Your browser is old and dusty. Try Google Chrome!

Details for ssl1633

ORF ssl1633
Accession NP_440923.1
Symbol hliC, scpB
Category high light-inducible polypeptide HliC, CAB/ELIP/HLIP superfamily
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -381 -395 10.3243 0.0635
NP_441061.1_2 Reverse -104 -118 0.589577 0.205
NP_441061.1_2 Forward -111 -97 -0.0987402 0.221
NP_440795.1_7 Forward -388 -381 14.6904 0.0123
NP_440795.1_7 Reverse -381 -388 14.6904 0.0123
NP_440795.1_7 Forward -111 -104 14.6904 0.0123
NP_440795.1_7 Reverse -104 -111 14.6904 0.0123
NP_441418.1_6 Forward -389 -370 7.47261 0.00613
NP_441418.1_6 Reverse -103 -122 -1.7705 0.0154
NP_441418.1_6 Forward -338 -319 -29.1065 0.216
NP_441418.1_6 Reverse -120 -139 -29.8932 0.245
NP_440815.1_5 Reverse -103 -122 9.0459 0.228
NP_441480.1_5 Reverse -113 -132 9.73422 0.286
NP_442291.1_5 Reverse -102 -118 -3.67804 0.249
NP_441453.1_1 Reverse -373 -391 2.37835 0.294
NP_441453.1_4 Reverse -103 -111 16.539 0.00633
NP_441453.1_4 Forward -389 -381 16.539 0.00633
NP_441453.1_4 Forward -112 -104 16.539 0.00633
NP_441453.1_4 Reverse -380 -388 7.8859 0.0536
NP_442151.1_6 Forward -112 -98 8.75105 0.164
NP_442151.1_6 Reverse -380 -394 7.76774 0.19
NP_442151.1_6 Reverse -103 -117 5.21113 0.288
NP_441818.1_1 Reverse -381 -392 18.8393 0.00301
NP_441818.1_1 Forward -388 -377 14.4145 0.0502
NP_441818.1_1 Forward -286 -275 9.3996 0.246
NP_441818.1_1 Reverse -104 -115 8.51463 0.288
NP_441818.1_9 Reverse -103 -122 2.94938 0.183
NP_441818.1_9 Reverse -120 -139 -9.63698 0.291
NP_440226.1_1 Forward -112 -93 9.24257 0.0754
NP_440226.1_1 Reverse -380 -399 8.06259 0.0944
NP_440226.1_1 Reverse -103 -122 6.68596 0.122
NP_440226.1_1 Forward -389 -370 1.76941 0.29
NP_441630.1_3 Reverse -95 -114 1.17943 0.252
NP_442655.1_1 Reverse -220 -239 5.40766 0.166
NP_442173.1_1 Forward -111 -103 15.4574 0.00633
NP_442173.1_1 Reverse -381 -389 15.4574 0.00633
NP_442173.1_1 Reverse -104 -112 15.4574 0.00633
NP_442173.1_1 Forward -388 -380 8.27922 0.101
NP_442752.1_4 Forward -389 -382 13.8055 0.0199
NP_442752.1_4 Forward -112 -105 13.8055 0.0199
NP_442752.1_4 Reverse -103 -110 13.8055 0.0199
NP_442752.1_4 Forward -338 -331 4.26735 0.293
NP_443027.1_4 Forward -391 -381 14.0414 0.0452
NP_443027.1_4 Forward -114 -104 7.35486 0.24
NP_441812.1_3 Reverse -102 -116 10.3243 0.222
NP_442975.1_10 Forward -116 -102 4.71887 0.241
NP_442975.1_10 Reverse -376 -390 4.12889 0.249
NP_440784.1_7 Forward -388 -381 15.9687 0.0123
NP_440784.1_7 Reverse -381 -388 15.9687 0.0123
NP_440784.1_7 Forward -111 -104 15.9687 0.0123
NP_440784.1_7 Reverse -104 -111 15.9687 0.0123
NP_442909.1_7 Reverse -381 -395 12.0937 0.131
NP_442909.1_7 Forward -111 -97 9.93039 0.14
NP_440061.1_9 Forward -289 -275 15.2402 0.0489
NP_440061.1_9 Reverse -101 -115 11.7003 0.107
NP_441145.1_1 Reverse -169 -188 6.29264 0.254
NP_441476.1_5 Forward -196 -177 -6.49039 0.274
NP_439979.1_9 Reverse -10 -28 8.96727 0.257
NP_442062.1_8 Reverse -103 -113 17.6796 0.00193
NP_442062.1_8 Forward -112 -102 17.3846 0.00193
NP_442062.1_8 Forward -389 -379 9.41981 0.0625
NP_442062.1_8 Forward -287 -277 9.32148 0.0633
NP_442062.1_8 Reverse -380 -390 7.84651 0.0871
NP_442062.1_8 Reverse -205 -215 3.12662 0.285
NP_442974.1_8 Forward -88 -69 16.0265 0.294
NP_442972.1_2 Reverse -45 -59 13.7653 0.179
NP_440304.1_4 Forward -114 -104 18.9579 0.00406
NP_440304.1_4 Forward -391 -381 10.8948 0.051
NP_440304.1_4 Reverse -378 -388 9.12481 0.0626
NP_440304.1_4 Reverse -80 -90 3.91327 0.289
NP_440304.1_4 Reverse -359 -369 3.71661 0.293
NP_440304.1_4 Reverse -19 -29 3.32329 0.299
NP_440304.1_4 Reverse -101 -111 1.84832 0.299
NP_442242.1_4 Forward -388 -381 14.3954 0.0124
NP_442242.1_4 Reverse -381 -388 14.3954 0.0124
NP_442242.1_4 Forward -111 -104 14.3954 0.0124
NP_442242.1_4 Reverse -104 -111 14.3954 0.0124
NP_440044.1_8 Reverse -381 -400 8.65258 0.0739
NP_440044.1_8 Forward -111 -92 -1.27885 0.241
NP_440853.1_7 Forward -220 -201 15.5357 0.175
