Your browser is old and dusty. Try Google Chrome!

Details for ssl1690

ORF ssl1690
Accession NP_442401.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -198 -184 7.86607 0.0956
NP_441061.1_2 Reverse -261 -275 -1.8687 0.274
NP_440795.1_7 Forward -268 -261 14.6904 0.0123
NP_440795.1_7 Reverse -261 -268 14.6904 0.0123
NP_441418.1_6 Reverse -260 -279 -11.8003 0.0565
NP_441480.1_1 Reverse -303 -322 -0.688862 0.287
NP_442291.1_5 Forward -247 -231 2.02515 0.135
NP_442291.1_5 Reverse -259 -275 -3.08806 0.234
NP_442291.1_7 Reverse -185 -199 9.14437 0.291
NP_440897.1_6 Forward -104 -85 1.57197 0.17
NP_440897.1_6 Reverse -260 -279 -0.787962 0.185
NP_440897.1_6 Forward -269 -250 -2.06626 0.203
NP_441453.1_1 Forward -276 -258 7.68819 0.211
NP_441453.1_4 Reverse -260 -268 16.539 0.00633
NP_441453.1_4 Forward -269 -261 16.539 0.00633
NP_441453.1_7 Forward -121 -114 13.4121 0.23
NP_441623.1_1 Forward -395 -377 -2.63579 0.241
NP_441623.1_1 Forward -276 -258 -4.01242 0.274
NP_441960.1_3 Reverse -260 -279 19.6213 0.116
NP_442151.1_1 Reverse -187 -206 6.88262 0.286
NP_442151.1_6 Forward -269 -255 8.84938 0.164
NP_442151.1_6 Reverse -260 -274 8.65272 0.167
NP_442838.1_7 Forward -274 -255 -10.4236 0.232
NP_441818.1_1 Forward -268 -257 15.4961 0.0264
NP_440226.1_1 Forward -269 -250 7.57094 0.103
NP_440226.1_1 Reverse -260 -279 1.86774 0.286
NP_441630.1_3 Forward -277 -258 4.12936 0.173
NP_440259.1_4 Forward -299 -285 9.31072 0.278
NP_441098.1_3 Reverse -319 -338 13.2132 0.117
NP_442287.1_3 Forward -277 -260 13.3128 0.294
NP_442173.1_1 Forward -268 -260 15.4574 0.00633
NP_442173.1_1 Reverse -261 -269 15.4574 0.00633
NP_442752.1_4 Forward -269 -262 13.8055 0.0199
NP_442752.1_4 Reverse -260 -267 13.8055 0.0199
NP_443027.1_4 Forward -271 -261 13.943 0.0452
NP_443027.1_4 Reverse -258 -268 11.0914 0.107
NP_441812.1_3 Reverse -259 -273 13.8643 0.146
NP_442975.1_10 Forward -273 -259 20.6484 0.00165
NP_440784.1_7 Forward -268 -261 15.9687 0.0123
NP_440784.1_7 Reverse -261 -268 15.9687 0.0123
NP_440061.1_9 Reverse -258 -272 14.5519 0.0631
NP_440061.1_9 Forward -271 -257 9.73373 0.14
NP_440061.1_9 Reverse -272 -286 7.27547 0.213
NP_440110.1_8 Reverse -258 -277 8.94757 0.0906
NP_440110.1_8 Reverse -1 -20 -2.36049 0.266
NP_441054.1_4 Reverse -250 -268 0.0191479 0.177
NP_442062.1_8 Reverse -260 -270 19.4496 0.000558
NP_442062.1_8 Forward -269 -259 17.3846 0.00193
NP_442062.1_8 Reverse -95 -105 2.83163 0.293
NP_440304.1_4 Forward -271 -261 9.91146 0.051
NP_440304.1_4 Reverse -258 -268 1.84832 0.299
NP_442242.1_4 Forward -268 -261 14.3954 0.0124
NP_442242.1_4 Reverse -261 -268 14.3954 0.0124
NP_440044.1_8 Reverse -261 -280 1.47442 0.172
NP_441035.1_3 Reverse -375 -394 1.86774 0.227
NP_442762.1_10 Reverse -178 -197 -10.6203 0.257
NP_441208.1_9 Forward -107 -93 8.45605 0.219
NP_441594.1_6 Forward -278 -259 0.58944 0.282
NP_440370.1_10 Forward -113 -94 6.68596 0.284
NP_442110.1_7 Reverse -260 -274 0.0979218 0.267
NP_441925.1_5 Forward -292 -278 14.4542 0.207
NP_441083.1_5 Forward -269 -259 20.3345 0.00053
NP_441083.1_5 Reverse -260 -270 11.3864 0.0159
NP_442827.1_8 Forward -277 -258 10.3234 0.0637
NP_441434.1_1 Reverse -339 -353 13.9534 0.233
NP_441434.1_7 Reverse -262 -276 3.34284 0.249
NP_441738.1_2 Forward -267 -260 15.28 0.0102
NP_441738.1_2 Reverse -262 -269 15.28 0.0102
NP_441738.1_2 Reverse -98 -105 6.72528 0.236
NP_441558.1_5 Reverse -258 -277 12.7825 0.0663
NP_440209.1_1 Reverse -260 -268 18.1123 0.00295
NP_440209.1_1 Forward -269 -261 18.1123 0.00295
NP_442136.1_1 Reverse -319 -338 8.35759 0.226
NP_442889.1_1 Forward -110 -91 -10.1286 0.217
NP_442889.1_8 Forward -272 -258 4.32555 0.27
NP_442889.1_8 Forward -316 -302 3.34225 0.281
NP_440447.1_5 Forward -279 -269 13.4514 0.289
NP_440447.1_6 Reverse -252 -270 5.13236 0.156
NP_440056.1_9 Forward -109 -90 14.4581 0.272
NP_441713.1_1 Reverse -254 -273 -12.7836 0.248
NP_440178.1_7 Reverse -259 -278 -12.6852 0.123
NP_442706.1_5 Forward -232 -213 14.6893 0.245
NP_442570.1_3 Forward -107 -88 3.6377 0.166
NP_442570.1_3 Forward -285 -266 -9.34199 0.298
NP_441716.1_1 Forward -269 -255 4.81781 0.248
NP_441716.1_2 Forward -344 -325 -1.33384 0.287
NP_441327.1_1 Forward -76 -57 9.59549 0.203
NP_442111.1_4 Reverse -259 -273 9.83269 0.0575
NP_441163.1_1 Forward -277 -260 5.83964 0.267
NP_441163.1_1 Forward -205 -188 3.87303 0.299
NP_440906.1_5 Forward -268 -261 15.8704 0.0124
NP_440906.1_5 Reverse -261 -268 15.8704 0.0124
NP_442442.1_2 Reverse -264 -283 16.2241 0.112
NP_440747.1_10 Reverse -257 -269 16.7552 0.0019
NP_440747.1_10 Forward -272 -260 -2.02597 0.0196
NP_440747.1_10 Reverse -271 -283 -12.2524 0.254
NP_440747.1_10 Reverse -92 -104 -12.3507 0.27
NP_441130.1_10 Reverse -258 -272 15.8309 0.0282
NP_441130.1_10 Forward -271 -257 11.0127 0.107
NP_441854.1_10 Reverse -380 -399 3.83436 0.282
NP_441486.1_1 Forward -272 -258 4.91614 0.0399
NP_441486.1_1 Reverse -257 -271 -4.22864 0.192
NP_442330.1_4 Forward -106 -87 13.6774 0.286
NP_442634.1_4 Reverse -258 -272 -3.34366 0.161
NP_441265.1_3 Forward -275 -261 1.67122 0.2
NP_440403.1_4 Forward -278 -259 -9.34199 0.274
NP_440403.1_10 Forward -201 -182 7.27595 0.208
NP_440403.1_10 Reverse -260 -279 6.39097 0.22
NP_440842.1_4 Forward -338 -319 -0.0221175 0.289
