_442216.1_4 Forward -322 -314 8.1805 0.255
NP_442216.1_4 Reverse -125 -133 8.08217 0.255
NP_442216.1_5 Forward -85 -66 13.3725 0.288
NP_440212.1_9 Forward -44 -25 7.96164 0.146
NP_441617.1_6 Reverse -317 -336 2.0644 0.2
NP_442138.1_10 Forward -389 -370 2.65439 0.117
NP_440546.1_4 Forward -156 -146 10.3369 0.109
NP_440546.1_4 Reverse -147 -157 8.6886 0.176
NP_440546.1_4 Reverse -387 -397 7.52511 0.235
NP_440546.1_6 Forward -199 -180 7.57094 0.268
NP_440546.1_7 Reverse -200 -210 15.8113 0.237
NP_442131.1_1 Forward -382 -363 -7.57203 0.224
NP_442499.1_3 Reverse -146 -164 6.01734 0.282
NP_441848.1_7 Reverse -328 -347 -3.93454 0.286
NP_439942.1_2 Reverse -237 -256 12.2108 0.271
NP_442039.1_7 Forward -305 -295 11.3864 0.257
NP_440505.1_3 Reverse -347 -357 8.04317 0.147
NP_440505.1_7 Forward -208 -189 -0.197208 0.268
NP_441011.1_8 Reverse -148 -157 11.6028 0.0754
NP_440724.1_6 Reverse -222 -241 6.78429 0.297
NP_440263.1_5 Reverse -188 -202 7.57108 0.294
NP_439944.1_9 Reverse -148 -158 10.8948 0.0887
NP_440816.1_2 Reverse -238 -257 7.40308 0.266
NP_441028.1_6 Reverse -293 -303 8.3377 0.216
NP_441028.1_6 Reverse -336 -346 8.04271 0.217
NP_441028.1_6 Reverse -211 -221 7.15773 0.23
NP_441028.1_6 Reverse -294 -304 4.10949 0.278
NP_442202.1_6 Forward -201 -182 1.86774 0.265
NP_441527.1_4 Reverse -250 -269 -5.10924 0.195
NP_441527.1_7 Reverse -104 -123 8.55343 0.282
NP_441972.1_5 Reverse -175 -194 -9.24366 0.282
NP_441106.1_3 Reverse -71 -90 9.93088 0.29
NP_442306.1_10 Reverse -361 -380 -11.5053 0.133
NP_442674.1_2 Forward -329 -310 13.0775 0.208
NP_441809.1_10 Forward -88 -70 19.3903 0.185
NP_440670.1_8 Reverse -15 -24 3.83464 0.219
NP_439899.1_1 Forward -108 -90 10.0275 0.165
NP_442022.1_4 Reverse -284 -303 12.9791 0.168
NP_440907.2_8 Reverse -367 -377 4.01116 0.283
NP_440666.1_3 Reverse -102 -121 14.6508 0.107
NP_441205.1_5 Reverse -31 -50 17.5015 0.222
NP_441401.1_10 Reverse -330 -349 19.3707 0.289
NP_441401.1_10 Forward -337 -318 13.7658 0.289
NP_441431.1_2 Forward -159 -145 10.1271 0.169
NP_440114.1_10 Reverse -147 -161 10.521 0.146
NP_440114.1_10 Reverse -349 -363 10.0294 0.155
NP_442090.1_2 Forward -99 -80 18.6683 0.119
NP_442090.1_2 Reverse -80 -99 5.39487 0.3
NP_442698.1_10 Reverse -236 -255 2.3594 0.284
NP_441156.1_1 Forward -123 -104 11.8975 0.229
NP_440766.1_5 Forward -344 -332 9.08817 0.277
NP_442680.1_7 Forward -335 -316 -4.13045 0.265
NP_440801.1_8 Reverse -233 -252 -0.688862 0.273
NP_442561.1_1 Reverse -71 -90 19.174 0.172
NP_442561.1_1 Forward -92 -73 17.994 0.177
NP_442509.1_9 Forward -216 -206 7.55106 0.214
NP_442936.1_10 Forward -38 -24 18.8343 0.216
NP_442703.1_9 Reverse -249 -267 3.55906 0.288
NP_442395.2_3 Reverse -300 -318 16.6371 0.243
NP_440423.1_6 Forward -149 -130 -21.1417 0.284
NP_441842.1_1 Forward -202 -189 13.785 0.133
NP_441842.1_1 Forward -373 -360 11.0318 0.275
NP_442638.1_3 Forward -52 -33 12.3658 0.298
NP_442373.1_2 Forward -392 -373 -1.27885 0.198
NP_440216.1_1 Reverse -195 -209 -3.147 0.0729
NP_441844.1_1 Reverse -73 -92 15.0441 0.146
NP_442015.1_10 Reverse -376 -389 6.70579 0.108
NP_440416.1_9 Forward -318 -299 -10.6203 0.143
NP_440845.1_1 Forward -133 -114 -3.73712 0.206
NP_440261.1_5 Forward -374 -361 -8.43718 0.201
NP_440261.1_5 Forward -23 -10 -11.0921 0.237
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCAACAGATAGGTGGTCCCAATGGTGGGATGCCCTGCAAAATCCAATTCCCTTTTGGGGGTAAAAATTCTTAGGCGAAAATTCCCCGTTTCCGTCACTGGGGGCAAAACAAACACCGTTTCGGAATAATTGATTTCCGCTGCAATTTTTTGCATTTGTCCATCGGTCAAACCCTCAGCATCGGGAAAAACCGCCAGGGGATTACCGCCAAAAAGTTGGTCAGTGAACACGTCAAGGGTATAGAAGCCATAGCGCATAGGTCTAACTGGGGAATTGAACACAGGGAAGAAGGGGATGTAAATTTTTGTTTCTGTATAAAATGTTACAGAATTTGTGCTATAAATATTAAAGAGGGTAATTAACCAAAACTTTTTTCAGCAATCGTCAAGAGGTATTAACT

CDS

ATGTCTACTCAACAACAGGCTCGCGCTCTCATGATGCGCCACCACCAATTCATCAAAAACCGTCAACAATCCATGTTGTCCCGCGCTGCCGCTGAGATTGGCGTGGAAGCAGAAAAGGATTTTTGGACCACTGTGCAGGGCAAACCTCAATCCAGTTTCCGCACAACCTATGACCGCAGTAATGCTTCCCTGAGCTAG

Protein

MSTQQQARALMMRHHQFIKNRQQSMLSRAAAEIGVEAEKDFWTTVQGKPQSSFRTTYDRSNASLS