NP_439918.1_3 Reverse -100 -119 4.916 0.264
NP_441935.1_6 Forward -295 -276 16.8141 0.277
NP_441619.1_8 Reverse -97 -111 15.3386 0.0847
NP_441619.1_8 Forward -395 -381 8.65209 0.237
NP_441208.1_9 Forward -234 -220 4.71948 0.291
NP_440132.1_1 Reverse -101 -119 8.57394 0.269
NP_441925.1_4 Reverse -215 -234 -12.8826 0.257
NP_440856.1_1 Reverse -166 -185 -2.16383 0.231
NP_441083.1_5 Forward -112 -102 20.3345 0.00053
NP_441083.1_5 Reverse -103 -113 19.3512 0.000718
NP_441083.1_5 Reverse -380 -390 19.0562 0.00147
NP_441083.1_5 Forward -389 -379 9.61647 0.0243
NP_441083.1_5 Reverse -329 -339 7.15819 0.0637
NP_441083.1_5 Forward -338 -328 5.48657 0.116
NP_442827.1_8 Reverse -372 -391 1.76863 0.172
NP_441434.1_6 Reverse -359 -369 16.303 0.243
NP_441738.1_2 Reverse -382 -389 15.28 0.0102
NP_441738.1_2 Forward -110 -103 15.28 0.0102
NP_441738.1_2 Reverse -105 -112 15.28 0.0102
NP_441738.1_4 Reverse -93 -112 4.81767 0.211
NP_441558.1_5 Forward -391 -372 6.39097 0.217
NP_441942.1_7 Reverse -332 -351 13.0775 0.277
NP_441645.1_1 Forward -138 -119 8.06178 0.256
NP_440209.1_1 Reverse -103 -111 18.1123 0.00295
NP_440209.1_1 Forward -389 -381 18.1123 0.00295
NP_440209.1_1 Forward -112 -104 18.1123 0.00295
NP_440209.1_1 Reverse -380 -388 15.1624 0.00583
NP_442889.1_1 Forward -293 -274 -12.0953 0.218
NP_442889.1_8 Forward -115 -101 11.307 0.0733
NP_440808.1_1 Forward -94 -75 17.109 0.22
NP_441713.1_1 Forward -395 -376 -14.7502 0.259
NP_441713.1_5 Forward -354 -335 5.80098 0.271
NP_440178.1_7 Reverse -379 -398 -5.9004 0.0657
NP_440178.1_7 Forward -113 -94 -11.8003 0.103
NP_440178.1_7 Reverse -102 -121 -12.2919 0.118
NP_439953.1_2 Reverse -271 -289 16.4404 0.183
NP_442445.1_1 Reverse -343 -362 18.0924 0.122
NP_441716.1_1 Forward -389 -375 21.3374 0.00655
NP_441716.1_1 Reverse -103 -117 15.1426 0.0532
NP_441716.1_1 Reverse -278 -292 5.01447 0.243
NP_441716.1_1 Forward -338 -324 3.8345 0.259
NP_442111.1_4 Reverse -102 -116 10.816 0.0518
NP_442111.1_4 Forward -390 -376 6.88276 0.11
NP_442111.1_4 Reverse -328 -342 3.34284 0.248
NP_441624.1_7 Forward -29 -15 8.16106 0.24
NP_441533.1_7 Reverse -221 -239 19.4878 0.159
NP_440906.1_5 Forward -388 -381 15.8704 0.0124
NP_440906.1_5 Reverse -381 -388 15.8704 0.0124
NP_440906.1_5 Forward -111 -104 15.8704 0.0124
NP_440906.1_5 Reverse -104 -111 15.8704 0.0124
NP_440747.1_10 Reverse -100 -112 14.887 0.00223
NP_440747.1_10 Forward -115 -103 7.80712 0.00223
NP_440747.1_10 Forward -392 -380 -2.22263 0.026
NP_440747.1_10 Forward -290 -278 -2.81262 0.0713
NP_440747.1_10 Reverse -377 -389 -11.7607 0.142
NP_440747.1_10 Forward -341 -329 -12.0557 0.199
NP_440747.1_10 Reverse -326 -338 -12.2524 0.254
NP_441130.1_10 Reverse -378 -392 9.04604 0.131
NP_441486.1_1 Forward -392 -378 13.2743 0.00871
NP_441486.1_1 Reverse -100 -114 12.8809 0.00979
NP_441486.1_1 Forward -115 -101 5.80112 0.0344
NP_441486.1_1 Reverse -377 -391 2.85119 0.074
NP_442850.1_8 Forward -342 -323 15.729 0.243
NP_442634.1_4 Reverse -101 -115 -1.77037 0.149
NP_441265.1_3 Reverse -374 -388 7.07942 0.181
NP_441265.1_3 Forward -118 -104 3.93283 0.181
NP_441265.1_3 Reverse -251 -265 -0.197071 0.268
NP_440403.1_4 Reverse -94 -113 -6.68705 0.235
NP_440403.1_4 Forward -398 -379 -6.98204 0.236
NP_440403.1_10 Reverse -12 -31 2.26107 0.279
NP_441014.1_10 Reverse -102 -121 2.45694 0.216
NP_442848.1_1 Forward -395 -381 16.0275 0.0143
NP_442848.1_1 Reverse -97 -111 -0.885388 0.263
NP_443018.1_3 Forward -388 -381 14.8871 0.0123
NP_443018.1_3 Reverse -381 -388 14.8871 0.0123
NP_443018.1_3 Forward -111 -104 14.8871 0.0123
NP_443018.1_3 Reverse -104 -111 14.8871 0.0123
NP_441316.1_5 Forward -233 -214 9.83255 0.2
NP_441316.1_7 Forward -114 -99 4.40479 0.131
NP_441316.1_7 Reverse -378 -393 -1.20007 0.228
NP_441634.1_8 Reverse -203 -217 8.75105 0.114
NP_441634.1_8 Forward -391 -377 2.75286 0.163
NP_440376.1_1 Forward -112 -103 19.4693 0.000692
NP_440376.1_1 Reverse -103 -112 19.4693 0.000692
NP_440376.1_1 Forward -389 -380 9.73449 0.0365