NP_440842.1_10 Reverse -187 -201 4.42448 0.254
NP_441014.1_5 Reverse -184 -202 9.65558 0.275
NP_441014.1_8 Forward -212 -193 0.687771 0.218
NP_441014.1_10 Reverse -62 -81 0.195343 0.245
NP_442848.1_5 Reverse -88 -106 3.75572 0.276
NP_443018.1_3 Forward -268 -261 14.8871 0.0123
NP_443018.1_3 Reverse -261 -268 14.8871 0.0123
NP_441634.1_8 Reverse -258 -272 25.2707 0.00156
NP_440376.1_1 Forward -269 -260 19.4693 0.000692
NP_440376.1_1 Reverse -260 -269 19.4693 0.000692
NP_440376.1_1 Forward -104 -95 3.93297 0.188
NP_440376.1_1 Forward -105 -96 0.491382 0.273
NP_441588.1_4 Forward -267 -257 6.46988 0.193
NP_441588.1_4 Forward -13 -3 5.09324 0.297
NP_442687.1_7 Forward -270 -260 15.8113 0.0125
NP_442687.1_7 Reverse -259 -269 8.92815 0.0994
NP_441077.1_6 Forward -82 -66 2.03061 0.29
NP_442485.1_3 Reverse -258 -277 -2.26216 0.262
NP_441846.1_10 Reverse -196 -215 -14.2585 0.218
NP_441846.1_10 Reverse -195 -214 -19.6667 0.256
NP_441846.1_10 Forward -115 -96 -20.4534 0.256
NP_441846.1_10 Reverse -194 -213 -23.6983 0.295
NP_440781.1_1 Reverse -3 -17 10.6193 0.296
NP_441422.1_7 Reverse -258 -275 -4.97604 0.247
NP_440667.1_2 Reverse -207 -226 -9.14533 0.297
NP_442658.1_1 Forward -271 -261 18.7607 0.00222
NP_442658.1_1 Reverse -258 -268 7.94438 0.199
NP_442658.1_9 Forward -123 -104 11.4058 0.286
NP_442198.1_3 Reverse -251 -270 11.8975 0.19
NP_442782.1_2 Forward -104 -90 3.63784 0.263
NP_442782.1_2 Forward -116 -102 2.35953 0.275
NP_442205.1_9 Forward -275 -259 -2.00642 0.266
NP_441414.1_9 Forward -269 -250 8.55425 0.0271
NP_442321.1_4 Reverse -86 -105 -2.16383 0.27
NP_442321.1_4 Forward -43 -24 -8.35868 0.289
NP_441317.1_4 Reverse -71 -85 16.1483 0.136
NP_441317.1_4 Reverse -159 -173 10.8963 0.27
NP_441958.1_5 Forward -270 -260 12.2714 0.00183
NP_441958.1_5 Reverse -259 -269 12.2714 0.00183
NP_441127.1_5 Forward -106 -87 14.8329 0.274
NP_440203.1_5 Forward -281 -271 10.206 0.235
NP_440203.1_5 Reverse -98 -108 9.81266 0.245
NP_439905.1_1 Forward -268 -255 16.5389 0.0578
NP_439905.1_1 Reverse -261 -274 11.7207 0.204
NP_440984.1_7 Forward -274 -260 19.1741 0.00932
NP_440984.1_7 Reverse -255 -269 11.2093 0.122
NP_439990.1_5 Reverse -255 -268 19.6855 0.00652
NP_442911.1_2 Reverse -250 -269 3.53937 0.0428
NP_440153.1_5 Reverse -261 -275 13.4709 0.0551
NP_440153.1_8 Reverse -189 -202 4.14919 0.204
NP_441591.1_10 Reverse -258 -277 15.5357 0.073
NP_442064.1_1 Reverse -255 -274 -11.5053 0.259
NP_443055.1_6 Reverse -260 -278 1.19838 0.234
NP_440993.1_2 Forward -274 -258 0.943514 0.298
NP_440993.1_3 Reverse -250 -269 -0.0996487 0.26
NP_441099.1_5 Reverse -250 -269 -2.55715 0.124
NP_442002.1_9 Forward -270 -263 10.7572 0.185
NP_440809.1_9 Reverse -251 -269 -8.33898 0.235
NP_441712.1_1 Forward -46 -27 11.9368 0.251
NP_441294.1_7 Forward -273 -259 17.7936 0.00679
NP_442438.1_10 Forward -274 -260 13.0776 0.0367
NP_441292.1_2 Forward -210 -191 -6.39206 0.241
NP_441000.1_6 Reverse -259 -273 4.32615 0.0957
NP_441000.1_6 Forward -270 -256 -3.93365 0.225
NP_440605.1_4 Reverse -250 -269 14.3475 0.225
NP_442870.1_4 Reverse -215 -229 17.4042 0.182
NP_440484.1_3 Reverse -235 -249 8.65272 0.293
NP_440147.1_4 Reverse -258 -271 16.8339 0.00906
NP_440147.1_4 Forward -271 -258 11.0324 0.0341
NP_440147.1_4 Reverse -187 -200 -0.570702 0.291
NP_441550.1_8 Reverse -258 -268 15.1225 0.0132
NP_441550.1_8 Forward -271 -261 10.501 0.066
NP_441916.1_7 Reverse -260 -270 18.4663 0.00144
NP_441916.1_7 Forward -269 -259 10.3048 0.0261
NP_440465.1_10 Forward -201 -182 3.93269 0.238
NP_441041.1_7 Forward -272 -260 10.2357 0.1
NP_442396.1_5 Reverse -256 -269 11.819 0.0913
NP_442396.1_5 Forward -288 -275 7.09911 0.215
NP_440569.1_10 Reverse -158 -177 6.06331 0.236
NP_441725.1_5 Reverse -261 -271 9.02648 0.0553
NP_441725.1_5 Forward -268 -258 2.04498 0.115
NP_439966.1_7 Forward -271 -261 17.4824 0.00636
NP_439966.1_7 Reverse -258 -268 15.3192 0.0152
NP_439966.1_9 Forward -271 -262 10.7178 0.0863
NP_442941.1_3 Forward -268 -258 19.2529 0.00262
NP_442941.1_3 Reverse -261 -271 2.53664 0.14
NP_440289.1_2 Forward -272 -259 10.2457 0.0272
NP_440289.1_2 Reverse -257 -270 -3.61896 0.267
NP_440260.1_7 Forward -151 -132 -0.983855 0.241
NP_441514.1_4 Reverse -284 -303 14.8329 0.226
NP_441678.1_9 Forward -116 -97 2.0644 0.223
NP_442281.1_1 Forward -274 -260 9.53707 0.0685
NP_442281.1_1 Reverse -374 -388 3.63724 0.224
NP_442281.1_1 Forward -109 -95 3.63724 0.224
NP_442281.1_1 Reverse -91 -105 2.75226 0.257
NP_442281.1_1 Reverse -270 -284 1.76896 0.29
NP_441334.1_7 Reverse -258 -277 -11.6036 0.124
NP_441079.1_7 Reverse -54 -73 11.995 0.0814
NP_442256.1_2 Reverse -258 -276 -4.70074 0.214
NP_442500.1_8 Reverse -339 -353 12.7813 0.222
NP_442012.1_1 Reverse -89 -108 2.55606 0.198
NP_439983.1_7 Reverse -211 -229 9.36059 0.298
NP_441556.1_4 Forward -281 -262 11.5476 0.247
NP_441556.1_7 Forward -280 -261 2.85027 0.265
NP_441644.1_6 Forward -269 -259 17.3841 0.00127
NP_441644.1_6 Reverse -260 -270 10.1076 0.0628
NP_440867.1_10 Reverse -259 -278 1.76941 0.291
NP_442215.1_2 Forward -286 -270 -5.05468 0.244
NP_442215.1_2 Forward -107 -91 -5.448 0.25
NP_442215.1_2 Forward -271 -255 -7.21796 0.289
NP_442247.1_8 Reverse -258 -272 9.73436 0.247
NP_440253.1_2 Forward -269 -251 10.3439 0.0401
NP_440253.1_2 Reverse -260 -278 1.59244 0.157
NP_440929.1_8 Forward -269 -260 19.2726 0.000701
NP_440929.1_8 Reverse -260 -269 19.2726 0.000701
NP_440780.1_1 Forward -92 -73 7.87766 0.274
NP_442933.1_10 Forward -269 -260 17.601 0.00325
NP_442933.1_10 Reverse -260 -269 17.601 0.00325
NP_440576.1_5 Reverse -94 -113 10.3242 0.243
NP_441751.2_8 Forward -268 -254 2.75286 0.0759
NP_442554.1_8 Forward -268 -258 16.2046 0.0065
NP_442554.1_8 Reverse -261 -271 16.008 0.0065
NP_442554.1_8 Reverse -190 -200 4.10993 0.198
NP_441762.1_7 Reverse -259 -271 12.4287 0.0142
NP_441762.1_7 Forward -270 -258 2.39892 0.0676
NP_442142.1_4 Reverse -257 -270 6.80355 0.154
NP_442142.1_4 Forward -272 -259 6.0169 0.175
NP_442292.1_1 Forward -268 -259 18.486 0.00229
NP_442292.1_1 Reverse -261 -270 9.63616 0.0183
NP_440919.1_1 Forward -393 -374 -1.96717 0.221
NP_441525.1_1 Forward -202 -189 13.884 0.238
NP_440254.1_1 Forward -91 -72 8.75091 0.228
NP_442476.1_6 Forward -268 -254 12.1926 0.0509
NP_442476.1_6 Reverse -261 -275 7.37441 0.114
NP_440895.1_6 Reverse -254 -267 10.4424 0.202
NP_442381.1_8 Forward -272 -253 -14.4552 0.28
NP_441711.1_4 Forward -278 -259 7.57094 0.144
NP_443009.1_5 Reverse -259 -270 18.3477 0.00265
NP_443009.1_5 Reverse -274 -285 15.2994 0.0152
NP_443009.1_5 Reverse -94 -105 9.69459 0.0913
NP_443009.1_5 Forward -127 -116 7.43299 0.129
NP_443009.1_5 Forward -105 -94 4.28642 0.254
NP_441715.1_4 Forward -268 -258 17.3846 0.0106
NP_441715.1_4 Reverse -261 -271 9.32148 0.097
NP_440881.1_4 Forward -103 -84 3.83436 0.226
NP_440730.1_4 Forward -104 -85 -3.3438 0.297
NP_441448.1_1 Reverse -7 -26 9.0459 0.198
NP_441198.1_8 Forward -128 -118 13.2713 0.108
NP_441198.1_8 Reverse -273 -283 13.076 0.108
NP_441198.1_8 Forward -106 -96 10.9275 0.232
NP_440379.1_5 Forward -201 -182 -9.83364 0.267
NP_441468.1_1 Forward -268 -261 15.8704 0.0124
NP_441468.1_1 Reverse -261 -268 15.8704 0.0124
NP_441015.1_10 Reverse -184 -203 -9.93197 0.282
NP_441673.1_1 Forward -269 -260 20.8459 0.000698
NP_441673.1_1 Reverse -260 -269 20.8459 0.000698
NP_442253.1_5 Reverse -185 -202 -2.12444 0.28
NP_442253.1_5 Forward -201 -184 -6.94266 0.298
NP_442253.1_5 Forward -391 -374 -7.04099 0.298
NP_441876.1_9 Reverse -86 -96 12.0743 0.267
NP_441876.1_9 Reverse -141 -151 10.5993 0.287
NP_441826.1_2 Forward -275 -261 2.94952 0.117
NP_441330.1_1 Reverse -90 -109 -7.86702 0.183
NP_441637.1_9 Forward -42 -24 7.19731 0.245
NP_441637.1_9 Reverse -72 -90 -2.83245 0.292
NP_442490.1_10 Reverse -259 -277 17.7187 0.0599
NP_442868.1_6 Reverse -258 -268 19.2529 0.00563
NP_442868.1_6 Forward -271 -261 8.53483 0.0555
NP_442719.1_2 Reverse -73 -91 -11.6829 0.294
NP_441251.1_8 Reverse -370 -383 15.7225 0.254
NP_441612.1_2 Forward -269 -259 8.54929 0.21
NP_442808.1_1 Forward -270 -260 18.4657 0.00201
NP_442808.1_1 Reverse -259 -269 8.63269 0.0481
NP_442808.1_1 Forward -234 -224 2.24121 0.274
NP_442542.1_2 Forward -271 -258 19.0955 0.0177
NP_442542.1_2 Forward -396 -383 12.409 0.114
NP_442542.1_9 Forward -276 -262 23.0083 0.00508
NP_442050.1_5 Reverse -258 -268 14.3359 0.0206
NP_442050.1_5 Forward -271 -261 8.23937 0.234
NP_441114.1_3 Reverse -380 -389 7.37455 0.239
NP_441114.1_3 Reverse -97 -106 7.27622 0.247
NP_442789.1_4 Reverse -190 -209 -4.42544 0.26
NP_441518.1_3 Forward -279 -260 -4.91709 0.121
NP_441878.1_6 Forward -270 -260 10.4031 0.0176
NP_441878.1_6 Reverse -259 -269 10.4031 0.0176
NP_441878.1_6 Forward -105 -95 2.33998 0.0405
NP_441878.1_6 Reverse -188 -198 1.65166 0.0795
NP_441036.1_3 Forward -116 -97 1.86774 0.168
NP_441036.1_3 Forward -127 -108 1.17943 0.177
NP_441036.1_8 Forward -270 -260 17.7779 0.000554
NP_441036.1_8 Reverse -259 -269 8.33817 0.174
NP_441557.1_5 Forward -269 -260 19.9609 0.000699
NP_441557.1_5 Reverse -260 -269 19.9609 0.000699
NP_441557.1_8 Reverse -108 -118 14.0409 0.201
NP_441445.1_1 Forward -278 -259 6.19431 0.153
NP_441590.1_4 Forward -212 -193 2.6536 0.293
NP_442066.2_4 Reverse -260 -279 1.37609 0.151
NP_442066.2_9 Reverse -256 -269 20.0788 0.00699
NP_440084.1_8 Forward -69 -55 13.5715 0.223
NP_441914.1_2 Reverse -266 -284 15.3588 0.218
NP_441308.1_8 Forward -271 -261 9.22315 0.226
NP_440101.1_3 Forward -109 -90 6.29264 0.182
NP_440101.1_3 Forward -274 -255 0.491109 0.298
NP_442830.1_5 Reverse -94 -108 4.03056 0.239
NP_442183.1_1 Reverse -260 -274 7.57108 0.138
NP_442183.1_1 Reverse -117 -131 4.42448 0.261
NP_441773.1_5 Forward -339 -321 15.4563 0.252
NP_440276.1_8 Reverse -103 -122 15.2408 0.101
NP_441549.1_9 Reverse -256 -274 1.39578 0.103
NP_441467.1_10 Reverse -73 -87 15.8309 0.0894
NP_442170.1_5 Reverse -260 -279 -1.47551 0.254
NP_442347.1_2 Forward -268 -259 12.4878 0.056
NP_442347.1_2 Reverse -261 -270 11.1111 0.056
NP_442347.1_2 Reverse -140 -149 7.96454 0.122
NP_442645.1_2 Reverse -252 -271 -21.83 0.29
NP_441037.1_4 Forward -271 -261 16.2838 0.0168
NP_442317.1_6 Reverse -255 -274 4.32602 0.247
NP_441633.1_3 Reverse -258 -271 20.5705 0.00512
NP_441633.1_3 Forward -271 -258 -3.71729 0.177
NP_441633.1_3 Reverse -115 -128 -4.11062 0.181
NP_440136.1_2 Forward -268 -261 15.9687 0.0123
NP_440136.1_2 Reverse -261 -268 15.9687 0.0123
NP_442590.1_9 Reverse -188 -207 5.11266 0.273
NP_442998.1_5 Forward -11 -1 12.3697 0.174
NP_442998.1_5 Forward -147 -137 9.22315 0.248
NP_442998.1_10 Forward -267 -260 15.5754 0.0102