NP_440376.1_1 Reverse -380 -389 9.63616 0.0385
NP_440376.1_1 Forward -185 -176 4.22796 0.166
NP_440376.1_1 Forward -287 -278 3.63797 0.2
NP_441588.1_4 Forward -110 -100 15.9097 0.0369
NP_441588.1_4 Reverse -382 -392 8.63316 0.14
NP_440794.1_7 Forward -390 -373 10.2653 0.251
NP_442687.1_7 Forward -113 -103 18.5646 0.0028
NP_442687.1_7 Reverse -379 -389 15.8113 0.0125
NP_442687.1_7 Reverse -102 -112 8.92815 0.0994
NP_442485.1_3 Reverse -369 -388 -3.3438 0.273
NP_440642.1_10 Forward -26 -12 2.75226 0.277
NP_440642.1_10 Forward -365 -351 2.45727 0.277
NP_441013.1_3 Reverse -277 -296 12.1925 0.204
NP_441013.1_3 Reverse -336 -355 6.4893 0.281
NP_440533.1_6 Forward -238 -219 8.75091 0.276
NP_442296.1_5 Forward -121 -102 7.37428 0.213
NP_442296.1_5 Reverse -371 -390 4.32602 0.251
NP_442296.1_9 Forward -111 -92 0.294447 0.197
NP_442658.1_1 Forward -114 -104 14.8275 0.0188
NP_442658.1_1 Reverse -378 -388 12.6642 0.0497
NP_442658.1_1 Reverse -276 -286 9.321 0.161
NP_442658.1_1 Reverse -101 -111 6.76441 0.214
NP_442658.1_1 Forward -391 -381 6.76441 0.214
NP_440141.1_8 Forward -240 -221 5.211 0.277
NP_442782.1_7 Forward -397 -378 1.37609 0.202
NP_441414.1_9 Forward -112 -93 15.9291 0.0106
NP_441414.1_9 Reverse -380 -399 7.17762 0.0358
NP_441414.1_9 Reverse -103 -122 -10.522 0.287
NP_442937.1_5 Reverse -98 -117 7.57094 0.248
NP_442321.1_1 Reverse -118 -137 -8.45701 0.291
NP_441958.1_5 Forward -113 -103 20.5312 0.000966
NP_441958.1_5 Reverse -102 -112 12.2714 0.00183
NP_441958.1_5 Reverse -379 -389 10.6981 0.0112
NP_441958.1_5 Forward -390 -380 3.12662 0.0364
NP_441958.1_5 Forward -339 -329 -0.609952 0.215
NP_442486.1_4 Forward -110 -91 16.4207 0.118
NP_442486.1_6 Reverse -374 -393 -3.93378 0.266
NP_440203.1_5 Reverse -280 -290 13.0576 0.131
NP_439905.1_1 Forward -286 -273 9.06573 0.224
NP_439905.1_2 Forward -150 -136 7.76774 0.291
NP_440984.1_7 Reverse -98 -112 11.0127 0.122
NP_439990.1_5 Reverse -98 -111 7.6891 0.186
NP_439990.1_5 Forward -292 -279 6.90245 0.22
NP_439990.1_5 Forward -394 -381 6.70579 0.223
NP_442376.1_2 Reverse -119 -138 -6.29373 0.286
NP_442911.1_2 Forward -122 -103 -1.57384 0.0871
NP_442911.1_2 Reverse -93 -112 -3.54046 0.114
NP_442911.1_2 Reverse -370 -389 -9.24366 0.252
NP_441580.1_6 Forward -400 -381 -7.76869 0.246
NP_443055.1_3 Forward -121 -102 15.4197 0.096
NP_443055.1_3 Forward -94 -75 10.7406 0.28
NP_440993.1_3 Forward -163 -144 -0.591301 0.272
NP_440934.1_1 Reverse -89 -108 7.27595 0.233
NP_442210.1_9 Reverse -87 -105 10.1472 0.246
NP_440138.1_6 Forward -111 -92 3.73524 0.24
NP_440138.1_6 Reverse -381 -400 2.6536 0.262
NP_441099.1_5 Forward -122 -103 7.17762 0.0429
NP_441099.1_5 Reverse -93 -112 -11.3086 0.276
NP_442002.1_9 Forward -339 -332 14.1004 0.074
NP_442002.1_9 Forward -113 -106 14.1004 0.074
NP_440809.1_9 Reverse -371 -389 12.9988 0.0632
NP_441294.1_7 Reverse -376 -390 16.8337 0.0122
NP_442438.1_10 Reverse -168 -182 8.16106 0.0812
NP_441000.1_6 Reverse -379 -393 -2.36035 0.216
NP_440147.1_4 Reverse -101 -114 11.6223 0.0326
NP_440147.1_4 Forward -114 -101 4.05085 0.173
NP_441550.1_8 Forward -114 -104 15.4175 0.0132
NP_441550.1_8 Reverse -101 -111 14.6309 0.0132
NP_441550.1_8 Forward -391 -381 12.3692 0.0336
NP_441550.1_8 Reverse -378 -388 11.7793 0.0435
NP_441550.1_8 Forward -340 -330 11.7793 0.0435
NP_441550.1_8 Reverse -327 -337 5.19112 0.26
NP_441916.1_7 Reverse -103 -113 16.893 0.00407
NP_441916.1_7 Forward -112 -102 10.3048 0.0261
NP_441916.1_7 Forward -389 -379 7.55152 0.0639
NP_441916.1_7 Forward -185 -175 5.19158 0.141
NP_441916.1_7 Reverse -380 -390 2.04498 0.265
NP_441916.1_10 Forward -120 -101 4.62101 0.223
NP_440345.1_3 Reverse -35 -49 9.94278 0.297
NP_441041.1_4 Reverse -103 -122 0.982764 0.0818
NP_441041.1_4 Reverse -129 -148 -8.94866 0.209
NP_441041.1_4 Forward -389 -370 -11.4069 0.246
NP_441041.1_7 Forward -115 -103 9.94422 0.104
NP_442396.1_5 Reverse -99 -112 21.1604 0.00421
NP_442396.1_5 Reverse -116 -129 5.82081 0.265
NP_442396.1_5 Forward -249 -236 5.13249 0.3