NP_442998.1_10 Reverse -262 -269 15.5754 0.0102
NP_440899.1_8 Reverse -73 -92 2.3594 0.131
NP_440299.1_1 Reverse -256 -269 10.9334 0.0529
NP_440299.1_1 Forward -273 -260 7.68852 0.107
NP_440299.1_1 Forward -311 -298 3.06699 0.261
NP_440299.1_1 Reverse -2 -15 2.96866 0.265
NP_441799.1_1 Reverse -256 -270 16.1252 0.0153
NP_441799.1_1 Forward -273 -259 12.782 0.04
NP_441007.1_10 Forward -274 -261 2.2809 0.193
NP_441007.1_10 Reverse -255 -268 1.29759 0.203
NP_442201.1_10 Forward -280 -261 -6.68705 0.184
NP_440256.1_1 Reverse -257 -276 9.93088 0.0193
NP_440709.1_1 Forward -340 -321 0.883656 0.256
NP_441559.1_8 Reverse -112 -126 11.5043 0.0574
NP_441559.1_8 Reverse -113 -127 4.42448 0.119
NP_441559.1_8 Reverse -90 -104 4.03116 0.133
NP_441559.1_8 Forward -288 -274 -2.55701 0.192
NP_441559.1_8 Reverse -101 -115 -2.65535 0.192
NP_441559.1_8 Reverse -102 -116 -3.83532 0.211
NP_441559.1_8 Reverse -255 -269 -5.90027 0.271
NP_441559.1_8 Forward -274 -260 -6.98191 0.281
NP_440915.1_6 Reverse -256 -270 0.687908 0.155
NP_440915.1_6 Forward -273 -259 -2.06536 0.258
NP_440915.1_6 Reverse -113 -127 -3.147 0.29
NP_440915.1_6 Reverse -91 -105 -3.34366 0.293
NP_442158.1_4 Forward -291 -281 15.9097 0.129
NP_441866.1_4 Forward -42 -29 13.1476 0.273
NP_441866.1_4 Forward -345 -332 12.2722 0.289
NP_441704.1_8 Forward -280 -261 10.1267 0.162
NP_440215.1_7 Forward -142 -124 14.2771 0.289
NP_440749.1_7 Reverse -279 -298 15.2305 0.237
NP_442452.1_8 Reverse -89 -103 11.9953 0.273
NP_440537.1_7 Forward -70 -51 11.0289 0.263
NP_441939.1_3 Reverse -261 -280 12.3892 0.102
NP_441199.1_7 Reverse -323 -342 11.1109 0.136
NP_442386.1_9 Forward -270 -261 15.7322 0.0144
NP_442386.1_9 Reverse -259 -268 13.8639 0.0289
NP_441340.1_5 Forward -268 -261 15.6737 0.0124
NP_441340.1_5 Reverse -261 -268 15.6737 0.0124
NP_441340.1_9 Reverse -283 -293 7.48397 0.256
NP_441947.1_4 Forward -280 -261 13.0775 0.223
NP_442791.1_5 Forward -277 -258 -8.16202 0.279
NP_442240.1_2 Reverse -261 -280 -16.3235 0.244
NP_440161.1_3 Forward -271 -252 7.37428 0.299
NP_440211.1_4 Forward -129 -119 14.4347 0.286
NP_440586.1_8 Forward -268 -261 13.2151 0.026
NP_440586.1_8 Reverse -261 -268 13.2151 0.026
NP_442251.1_6 Forward -268 -261 15.2804 0.0124
NP_442251.1_6 Reverse -261 -268 15.2804 0.0124
NP_440192.1_4 Forward -128 -109 12.6963 0.169
NP_441262.1_3 Reverse -260 -267 14.7888 0.0223
NP_441262.1_3 Forward -269 -262 14.7888 0.0223
NP_440027.1_3 Reverse -378 -396 3.65664 0.267
NP_443051.1_1 Reverse -259 -268 10.4228 0.00754
NP_443051.1_1 Forward -270 -261 10.4228 0.00754
NP_439937.1_9 Forward -270 -253 -6.74666 0.157
NP_439937.1_9 Reverse -259 -276 -15.7931 0.287
NP_441595.1_2 Forward -353 -340 8.75154 0.28
NP_440408.1_7 Forward -105 -86 7.66927 0.284
NP_440439.1_1 Forward -272 -259 11.9173 0.0288
NP_440439.1_1 Reverse -257 -270 1.88757 0.139
NP_440372.1_2 Forward -268 -261 16.3621 0.0124
NP_440372.1_2 Reverse -261 -268 16.3621 0.0124
NP_440171.1_3 Forward -129 -110 2.0644 0.289
NP_440316.1_10 Reverse -188 -198 7.35486 0.251
NP_439977.1_5 Reverse -111 -130 3.24438 0.16
NP_439977.1_5 Reverse -254 -273 0.392778 0.21
NP_440267.1_2 Reverse -90 -104 6.39049 0.229
NP_442384.1_10 Forward -269 -256 19.2922 0.00338
NP_442384.1_10 Reverse -260 -273 2.2809 0.23
NP_440472.1_1 Reverse -86 -105 10.4217 0.265
NP_442114.1_4 Reverse -260 -271 12.1534 0.107
NP_442114.1_8 Forward -89 -75 8.45543 0.234
NP_440699.1_1 Reverse -40 -59 8.54611 0.232
NP_442262.1_10 Forward -268 -261 14.1988 0.0123
NP_442262.1_10 Reverse -261 -268 14.1988 0.0123
NP_441689.1_5 Reverse -258 -268 5.78111 0.197
NP_440344.1_10 Forward -276 -259 -1.14113 0.0505
NP_440344.1_10 Reverse -253 -270 -8.31929 0.125
NP_440344.1_10 Reverse -268 -285 -10.5809 0.185
NP_440531.1_6 Forward -277 -258 11.1109 0.0598
NP_440531.1_6 Forward -206 -187 -3.3438 0.265
NP_442123.1_3 Reverse -260 -279 14.6508 0.135
NP_442910.1_1 Reverse -268 -287 -2.26216 0.254
NP_441965.1_10 Forward -272 -256 13.0382 0.105
NP_440297.1_9 Forward -268 -258 -0.118297 0.282
NP_440297.1_9 Reverse -261 -271 -0.216628 0.282
NP_441592.1_4 Forward -240 -221 -0.590531 0.244
NP_441896.1_3 Reverse -251 -270 2.85105 0.183
NP_441778.1_10 Forward -357 -339 18.8505 0.217
NP_442067.1_4 Forward -280 -261 7.66927 0.194
NP_440999.1_9 Forward -273 -259 12.1926 0.0414
NP_440999.1_9 Reverse -113 -127 -0.197071 0.201
NP_440888.1_2 Reverse -260 -274 17.9935 0.00283
NP_440888.1_2 Forward -269 -255 15.1419 0.0122
NP_442454.1_2 Forward -354 -335 6.82725 0.291
NP_440600.1_4 Forward -277 -259 -1.75081 0.174
NP_439969.1_1 Forward -215 -196 2.75272 0.176
NP_442277.1_7 Forward -78 -62 -1.04361 0.264
NP_442033.1_10 Forward -271 -252 -6.98204 0.186
NP_441543.1_2 Reverse -261 -270 18.486 0.00236
NP_441543.1_2 Forward -268 -259 16.9127 0.00359
NP_442845.1_2 Reverse -254 -268 5.89945 0.22
NP_442845.1_2 Forward -105 -91 5.60446 0.228
NP_441319.1_8 Reverse -254 -272 12.4089 0.13
NP_441319.1_8 Forward -154 -136 7.19731 0.261
NP_442710.1_7 Reverse -348 -367 -8.56828 0.299
NP_441469.1_8 Forward -270 -261 16.126 0.00797
NP_441469.1_8 Reverse -259 -268 6.48957 0.227
NP_442315.1_2 Reverse -219 -231 8.59377 0.293
NP_443064.1_6 Forward -269 -259 12.5669 0.0796
NP_442337.1_8 Reverse -177 -196 2.65439 0.217
NP_442578.1_7 Forward -268 -261 14.5921 0.026
NP_442578.1_7 Reverse -261 -268 14.5921 0.026
NP_440710.1_1 Forward -277 -259 -8.43732 0.264
NP_440148.1_1 Reverse -286 -305 3.34271 0.186
NP_440148.1_1 Forward -45 -26 -3.93378 0.219
NP_441462.1_2 Forward -269 -259 11.5831 0.00406
NP_441462.1_2 Reverse -260 -270 11.5831 0.00406
NP_441621.1_7 Forward -271 -257 -3.147 0.188
NP_441621.1_7 Reverse -258 -272 -3.44199 0.188
NP_443062.1_6 Reverse -252 -271 10.8159 0.11
NP_442204.1_5 Forward -279 -260 3.53937 0.187
NP_440255.1_5 Reverse -128 -142 17.3912 0.211
NP_440516.1_2 Reverse -254 -272 -1.55415 0.287
NP_440516.1_8 Forward -269 -260 16.9127 0.00442
NP_440516.1_8 Reverse -260 -269 16.9127 0.00442
NP_442428.1_5 Forward -268 -261 15.8704 0.0124
NP_442428.1_5 Reverse -261 -268 15.8704 0.0124
NP_441267.1_1 Reverse -254 -273 4.22769 0.233
NP_440673.1_2 Forward -279 -260 13.9015 0.103
NP_440673.1_3 Forward -267 -260 12.4288 0.0426
NP_440673.1_3 Reverse -262 -269 12.4288 0.0426
NP_441052.1_2 Forward -269 -259 19.9412 0.00106
NP_441052.1_2 Reverse -260 -270 10.5014 0.0285
NP_442219.1_9 Forward -268 -259 17.7976 0.00718
NP_442219.1_9 Reverse -261 -270 8.35786 0.0681
NP_440436.1_4 Reverse -261 -270 18.1905 0.00233
NP_440436.1_4 Forward -268 -259 17.2072 0.00233
NP_440436.1_4 Reverse -7 -16 8.06244 0.118
NP_440436.1_4 Reverse -96 -105 6.78414 0.147
NP_441884.1_8 Reverse -259 -278 -9.34199 0.268
NP_441884.1_9 Reverse -257 -276 -12.0953 0.138
NP_441884.1_9 Reverse -376 -395 -22.8133 0.284
NP_441884.1_9 Forward -272 -253 -23.6 0.284
NP_442086.1_3 Reverse -261 -280 5.70265 0.288
NP_441893.1_5 Reverse -92 -106 17.6002 0.166
NP_441336.1_7 Reverse -82 -101 13.7658 0.153
NP_440314.1_9 Forward -175 -156 -3.24547 0.179
NP_440314.1_9 Forward -268 -249 -7.96535 0.243
NP_441719.1_4 Forward -268 -261 16.3621 0.0124
NP_441719.1_4 Reverse -261 -268 16.3621 0.0124
NP_441733.1_10 Reverse -257 -270 7.09911 0.156
NP_441004.1_1 Forward -110 -91 -4.72043 0.173
NP_441004.1_1 Forward -109 -90 -15.5368 0.275
NP_441004.1_1 Forward -132 -113 -16.9135 0.287
NP_441004.1_1 Reverse -206 -225 -17.9951 0.296
NP_439949.1_7 Reverse -209 -223 17.0108 0.153
NP_440129.1_4 Forward -243 -225 18.2096 0.119
NP_440296.1_6 Reverse -57 -75 10.8881 0.295
NP_440296.1_10 Forward -107 -88 -3.14714 0.209
NP_441115.1_4 Forward -270 -252 11.5231 0.136
NP_443054.1_2 Reverse -258 -272 10.226 0.0761
NP_442430.1_6 Reverse -281 -300 7.07928 0.271
NP_441851.1_10 Forward -270 -260 16.008 0.00552
NP_441851.1_10 Reverse -259 -269 15.8113 0.00552
NP_441851.1_10 Forward -285 -275 9.61647 0.114
NP_441851.1_10 Reverse -273 -283 8.4365 0.116
NP_441851.1_10 Forward -128 -118 6.17489 0.182
NP_441851.1_10 Forward -105 -95 4.99491 0.233
NP_441851.1_10 Reverse -274 -284 4.40493 0.271
NP_442208.1_5 Reverse -261 -280 -7.76869 0.274
NP_442001.1_1 Forward -338 -319 7.86512 0.0892
NP_442622.1_1 Reverse -259 -278 -11.6036 0.257
NP_442622.1_8 Reverse -260 -278 -18.6637 0.243
NP_442898.1_1 Reverse -60 -78 19.1916 0.155
NP_441668.1_4 Forward -114 -95 3.93269 0.183
NP_442515.1_1 Reverse -259 -273 12.3893 0.0339
NP_442515.1_1 Forward -270 -256 11.6026 0.0393
NP_441396.1_2 Forward -342 -325 2.69307 0.168
NP_441982.1_6 Forward -83 -74 12.2944 0.286
NP_442709.1_3 Forward -111 -92 8.65258 0.121
NP_440338.1_4 Forward -229 -210 4.03023 0.298
NP_441349.1_10 Reverse -250 -269 -6.29373 0.226
NP_441409.1_6 Reverse -254 -273 -7.08038 0.142
NP_441409.1_8 Forward -180 -161 14.1506 0.209
NP_440432.1_9 Reverse -261 -276 9.91133 0.0419
NP_442843.1_1 Forward -121 -102 -7.08038 0.245
NP_440474.1_8 Reverse -261 -275 15.1419 0.0586
NP_441124.1_5 Forward -67 -57 14.6315 0.215
NP_440431.1_3 Forward -270 -251 3.24438 0.0923
NP_440431.1_4 Forward -78 -59 -8.45146 0.275
NP_442168.1_5 Forward -283 -264 -0.688862 0.264
NP_440588.1_2 Reverse -251 -270 2.65439 0.115
NP_440588.1_2 Reverse -86 -105 -7.08038 0.299
NP_440195.1_5 Forward -275 -256 0.982764 0.295
NP_442006.1_2 Forward -278 -261 -5.56602 0.143
NP_442006.1_2 Reverse -198 -215 -15.4975 0.227
NP_442006.1_3 Reverse -184 -202 -6.1757 0.298
NP_440483.1_1 Reverse -200 -219 -2.16383 0.208
NP_440483.1_1 Reverse -199 -218 -8.16202 0.282
NP_441570.1_1 Reverse -260 -278 1.29745 0.0315
NP_441078.1_4 Forward -269 -260 19.6659 0.0007
NP_441078.1_4 Reverse -260 -269 19.6659 0.0007
NP_441078.1_4 Reverse -95 -104 -1.57357 0.266
NP_441078.1_4 Forward -104 -95 -1.57357 0.266
NP_442729.1_8 Reverse -256 -269 10.639 0.125
NP_441663.1_7 Reverse -257 -276 3.24438 0.298
NP_442348.1_2 Reverse -212 -221 14.7494 0.146
NP_442348.1_2 Reverse -211 -220 7.57121 0.28
NP_442348.1_2 Forward -388 -379 7.17789 0.285
NP_440526.1_3 Reverse -261 -272 2.41814 0.267
NP_440526.1_3 Forward -268 -257 1.04151 0.267
NP_440526.1_7 Reverse -57 -76 16.7076 0.143
NP_441432.1_8 Reverse -259 -268 16.8143 0.00595
NP_441432.1_8 Forward -270 -261 8.25953 0.0755
NP_441432.1_9 Reverse -163 -176 9.66489 0.269
NP_441432.1_9 Forward -352 -339 8.11358 0.294
NP_442320.1_8 Forward -275 -261 5.99778 0.0309
NP_442320.1_8 Reverse -254 -268 -2.36035 0.0871
NP_441732.1_2 Reverse -256 -272 -15.1828 0.145
NP_441732.1_2 Forward -273 -257 -16.1661 0.165
NP_441732.1_5 Forward -239 -225 11.996 0.21
NP_441030.1_4 Reverse -317 -336 5.1084 0.277
NP_440290.1_1 Forward -67 -58 16.0328 0.292