NP_440569.1_7 Reverse -103 -122 9.83255 0.286
NP_442004.1_6 Forward -389 -375 2.06454 0.274
NP_442004.1_6 Reverse -380 -394 2.06454 0.274
NP_442004.1_6 Reverse -374 -388 1.76955 0.278
NP_441725.1_5 Reverse -104 -114 21.0229 0.00533
NP_441725.1_5 Forward -388 -378 19.0562 0.0119
NP_441725.1_5 Reverse -381 -391 11.2881 0.0247
NP_441725.1_5 Forward -111 -101 2.04498 0.115
NP_439966.1_7 Forward -391 -381 15.8108 0.0124
NP_439966.1_7 Reverse -378 -388 9.81266 0.1
NP_439966.1_7 Forward -114 -104 9.12434 0.119
NP_439966.1_7 Reverse -101 -111 7.25606 0.15
NP_439966.1_7 Reverse -327 -337 5.68278 0.214
NP_440202.1_8 Forward -120 -101 10.7789 0.291
NP_442941.1_3 Reverse -381 -391 19.9412 0.00262
NP_442941.1_3 Reverse -104 -114 11.3864 0.0116
NP_442941.1_3 Forward -111 -101 11.0914 0.0116
NP_442941.1_3 Forward -388 -378 1.94665 0.147
NP_440289.1_2 Forward -392 -379 14.8673 0.0107
NP_440289.1_2 Forward -115 -102 13.0973 0.0132
NP_440289.1_2 Reverse -377 -390 12.8023 0.0139
NP_440289.1_2 Reverse -100 -113 -2.144 0.251
NP_440983.1_5 Forward -150 -131 -7.67036 0.291
NP_440260.1_8 Forward -182 -164 -2.3408 0.243
NP_442281.1_1 Forward -117 -103 21.4351 0.00192
NP_442281.1_1 Reverse -98 -112 8.94708 0.0747
NP_442281.1_1 Forward -394 -380 7.66879 0.0949
NP_442281.1_1 Forward -291 -277 2.94893 0.249
NP_442847.1_7 Reverse -277 -296 13.0775 0.286
NP_440177.1_9 Reverse -95 -114 14.5524 0.213
NP_442256.1_2 Reverse -101 -119 0.0191479 0.131
NP_442256.1_2 Reverse -378 -396 -0.0791831 0.136
NP_442256.1_2 Forward -114 -96 -9.12563 0.249
NP_440437.1_1 Reverse -374 -393 14.0608 0.0272
NP_442012.1_1 Reverse -271 -290 3.24438 0.182
NP_442012.1_1 Reverse -97 -116 0.884433 0.229
NP_442012.1_2 Forward -391 -372 4.52268 0.216
NP_439983.1_7 Forward -235 -217 18.997 0.127
NP_441087.1_6 Forward -30 -12 -2.83317 0.296
NP_440498.1_1 Forward -121 -103 -1.75081 0.231
NP_443030.1_4 Reverse -271 -290 -6.98204 0.294
NP_441644.1_6 Forward -112 -102 17.3841 0.00127
NP_441644.1_6 Reverse -103 -113 15.7125 0.0048
NP_441644.1_6 Reverse -380 -390 14.7292 0.0105
NP_441644.1_6 Forward -389 -379 11.9759 0.0408
NP_441644.1_6 Reverse -176 -186 8.63269 0.097
NP_443049.1_6 Forward -390 -380 13.8856 0.139
NP_443049.1_6 Forward -339 -329 13.6904 0.149
NP_442215.1_2 Reverse -101 -117 6.45005 0.0712
NP_442215.1_2 Reverse -275 -291 3.20513 0.1
NP_442215.1_2 Reverse -223 -239 -5.64466 0.254
NP_440929.1_8 Forward -112 -103 19.2726 0.000701
NP_440929.1_8 Reverse -103 -112 19.2726 0.000701
NP_440929.1_8 Forward -389 -380 9.93116 0.0249
NP_440929.1_8 Reverse -380 -389 9.83282 0.0254
NP_442933.1_10 Forward -112 -103 17.601 0.00325
NP_442933.1_10 Reverse -103 -112 17.601 0.00325
NP_442933.1_10 Forward -389 -380 9.04618 0.063
NP_442933.1_10 Reverse -380 -389 8.94785 0.0643
NP_441751.2_8 Reverse -381 -395 12.7826 0.0191
NP_441751.2_8 Reverse -104 -118 7.07942 0.0341
NP_441751.2_8 Forward -111 -97 -3.147 0.134
NP_441751.2_8 Forward -388 -374 -4.22864 0.166
NP_441751.2_8 Reverse -330 -344 -5.40861 0.206
NP_442554.1_8 Reverse -381 -391 15.9097 0.00747
NP_442554.1_8 Forward -111 -101 15.3197 0.00882
NP_442554.1_8 Reverse -104 -114 14.828 0.0108
NP_442554.1_8 Forward -388 -378 5.28991 0.153
NP_441762.1_7 Forward -113 -101 8.9871 0.0142
NP_441762.1_7 Forward -390 -378 -4.87757 0.183
NP_441762.1_7 Reverse -379 -391 -5.76255 0.238
NP_441762.1_7 Reverse -102 -114 -6.94252 0.284
NP_442142.1_4 Forward -115 -102 15.1616 0.0289
NP_442142.1_4 Reverse -377 -390 8.67183 0.111
NP_442142.1_4 Forward -188 -175 4.64028 0.214
NP_442142.1_4 Forward -392 -379 4.24695 0.227
NP_442292.1_1 Forward -111 -102 18.486 0.00229
NP_442292.1_1 Reverse -381 -390 18.486 0.00229
NP_442292.1_1 Reverse -104 -113 9.53783 0.0183
NP_442292.1_1 Forward -388 -379 0.688044 0.23
NP_440919.1_7 Forward -252 -234 13.6455 0.147
NP_442476.1_6 Forward -111 -97 8.16106 0.105
NP_442476.1_6 Reverse -381 -395 0.491246 0.258
NP_440895.1_10 Forward -183 -166 -4.87771 0.262
NP_442381.1_8 Reverse -100 -119 -14.5535 0.283