NP_440760.1_1 Forward -269 -250 -12.1936 0.0915
NP_440760.1_7 Reverse -63 -82 4.12856 0.235
NP_442353.1_4 Forward -275 -256 5.50519 0.183
NP_442400.1_10 Forward -87 -74 14.3856 0.173
NP_442489.1_7 Forward -269 -260 20.1576 0.000695
NP_442489.1_7 Reverse -260 -269 20.1576 0.000695
NP_442489.1_7 Forward -104 -95 -1.57357 0.213
NP_442489.1_7 Reverse -95 -104 -2.06522 0.288
NP_442079.1_7 Forward -268 -249 2.16274 0.234
NP_440559.1_1 Forward -268 -259 17.4043 0.00658
NP_440559.1_1 Reverse -261 -270 8.75118 0.0586
NP_441659.2_8 Forward -269 -259 18.1713 0.00133
NP_441659.2_8 Reverse -260 -270 11.9764 0.0147
NP_441659.2_8 Forward -198 -188 1.455 0.24
NP_442913.1_10 Forward -278 -259 -5.40875 0.264
NP_439956.1_7 Forward -110 -91 4.03102 0.257
NP_440708.1_6 Reverse -174 -193 14.4541 0.0634
NP_440708.1_6 Reverse -97 -116 -1.86883 0.201
NP_440335.1_9 Reverse -284 -302 9.16393 0.298
NP_440779.1_5 Reverse -260 -277 -5.27103 0.14
NP_442346.1_5 Reverse -259 -269 16.6963 0.00248
NP_442346.1_5 Forward -270 -260 9.02648 0.118
NP_442346.1_5 Forward -105 -95 4.79825 0.272
NP_440545.1_3 Forward -273 -256 -2.02611 0.179
NP_440545.1_3 Forward -108 -91 -6.84433 0.289
NP_440010.1_10 Forward -281 -262 3.04771 0.264
NP_441943.1_2 Forward -354 -335 13.3725 0.236
NP_441943.1_6 Forward -90 -76 18.2892 0.271
NP_441943.1_8 Forward -101 -82 -6.29373 0.261
NP_441943.1_8 Forward -156 -137 -6.58872 0.261
NP_442603.1_7 Forward -269 -255 16.9119 0.0273
NP_441585.1_5 Forward -229 -210 0.392004 0.291
NP_441050.1_5 Forward -108 -90 -2.93078 0.285
NP_441948.1_4 Forward -276 -258 6.80398 0.0633
NP_441948.1_4 Reverse -253 -271 -1.06249 0.14
NP_442732.1_6 Forward -134 -115 19.8623 0.127
NP_441833.1_4 Forward -268 -261 15.9687 0.0124
NP_441833.1_4 Reverse -261 -268 15.9687 0.0124
NP_441112.1_6 Forward -279 -260 5.89931 0.172
NP_442699.1_8 Forward -100 -81 -12.6852 0.255
NP_442162.1_9 Forward -268 -261 16.2637 0.0124
NP_442162.1_9 Reverse -261 -268 16.2637 0.0124
NP_440671.1_1 Reverse -319 -338 7.85374 0.205
NP_443026.1_5 Reverse -206 -225 -3.63879 0.283
NP_443026.1_5 Reverse -205 -224 -5.70374 0.293
NP_440224.1_1 Reverse -263 -282 -3.54046 0.267
NP_440224.1_1 Reverse -84 -103 -4.22878 0.292
NP_441044.1_4 Forward -224 -206 6.80398 0.223
NP_442943.1_1 Reverse -38 -53 5.1154 0.211
NP_442045.1_9 Reverse -190 -200 17.8763 0.218
NP_442199.1_5 Reverse -252 -271 0.0977854 0.174
NP_442140.1_3 Reverse -261 -271 17.4829 0.0159
NP_442140.1_3 Forward -268 -258 10.3048 0.0902
NP_442021.1_6 Forward -121 -102 8.35759 0.262
NP_441609.1_5 Forward -356 -337 8.84924 0.279
NP_442778.1_10 Reverse -213 -231 9.0656 0.259
NP_440875.1_9 Reverse -262 -272 15.2829 0.0295
NP_441813.1_3 Forward -128 -109 15.5947 0.238
NP_441813.1_5 Reverse -258 -268 18.1713 0.00743
NP_441813.1_5 Forward -271 -261 10.0098 0.0208
NP_440594.1_8 Forward -268 -255 12.2117 0.152
NP_440590.1_4 Reverse -261 -274 12.2123 0.0156
NP_440590.1_4 Forward -268 -255 11.7207 0.0187
NP_440567.1_1 Reverse -261 -275 12.3893 0.0236
NP_442497.1_10 Forward -268 -259 10.4228 0.0087
NP_442497.1_10 Reverse -261 -270 10.4228 0.0087
NP_440821.1_4 Forward -271 -261 18.7612 0.00422
NP_440821.1_4 Reverse -258 -268 9.41981 0.0286
NP_441239.1_9 Forward -271 -259 16.0669 0.0175
NP_441239.1_9 Reverse -258 -270 7.80712 0.148
NP_441239.1_9 Forward -106 -94 4.5622 0.251
NP_441892.1_1 Forward -278 -261 5.54538 0.101
NP_441892.1_1 Reverse -180 -197 -5.56602 0.283
NP_442399.1_3 Forward -86 -67 9.88382 0.252
NP_442105.1_9 Forward -18 -4 13.9634 0.294
NP_441508.1_1 Reverse -322 -341 13.1525 0.204
NP_441508.1_1 Forward -78 -59 12.0953 0.233
NP_441017.1_8 Forward -391 -376 15.5162 0.174
NP_441541.1_1 Reverse -325 -343 -1.23941 0.237
NP_442216.1_4 Reverse -119 -127 8.37716 0.255
NP_442216.1_4 Forward -219 -211 8.1805 0.255
NP_440354.1_7 Forward -275 -257 6.41066 0.283
NP_440546.1_4 Reverse -260 -270 11.8882 0.0679
NP_440546.1_4 Forward -269 -259 10.046 0.109
NP_440546.1_7 Forward -278 -268 14.238 0.279
NP_441230.1_5 Reverse -90 -109 2.75272 0.209
NP_440675.1_1 Forward -108 -89 6.68596 0.195
NP_440462.1_6 Forward -271 -261 17.9746 0.00578
NP_440462.1_6 Reverse -258 -268 9.61647 0.0429
NP_440868.1_4 Forward -273 -261 19.3118 0.0113
NP_440868.1_4 Reverse -256 -268 9.97041 0.0405
NP_440868.1_4 Reverse -6 -18 0.0389777 0.234
NP_440401.1_9 Reverse -50 -57 14.5917 0.287
NP_442479.1_9 Reverse -286 -305 -12.4886 0.283
NP_441474.1_1 Forward -214 -195 -0.00131823 0.255
NP_441474.1_1 Forward -25 -6 -0.29631 0.255
NP_441474.1_1 Forward -215 -196 -3.44288 0.299
NP_442402.1_1 Reverse -99 -118 20.944 0.0321
NP_442402.1_1 Reverse -76 -95 10.5209 0.254
NP_442402.1_1 Reverse -131 -150 7.57094 0.289
NP_442402.1_2 Reverse -81 -95 15.6336 0.263
NP_442402.1_4 Reverse -131 -150 22.713 0.0147
NP_442402.1_4 Reverse -110 -129 13.9616 0.0585
NP_442402.1_4 Reverse -99 -118 6.48849 0.131
NP_442402.1_4 Reverse -111 -130 1.57197 0.173
NP_442402.1_4 Reverse -76 -95 -1.37794 0.189
NP_442402.1_4 Forward -291 -272 -7.3761 0.274
NP_442402.1_5 Reverse -175 -194 19.174 0.132
NP_442402.1_6 Forward -108 -99 15.4377 0.241
NP_442402.1_6 Reverse -271 -280 14.8477 0.241
NP_442402.1_6 Forward -151 -142 13.4711 0.284
NP_442402.1_6 Forward -96 -87 13.1761 0.289
NP_442402.1_6 Forward -119 -110 12.9794 0.289
NP_442402.1_10 Reverse -108 -118 16.0075 0.118