NP_443009.1_5 Reverse -102 -113 15.7911 0.0107
NP_443009.1_5 Forward -113 -102 11.1696 0.066
NP_443009.1_5 Forward -288 -277 7.92465 0.118
NP_443009.1_5 Forward -390 -379 7.138 0.137
NP_443009.1_5 Reverse -204 -215 5.46638 0.202
NP_442408.2_1 Reverse -103 -122 1.17943 0.193
NP_441715.1_4 Reverse -381 -391 14.828 0.0268
NP_441715.1_4 Forward -111 -101 7.94484 0.107
NP_441715.1_4 Reverse -104 -114 7.25653 0.108
NP_440158.1_8 Reverse -118 -137 11.7992 0.239
NP_440183.1_1 Reverse -104 -123 7.37428 0.262
NP_441198.1_8 Forward -114 -104 13.076 0.108
NP_440379.1_5 Reverse -274 -293 1.86774 0.153
NP_440464.1_10 Forward -111 -101 13.0082 0.169
NP_441468.1_1 Forward -388 -381 15.8704 0.0124
NP_441468.1_1 Reverse -381 -388 15.8704 0.0124
NP_441468.1_1 Forward -111 -104 15.8704 0.0124
NP_441468.1_1 Reverse -104 -111 15.8704 0.0124
NP_441618.1_3 Reverse -329 -348 1.96607 0.228
NP_441020.2_6 Reverse -101 -118 17.7384 0.0169
NP_441020.2_6 Reverse -118 -135 10.3636 0.146
NP_441020.2_6 Forward -114 -97 9.18362 0.179
NP_441020.2_6 Reverse -378 -395 6.62702 0.26
NP_441015.1_8 Forward -118 -99 -0.39387 0.292
NP_441015.1_10 Forward -233 -214 -8.06369 0.272
NP_441015.1_10 Reverse -10 -29 -8.752 0.277
NP_441673.1_1 Forward -112 -103 20.8459 0.000698
NP_441673.1_1 Reverse -103 -112 20.8459 0.000698
NP_441673.1_1 Forward -389 -380 11.1111 0.0121
NP_441673.1_1 Reverse -380 -389 11.0128 0.018
NP_442253.1_5 Forward -290 -273 -6.35267 0.298
NP_442253.1_5 Reverse -274 -291 -7.13932 0.298
NP_440265.1_7 Reverse -91 -105 17.2068 0.158
NP_441826.1_2 Forward -395 -381 10.7177 0.0451
NP_441826.1_2 Forward -118 -104 2.16287 0.134
NP_441826.1_2 Reverse -374 -388 0.196253 0.194
NP_441826.1_2 Reverse -323 -337 -2.55701 0.273
NP_441826.1_2 Forward -185 -171 -3.73699 0.286
NP_442868.1_6 Forward -391 -381 9.91146 0.038
NP_442868.1_6 Reverse -101 -111 9.81313 0.038
NP_442868.1_6 Forward -114 -104 9.22315 0.0527
NP_442868.1_6 Reverse -378 -388 8.92815 0.0555
NP_442868.1_6 Reverse -276 -286 2.63497 0.205
NP_441056.1_1 Reverse -103 -122 -0.983855 0.17
NP_441056.1_1 Reverse -380 -399 -2.26216 0.204
NP_441612.1_2 Forward -112 -102 8.54929 0.21
NP_442019.1_8 Forward -34 -15 9.53756 0.224
NP_442227.1_2 Forward -28 -9 -1.96717 0.269
NP_442227.1_2 Forward -354 -335 -2.95047 0.285
NP_442808.1_1 Reverse -379 -389 9.12434 0.0481
NP_442808.1_1 Forward -113 -103 8.73102 0.0481
NP_442808.1_1 Reverse -102 -112 8.63269 0.0481
NP_442808.1_1 Reverse -276 -286 2.73286 0.256
NP_442775.1_6 Forward -242 -223 12.1925 0.277
NP_440145.1_3 Reverse -166 -185 -3.63879 0.206
NP_442542.1_2 Reverse -378 -391 9.55739 0.134
NP_442542.1_2 Forward -340 -327 7.29578 0.187
NP_442050.1_5 Forward -391 -381 16.4991 0.00812
NP_442050.1_5 Forward -114 -104 15.8108 0.0091
NP_442050.1_5 Reverse -378 -388 14.8275 0.0179
NP_442050.1_5 Forward -268 -258 7.94438 0.243
NP_442050.1_5 Reverse -101 -111 7.64939 0.243
NP_440334.1_2 Reverse -77 -90 14.3756 0.252
NP_441493.2_10 Reverse -92 -111 9.24257 0.249
NP_441493.2_10 Forward -400 -381 7.07928 0.249
NP_440601.1_8 Forward -176 -157 20.9381 0.0882
NP_440601.1_8 Reverse -93 -112 14.488 0.249
NP_441114.1_3 Reverse -279 -288 17.1093 0.113
NP_441114.1_3 Forward -285 -276 7.66954 0.231
NP_440558.1_2 Forward -290 -271 3.24438 0.159
NP_440558.1_2 Reverse -274 -293 -0.0988766 0.198
NP_440558.1_2 Forward -121 -102 -3.54046 0.236
NP_441498.1_3 Forward -40 -22 8.6715 0.214
NP_442789.1_4 Reverse -10 -29 -5.31042 0.269
NP_441518.1_3 Forward -122 -103 -14.3569 0.275
NP_441518.1_3 Forward -399 -380 -14.9469 0.284
NP_441878.1_4 Reverse -347 -366 8.35759 0.204
NP_441878.1_6 Forward -113 -103 20.2362 0.0046
NP_441878.1_6 Reverse -379 -389 10.4031 0.0176
NP_441878.1_6 Reverse -102 -112 10.4031 0.0176
NP_441878.1_6 Reverse -277 -287 2.24165 0.0462
NP_441878.1_6 Forward -390 -380 0.668351 0.139
NP_441878.1_6 Forward -287 -277 -6.70647 0.194
NP_441878.1_6 Forward -186 -176 -7.88644 0.278
NP_441036.1_8 Forward -113 -103 8.4365 0.174