NP_442402.1_10 Reverse -84 -94 10.4026 0.29
NP_442402.1_10 Reverse -120 -130 10.1076 0.3
NP_441848.1_4 Forward -73 -57 15.381 0.154
NP_441848.1_4 Reverse -277 -293 12.6117 0.199
NP_441848.1_4 Reverse -329 -345 8.12362 0.288
NP_441848.1_7 Forward -223 -204 0.883656 0.228
NP_439942.1_2 Reverse -335 -354 12.7933 0.267
NP_440696.1_3 Reverse -260 -278 1.69077 0.217
NP_440843.1_8 Forward -110 -91 13.0775 0.297
NP_440843.1_8 Reverse -206 -225 12.8808 0.297
NP_442039.1_4 Forward -268 -261 15.1821 0.0124
NP_442039.1_4 Reverse -261 -268 15.1821 0.0124
NP_442039.1_7 Reverse -12 -22 13.0581 0.213
NP_442039.1_7 Forward -120 -110 10.7964 0.257
NP_442039.1_7 Forward -132 -122 7.45319 0.276
NP_442039.1_10 Reverse -97 -115 10.2448 0.293
NP_442829.1_2 Forward -89 -73 15.3886 0.234
NP_442829.1_2 Forward -177 -161 7.65792 0.297
NP_442837.1_3 Forward -268 -261 15.7721 0.0124
NP_442837.1_3 Reverse -261 -268 15.7721 0.0124
NP_440160.1_5 Forward -265 -255 15.0242 0.267
NP_442053.1_1 Forward -269 -260 18.3876 0.0007
NP_442053.1_1 Reverse -260 -269 18.3876 0.0007
NP_440505.1_3 Reverse -258 -268 18.3679 0.00213
NP_440505.1_3 Forward -271 -261 14.1397 0.0235
NP_440505.1_3 Forward -118 -108 5.38824 0.23
NP_440505.1_3 Reverse -235 -245 5.09324 0.246
NP_440505.1_7 Forward -276 -257 5.30933 0.183
NP_442360.1_5 Forward -110 -100 12.6647 0.298
NP_441102.1_2 Forward -356 -337 15.5357 0.139
NP_442532.1_7 Reverse -260 -274 5.60446 0.171
NP_440914.1_1 Forward -269 -259 17.5935 0.000537
NP_440914.1_1 Forward -104 -94 9.00547 0.186
NP_440914.1_1 Reverse -260 -270 8.6151 0.186
NP_441011.1_8 Reverse -261 -270 16.9127 0.00602
NP_441011.1_8 Forward -268 -259 8.25953 0.144
NP_442533.1_1 Reverse -189 -208 -16.9135 0.277
NP_442533.1_6 Forward -269 -260 17.2076 0.00137
NP_442533.1_6 Reverse -260 -269 17.2076 0.00137
NP_442533.1_6 Reverse -95 -104 7.57121 0.0898
NP_442533.1_6 Forward -198 -189 4.22796 0.186
NP_442533.1_6 Reverse -189 -198 4.12963 0.191
NP_442541.1_10 Reverse -89 -103 2.26061 0.263
NP_442541.1_10 Reverse -189 -203 1.08065 0.292
NP_440263.1_5 Forward -41 -27 7.66941 0.294
NP_440263.1_5 Forward -354 -340 6.88276 0.297
NP_442322.1_4 Reverse -87 -104 -9.20492 0.29
NP_441219.1_6 Forward -279 -261 16.2438 0.102
NP_441482.1_7 Reverse -254 -268 -12.3901 0.295
NP_439944.1_9 Forward -268 -258 10.5014 0.0887
NP_439944.1_9 Reverse -261 -271 10.4031 0.0887
NP_441697.1_5 Reverse -54 -73 -10.9342 0.287
NP_440816.1_2 Reverse -367 -386 13.115 0.157
NP_441028.1_6 Reverse -85 -95 12.9592 0.166
NP_441028.1_6 Reverse -140 -150 12.6642 0.183
NP_441028.1_6 Forward -400 -390 5.78111 0.243
NP_441028.1_6 Reverse -109 -119 5.78111 0.243
NP_442202.1_4 Reverse -258 -272 16.0349 0.159
NP_441527.1_4 Forward -87 -68 -8.64244 0.248
NP_441527.1_4 Forward -78 -59 -12.2711 0.285
NP_441527.1_4 Reverse -284 -303 -13.1306 0.298
NP_440115.1_6 Forward -272 -262 9.61647 0.115
NP_440115.1_6 Reverse -257 -267 6.76487 0.167
NP_441059.1_2 Forward -126 -107 -3.3438 0.242
NP_441961.1_2 Forward -296 -277 10.0292 0.234
NP_440608.1_6 Reverse -261 -280 7.76679 0.238
NP_441602.1_3 Reverse -255 -274 9.24257 0.117
NP_441602.1_4 Forward -280 -261 10.1275 0.278
NP_441972.1_5 Forward -215 -196 -3.83545 0.201
NP_441106.1_1 Forward -270 -261 18.191 0.0028
NP_441106.1_1 Reverse -259 -268 9.63616 0.0311
NP_441106.1_1 Forward -16 -7 8.06287 0.0629
NP_439903.1_6 Reverse -92 -111 7.57013 0.151
NP_442306.1_10 Reverse -255 -274 -0.787193 0.0484
NP_441286.1_1 Reverse -259 -271 14.7886 0.00418
NP_441286.1_1 Forward -270 -258 3.38223 0.0467
NP_440670.1_8 Forward -269 -260 18.3876 0.000699
NP_440670.1_8 Reverse -260 -269 18.3876 0.000699
NP_441479.1_9 Reverse -198 -216 14.0805 0.271
NP_440886.1_7 Forward -270 -260 17.7774 0.0011
NP_440886.1_7 Reverse -259 -269 7.94438 0.0805
NP_440886.1_7 Forward -214 -204 3.22451 0.291
NP_442614.1_2 Forward -269 -255 9.04604 0.242
NP_442072.1_9 Reverse -259 -277 -21.3187 0.207
NP_442401.1_2 Forward -208 -189 16.5182 0.0964
NP_442401.1_5 Forward -99 -80 20.5506 0.0831
NP_442401.1_6 Forward -53 -36 26.7849 0.0000677
NP_442401.1_10 Forward -347 -328 23.9913 0.00684
NP_442213.1_6 Reverse -252 -271 3.34271 0.29
NP_441753.1_10 Forward -278 -259 6.88262 0.186
NP_440907.2_8 Reverse -261 -271 17.4824 0.00685
NP_442264.1_5 Forward -284 -270 16.4209 0.222
NP_442264.1_5 Reverse -95 -109 12.586 0.253
NP_440326.1_9 Forward -379 -360 19.1731 0.138
NP_441463.1_2 Reverse -316 -334 4.79171 0.175
NP_441463.1_3 Forward -279 -260 -0.787193 0.133
NP_441463.1_6 Reverse -258 -272 6.02939 0.283
NP_442842.1_4 Reverse -212 -231 2.26107 0.265
NP_441626.1_2 Forward -268 -261 15.7721 0.0124
NP_441626.1_2 Reverse -261 -268 15.7721 0.0124
NP_442211.1_3 Reverse -264 -283 8.93095 0.266
NP_442365.1_7 Reverse -256 -275 0.687771 0.177
NP_442365.1_7 Reverse -92 -111 -5.99873 0.284
NP_442209.1_8 Forward -263 -244 16.8141 0.172
NP_442794.1_1 Reverse -256 -268 7.31547 0.142
NP_442615.1_1 Reverse -251 -269 11.1305 0.0184
NP_442615.1_1 Forward -278 -260 -4.79907 0.194
NP_441962.1_4 Reverse -190 -209 -11.3086 0.239
NP_440387.1_1 Reverse -260 -276 -1.12144 0.142
NP_441431.1_2 Forward -272 -258 10.717 0.155
NP_441431.1_3 Reverse -198 -217 3.24438 0.271
NP_442020.1_1 Forward -231 -212 8.75009 0.157
NP_442020.1_1 Forward -230 -211 2.45694 0.255
NP_441836.1_2 Forward -275 -256 5.70265 0.123
NP_441836.1_2 Reverse -254 -273 -5.01543 0.269
NP_441836.1_2 Reverse -257 -276 -5.60541 0.284
NP_440143.1_1 Reverse -224 -243 12.6841 0.284
NP_441174.1_4 Forward -150 -140 9.91146 0.288
NP_440114.1_10 Reverse -260 -274 13.4709 0.0561
NP_442698.1_10 Forward -95 -76 -0.787193 0.297
NP_442323.1_7 Reverse -90 -109 4.62021 0.215
NP_440293.1_3 Forward -112 -93 -2.16383 0.239
NP_440293.1_3 Reverse -267 -286 -3.83545 0.254
NP_440293.1_3 Reverse -182 -201 -6.09707 0.286
NP_440766.1_6 Reverse -155 -174 19.0757 0.116
NP_442930.1_1 Forward -222 -212 15.9091 0.19
NP_439910.1_2 Reverse -252 -269 -22.3806 0.232
NP_440502.1_3 Reverse -109 -119 14.2769 0.251
NP_442867.1_8 Reverse -261 -280 7.7676 0.242
NP_440457.1_1 Forward -273 -261 0.23564 0.25
NP_440457.1_1 Reverse -256 -268 -0.74767 0.273
NP_440798.1_6 Reverse -261 -274 21.8488 0.0101
NP_441801.1_4 Reverse -86 -96 2.83163 0.231
NP_441801.1_4 Forward -281 -271 2.63497 0.29
NP_442680.1_5 Forward -181 -162 5.54289 0.224
NP_442680.1_5 Reverse -365 -384 5.24982 0.227
NP_442680.1_5 Forward -93 -74 2.51449 0.237
NP_442680.1_5 Forward -94 -75 0.169919 0.268
NP_442297.1_4 Reverse -270 -289 11.6543 0.294
NP_441436.1_6 Reverse -260 -279 13.4708 0.162
NP_441436.1_8 Forward -116 -97 12.9791 0.215
NP_441436.1_8 Forward -106 -87 7.7676 0.293
NP_442509.1_9 Reverse -260 -270 16.2041 0.00739
NP_442509.1_9 Forward -269 -259 8.14104 0.192
NP_442509.1_9 Reverse -275 -285 7.15773 0.234
NP_441253.1_8 Reverse -374 -388 14.3399 0.128
NP_440554.1_4 Reverse -261 -271 13.943 0.0218
NP_440554.1_4 Forward -268 -258 8.92815 0.0646
NP_441885.1_5 Forward -269 -259 20.9245 0.000538
NP_441885.1_5 Reverse -260 -270 11.4848 0.00668
NP_440478.1_3 Forward -279 -260 17.1082 0.228
NP_440478.1_9 Reverse -192 -211 8.35759 0.27
NP_440478.1_10 Forward -271 -257 17.9942 0.107
NP_442341.1_7 Reverse -259 -273 11.8976 0.0502
NP_442341.1_7 Forward -270 -256 6.78443 0.118
NP_441173.1_9 Forward -310 -302 12.9004 0.206
NP_441173.1_9 Reverse -86 -94 12.0154 0.214
NP_442534.1_7 Forward -277 -258 11.7008 0.181
NP_440423.1_6 Forward -277 -258 -13.2752 0.215
NP_443000.1_7 Reverse -258 -268 19.9412 0.00223
NP_443000.1_7 Forward -271 -261 2.04498 0.226
NP_442513.1_5 Forward -277 -258 11.6017 0.266
NP_441842.1_1 Reverse -262 -275 10.2451 0.3
NP_441842.1_10 Forward -276 -262 16.8142 0.0288
NP_440275.1_3 Forward -271 -261 17.9746 0.0082
NP_440275.1_3 Reverse -258 -268 15.123 0.0182
NP_440091.1_1 Forward -273 -261 17.7386 0.013
NP_443010.1_7 Reverse -86 -105 13.175 0.278
NP_443010.1_10 Forward -272 -255 13.6904 0.0694
NP_442638.1_3 Forward -361 -342 10.7424 0.298
NP_439962.1_4 Forward -277 -258 -7.96535 0.292
NP_440175.1_7 Reverse -353 -371 10.4366 0.253
NP_440880.1_5 Reverse -227 -245 14.9655 0.183
NP_442495.1_4 Forward -100 -90 17.5813 0.0771
NP_440804.1_4 Reverse -286 -295 16.716 0.145
NP_440149.1_8 Reverse -260 -279 -0.000545616 0.143
NP_441105.1_3 Reverse -249 -268 1.27776 0.115
NP_440216.1_1 Reverse -260 -274 16.4209 0.00307
NP_440216.1_1 Forward -269 -255 -0.787057 0.0284
NP_440216.1_1 Forward -104 -90 -12.0951 0.24
NP_440172.1_1 Forward -269 -259 15.0247 0.00945
NP_440172.1_1 Reverse -260 -270 8.73149 0.0586
NP_440172.1_1 Reverse -167 -177 5.28991 0.146
NP_440172.1_1 Forward -104 -94 1.84832 0.294
NP_442371.1_1 Reverse -283 -293 11.8776 0.273
NP_442290.1_2 Reverse -78 -97 15.6341 0.144
NP_442290.1_8 Reverse -259 -273 14.5526 0.288
NP_440167.1_3 Forward -279 -260 10.7175 0.233
NP_442788.1_3 Reverse -260 -279 13.3725 0.232
NP_442015.1_10 Forward -273 -260 3.16588 0.185
NP_442015.1_10 Reverse -256 -269 2.67422 0.187
NP_441226.1_7 Forward -268 -261 14.4934 0.0123
NP_441226.1_7 Reverse -261 -268 14.4934 0.0123
NP_442834.1_9 Forward -100 -81 3.44104 0.298
NP_441111.1_7 Forward -268 -260 18.7023 0.00294
NP_441111.1_7 Reverse -261 -269 18.7023 0.00294
NP_441766.1_2 Forward -269 -260 17.5026 0.00297
NP_441766.1_2 Reverse -260 -269 17.5026 0.00297
NP_441766.1_9 Reverse -261 -280 2.85105 0.233
NP_441766.1_9 Forward -277 -258 -0.590531 0.261
NP_440416.1_9 Reverse -253 -272 -17.3068 0.237
NP_440416.1_9 Reverse -88 -107 -20.0601 0.281
NP_443052.1_8 Forward -279 -260 12.7825 0.012
NP_440072.1_5 Reverse -198 -216 -1.55415 0.259
NP_442154.1_1 Reverse -196 -214 -18.3687 0.281
NP_442564.1_10 Reverse -385 -399 9.73436 0.296
NP_440261.1_5 Reverse -261 -274 6.70579 0.0318
NP_440261.1_5 Forward -268 -255 5.03416 0.0478
NP_440988.1_10 Forward -200 -186 5.4797 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTTGCCCCGGTGGGCATTTCTCATTTTTGCTAACGAAACTATAGGAATTTGAGCTATTTTTACTTAACTCAACTTAACAATAAAAGGGCTTTAACCAACTCTCTCTAATTTTTTCTGGGATTCCCCAGGCGGCGATCGCCAGAAAAATATTCCTACTATCCCTAGCGTCAAAACCCTAAAAAATTCCCCCACCCCTAGGGTGCCCACGGCCCAGTCAGGGTTAAGAAATAGCCTAAAAACCTTAACCTCCTGGGGATAAAATCCGCTAACTGGGGGAATCACTGGGGAAAGTCTGGGGAATGGCCTGGGGAGAAACTAGCCAAAAATAAGAATTACAAAATTTTGGGGTTATGTAACAATTTAGAGTTAATTTCCCAGTCTCCCAACGAGGGCAAAACC

CDS

ATGGCCGCTAAAATGAAAAAGGGCAGTTTAGTGCGGGTTATCCGCGCACAATTGGAAAACAGCCTTGAAGCCCAAGCCAGCGATCGCCGTTTACCCGACTACCTTTTCCATAGCAAAGGAGAAGTGTTGGATTTAAACGAAGAATATGCCCTAGTGCGATTTTATGTCCCTACCCCCAACGTCTGGCTGCGCTTAGACCAAATCGAAGCCCTGGCTTAG

Protein

MAAKMKKGSLVRVIRAQLENSLEAQASDRRLPDYLFHSKGEVLDLNEEYALVRFYVPTPNVWLRLDQIEALA