NP_441036.1_8 Reverse -102 -112 8.33817 0.174
NP_441036.1_8 Reverse -379 -389 6.07655 0.242
NP_441557.1_5 Forward -112 -103 19.9609 0.000699
NP_441557.1_5 Reverse -103 -112 19.9609 0.000699
NP_441557.1_5 Forward -389 -380 10.8161 0.00464
NP_441557.1_5 Reverse -380 -389 10.4228 0.00915
NP_441445.1_1 Reverse -371 -390 15.0441 0.0475
NP_441445.1_1 Forward -121 -102 6.88262 0.14
NP_441445.1_1 Reverse -320 -339 3.14605 0.218
NP_441445.1_1 Forward -398 -379 2.3594 0.235
NP_442066.2_9 Reverse -99 -112 11.1307 0.154
NP_442066.2_9 Forward -393 -380 7.29578 0.237
NP_440101.1_8 Reverse -168 -181 21.0621 0.0881
NP_442830.1_5 Reverse -276 -290 0.883986 0.29
NP_442183.1_1 Reverse -103 -117 16.3225 0.0151
NP_442183.1_1 Forward -112 -98 11.5043 0.0702
NP_442183.1_1 Reverse -380 -394 10.521 0.0829
NP_440190.1_4 Reverse -201 -218 26.3915 0.00371
NP_440979.1_3 Forward -388 -370 18.2104 0.176
NP_441549.1_9 Forward -393 -375 1.49411 0.101
NP_441549.1_9 Reverse -99 -117 -4.01242 0.198
NP_442347.1_2 Reverse -381 -390 12.4878 0.056
NP_442347.1_2 Forward -111 -102 12.4878 0.056
NP_442347.1_2 Reverse -330 -339 3.44131 0.284
NP_442347.1_2 Reverse -104 -113 3.34298 0.284
NP_442645.1_2 Reverse -95 -114 -22.6167 0.292
NP_441037.1_4 Forward -114 -104 9.65667 0.21
NP_441037.1_4 Reverse -101 -111 7.9999 0.237
NP_441037.1_4 Forward -77 -67 6.34312 0.267
NP_442594.1_7 Forward -123 -104 7.37347 0.196
NP_442508.1_9 Reverse -119 -133 14.6509 0.273
NP_440151.1_5 Forward -184 -165 3.24438 0.289
NP_442317.1_6 Reverse -98 -117 7.37428 0.229
NP_441633.1_3 Reverse -101 -114 10.5407 0.0286
NP_441633.1_3 Forward -391 -378 -6.37223 0.248
NP_440136.1_2 Forward -388 -381 15.9687 0.0123
NP_440136.1_2 Reverse -381 -388 15.9687 0.0123
NP_440136.1_2 Forward -111 -104 15.9687 0.0123
NP_440136.1_2 Reverse -104 -111 15.9687 0.0123
NP_442590.1_9 Forward -241 -222 4.42435 0.273
NP_442590.1_10 Reverse -329 -348 9.53756 0.196
NP_442998.1_5 Reverse -12 -22 7.94484 0.278
NP_442998.1_10 Reverse -382 -389 15.5754 0.0102
NP_442998.1_10 Forward -110 -103 15.5754 0.0102
NP_442998.1_10 Reverse -105 -112 15.5754 0.0102
NP_442998.1_10 Reverse -331 -338 5.93897 0.206
NP_442998.1_10 Forward -387 -380 5.84064 0.235
NP_440899.1_1 Forward -400 -381 9.67614 0.21
NP_440899.1_1 Reverse -92 -111 6.26042 0.287
NP_440299.1_1 Reverse -99 -112 12.9984 0.0319
NP_440299.1_1 Forward -116 -103 9.45847 0.0709
NP_440299.1_1 Reverse -376 -389 3.7553 0.232
NP_441799.1_1 Reverse -376 -390 12.8803 0.0385
NP_441799.1_1 Forward -116 -102 12.8803 0.0385
NP_441799.1_1 Reverse -99 -113 9.24208 0.0966
NP_441799.1_1 Forward -393 -379 3.93223 0.274
NP_441007.1_10 Forward -394 -381 9.95071 0.0804
NP_441007.1_10 Reverse -98 -111 8.27909 0.115
NP_441007.1_10 Reverse -171 -184 1.29759 0.203
NP_441007.1_10 Forward -117 -104 -0.472371 0.285
NP_441435.1_6 Reverse -171 -190 2.16274 0.259
NP_440256.1_1 Forward -392 -373 -2.0655 0.112
NP_440256.1_1 Forward -115 -96 -10.3253 0.299
NP_441559.1_4 Reverse -100 -119 7.37428 0.12
NP_441559.1_8 Reverse -273 -287 4.42448 0.119
NP_441559.1_8 Forward -291 -277 -4.32697 0.222
NP_441559.1_8 Forward -292 -278 -6.68692 0.279
NP_440915.1_6 Reverse -99 -113 1.57289 0.134
NP_440915.1_6 Forward -393 -379 1.08123 0.147
NP_442866.1_1 Reverse -272 -291 -3.14714 0.217
NP_442866.1_1 Reverse -98 -117 -4.42544 0.227
NP_442866.1_1 Forward -96 -77 -4.91709 0.237
NP_440748.1_5 Forward -127 -108 -2.45882 0.274
NP_441464.1_8 Reverse -205 -219 3.53951 0.296
NP_440026.1_4 Forward -392 -373 9.53756 0.253
NP_440695.1_5 Forward -389 -370 1.67108 0.28
NP_442993.1_1 Forward -185 -169 -13.8061 0.295
NP_442386.1_9 Reverse -102 -111 13.8639 0.0289
NP_442386.1_9 Forward -390 -381 13.8639 0.0289
NP_442386.1_9 Reverse -379 -388 8.35743 0.201
NP_442386.1_9 Forward -113 -104 6.39082 0.219
NP_441340.1_5 Forward -388 -381 15.6737 0.0124
NP_441340.1_5 Reverse -381 -388 15.6737 0.0124
NP_441340.1_5 Forward -111 -104 15.6737 0.0124
NP_441340.1_5 Reverse -104 -111 15.6737 0.0124
NP_442484.1_2 Reverse -92 -111 2.26107 0.226
NP_440161.1_3 Reverse -101 -120 8.25926 0.273
NP_440161.1_3 Reverse -378 -397 8.16093 0.276
NP_442714.1_7 Forward -286 -267 -1.08219 0.281
NP_440586.1_1 Reverse -116 -135 0.392778 0.237
NP_440586.1_8 Forward -388 -381 13.2151 0.026
NP_440586.1_8 Forward -111 -104 13.2151 0.026
NP_440586.1_8 Reverse -381 -388 13.2151 0.026
NP_440586.1_8 Reverse -104 -111 13.2151 0.026
NP_442251.1_6 Forward -388 -381 15.2804 0.0124
NP_442251.1_6 Reverse -381 -388 15.2804 0.0124
NP_442251.1_6 Forward -111 -104 15.2804 0.0124
NP_442251.1_6 Reverse -104 -111 15.2804 0.0124
NP_440684.1_9 Reverse -97 -111 12.6843 0.168
NP_440684.1_9 Forward -395 -381 9.83269 0.216
NP_441262.1_3 Reverse -103 -110 14.7888 0.0223
NP_441262.1_3 Forward -389 -382 14.7888 0.0223
NP_441262.1_3 Forward -112 -105 14.7888 0.0223
NP_441262.1_3 Reverse -380 -387 6.52896 0.0809
NP_443051.1_1 Forward -113 -104 18.0926 0.00402
NP_443051.1_1 Reverse -102 -111 10.4228 0.00754
NP_443051.1_1 Forward -390 -381 10.4228 0.00754
NP_443051.1_1 Reverse -379 -388 8.65285 0.029
NP_443051.1_1 Forward -339 -330 5.40793 0.0926
NP_441232.1_10 Reverse -92 -111 7.7676 0.142
NP_439984.1_3 Reverse -96 -110 13.8636 0.216
NP_439937.1_9 Forward -288 -271 -10.0899 0.221
NP_439937.1_9 Reverse -211 -228 -12.7448 0.276
NP_439937.1_9 Forward -390 -373 -14.9081 0.287
NP_440408.1_7 Reverse -288 -307 7.37428 0.29
NP_440408.1_7 Reverse -157 -176 6.98095 0.295
NP_440439.1_1 Forward -115 -102 0.215946 0.199
NP_442239.1_8 Reverse -164 -183 5.50599 0.274
NP_439943.1_4 Forward -328 -309 9.3409 0.241
NP_440372.1_2 Forward -388 -381 16.3621 0.0124
NP_440372.1_2 Reverse -381 -388 16.3621 0.0124
NP_440372.1_2 Forward -111 -104 16.3621 0.0124
NP_440372.1_2 Reverse -104 -111 16.3621 0.0124
NP_440372.1_2 Forward -337 -330 4.07068 0.262
NP_442783.1_2 Forward -239 -220 14.7491 0.129
NP_440139.1_1 Reverse -374 -393 12.6833 0.0734
NP_440139.1_1 Forward -118 -99 3.34192 0.208
NP_440267.1_2 Forward -117 -103 16.4202 0.0566
NP_442384.1_10 Forward -112 -99 15.8506 0.00946
NP_442384.1_10 Reverse -103 -116 9.06573 0.0574
NP_442384.1_10 Forward -389 -376 8.86907 0.0606
NP_442384.1_10 Reverse -329 -342 6.4108 0.102
NP_442384.1_10 Reverse -85 -98 1.10092 0.268
NP_441018.1_7 Reverse -99 -118 6.68596 0.283
NP_442790.1_4 Reverse -94 -113 -11.4069 0.226
NP_442262.1_10 Forward -388 -381 14.1988 0.0123
NP_442262.1_10 Reverse -381 -388 14.1988 0.0123
NP_442262.1_10 Forward -111 -104 14.1988 0.0123
NP_442262.1_10 Reverse -104 -111 14.1988 0.0123
NP_441689.1_5 Forward -391 -381 15.3192 0.0403
NP_441689.1_5 Forward -114 -104 8.63269 0.132
NP_441689.1_5 Reverse -101 -111 5.78111 0.197
NP_440163.1_10 Forward -392 -382 11.3864 0.169
NP_440344.1_10 Reverse -373 -390 7.02034 0.0156
NP_440344.1_10 Forward -119 -102 -2.02611 0.06
NP_440282.1_10 Forward -122 -103 -9.047 0.269
NP_440531.1_6 Forward -120 -101 1.76941 0.169
NP_440531.1_6 Forward -397 -378 0.786102 0.187
NP_442123.1_3 Forward -214 -195 10.8159 0.269
NP_441060.1_1 Reverse -82 -101 13.9343 0.294
NP_442910.1_1 Forward -293 -274 -8.26035 0.289
NP_440562.1_3 Forward -184 -167 3.18543 0.246
NP_441965.1_3 Forward -276 -257 1.37609 0.221
NP_441965.1_7 Forward -23 -4 11.8967 0.285
NP_441965.1_10 Reverse -377 -393 8.22001 0.131
NP_441965.1_10 Forward -115 -99 3.59845 0.259
NP_440297.1_9 Reverse -104 -114 19.0562 0.0359
NP_440297.1_9 Forward -388 -378 10.5998 0.0917
NP_440297.1_9 Reverse -381 -391 9.32148 0.0917
NP_440297.1_9 Forward -111 -101 -0.118297 0.282
NP_440350.1_5 Forward -311 -292 -7.27704 0.299
NP_442187.1_3 Forward -390 -380 17.188 0.0619
NP_442280.1_1 Reverse -103 -122 7.57094 0.162
NP_440937.1_5 Reverse -114 -133 12.6841 0.275
NP_440937.1_5 Reverse -271 -290 7.7676 0.29
NP_443036.1_1 Reverse -334 -353 11.2084 0.246
NP_440999.1_9 Forward -259 -245 -2.16369 0.261
NP_440888.1_2 Reverse -380 -394 12.487 0.0442
NP_440888.1_2 Forward -112 -98 7.07881 0.208
NP_440600.1_4 Reverse -95 -113 9.36059 0.0635
NP_442033.1_10 Reverse -276 -295 -12.2919 0.267
NP_442033.1_10 Forward -289 -270 -13.0786 0.281
NP_442077.1_4 Reverse -85 -104 9.53756 0.154
NP_441543.1_2 Forward -111 -102 16.9127 0.00359
NP_441543.1_2 Reverse -381 -390 16.9127 0.00359
NP_441543.1_2 Reverse -104 -113 9.34117 0.0818
NP_442845.1_2 Forward -395 -381 6.09611 0.217
NP_442845.1_2 Reverse -97 -111 5.99778 0.219
NP_441551.1_5 Reverse -376 -392 9.10428 0.218
NP_441469.1_8 Forward -113 -104 13.3727 0.073
NP_441469.1_8 Reverse -379 -388 12.6844 0.0995
NP_441469.1_8 Reverse -277 -286 9.4395 0.227
NP_441469.1_8 Forward -390 -381 6.48957 0.227
NP_441469.1_8 Reverse -102 -111 6.48957 0.227
NP_443064.1_6 Reverse -103 -113 13.8273 0.0796
NP_443064.1_6 Forward -112 -102 12.5669 0.0796
NP_443064.1_6 Reverse -380 -390 9.46426 0.219
NP_442578.1_7 Forward -388 -381 14.5921 0.026
NP_442578.1_7 Forward -111 -104 14.5921 0.026
NP_442578.1_7 Reverse -381 -388 14.5921 0.026
NP_442578.1_7 Reverse -104 -111 14.5921 0.026
NP_440710.1_1 Forward -120 -102 -3.52077 0.208
NP_440710.1_1 Reverse -95 -113 -9.32229 0.297
NP_440220.1_4 Forward -31 -12 -3.24622 0.285
NP_441462.1_2 Reverse -103 -113 20.1379 0.000967
NP_441462.1_2 Forward -389 -379 17.8763 0.00406
NP_441462.1_2 Forward -112 -102 11.5831 0.00406
NP_441462.1_2 Reverse -380 -390 1.74999 0.0811
NP_441462.1_2 Forward -185 -175 -0.708283 0.245
NP_443062.1_1 Reverse -380 -398 19.5642 0.0208
NP_443062.1_1 Reverse -103 -121 12.2512 0.0831
NP_443062.1_1 Forward -112 -94 11.5686 0.0962
NP_443062.1_6 Forward -397 -378 4.71934 0.214
NP_443062.1_6 Reverse -372 -391 4.03102 0.224
NP_443062.1_6 Reverse -95 -114 2.94938 0.247
NP_442204.1_1 Forward -116 -105 0.0586712 0.284
NP_442204.1_10 Forward -101 -82 18.7807 0.11
NP_441560.1_10 Forward -120 -101 16.0274 0.0867
NP_440504.1_7 Reverse -272 -291 -3.83545 0.256
NP_440516.1_8 Forward -389 -380 18.9776 0.00442
NP_440516.1_8 Forward -112 -103 16.9127 0.00442
NP_440516.1_8 Reverse -103 -112 16.9127 0.00442
NP_440516.1_8 Forward -338 -329 9.24284 0.0264
NP_440516.1_8 Reverse -380 -389 7.07956 0.0867
NP_442428.1_5 Forward -388 -381 15.8704 0.0124
NP_442428.1_5 Reverse -381 -388 15.8704 0.0124
NP_442428.1_5 Forward -111 -104 15.8704 0.0124
NP_442428.1_5 Reverse -104 -111 15.8704 0.0124
NP_440673.1_2 Reverse -166 -185 7.85324 0.288
NP_440673.1_3 Forward -387 -380 13.1171 0.0426
NP_440673.1_3 Forward -110 -103 12.4288 0.0426
NP_440673.1_3 Reverse -382 -389 12.4288 0.0426
NP_440673.1_3 Reverse -105 -112 12.4288 0.0426
NP_440673.1_3 Reverse -331 -338 10.1672 0.149
NP_440673.1_3 Forward -28 -21 6.23397 0.283
NP_441052.1_2 Reverse -380 -390 20.5312 0.00106
NP_441052.1_2 Forward -112 -102 19.9412 0.00106
NP_441052.1_2 Reverse -103 -113 10.4031 0.0285
NP_441052.1_2 Reverse -278 -288 5.48657 0.116
NP_441052.1_2 Forward -389 -379 0.668351 0.256
NP_442219.1_9 Forward -111 -102 17.7976 0.00718
NP_442219.1_9 Reverse -381 -390 17.7976 0.00718
NP_442219.1_9 Forward -388 -379 8.84951 0.0681
NP_442219.1_9 Reverse -104 -113 8.25953 0.0681
NP_440436.1_4 Forward -111 -102 17.2072 0.00233
NP_440436.1_4 Reverse -381 -390 17.2072 0.00233
NP_440436.1_4 Reverse -104 -113 15.9289 0.00508
NP_440436.1_4 Forward -388 -379 6.78414 0.147
NP_441884.1_8 Forward -113 -94 -6.1954 0.217
NP_441884.1_8 Reverse -123 -142 -7.27704 0.248
NP_441884.1_8 Reverse -379 -398 -12.2919 0.271
NP_441884.1_8 Forward -242 -223 -14.0619 0.298
NP_441884.1_9 Forward -392 -373 -20.5517 0.194
NP_441884.1_9 Forward -115 -96 -26.6482 0.29
NP_440314.1_9 Forward -111 -92 -6.58872 0.23
NP_440577.1_2 Reverse -266 -285 14.4541 0.219
NP_440041.1_6 Reverse -86 -105 9.83173 0.285
NP_441719.1_4 Forward -388 -381 16.3621 0.0124
NP_441719.1_4 Reverse -381 -388 16.3621 0.0124
NP_441719.1_4 Forward -111 -104 16.3621 0.0124
NP_441719.1_4 Reverse -104 -111 16.3621 0.0124
NP_441733.1_10 Forward -392 -379 10.4424 0.106
NP_441733.1_10 Reverse -100 -113 5.32916 0.218
NP_441004.1_1 Reverse -164 -183 -4.13045 0.167
NP_441004.1_1 Forward -240 -221 -13.4719 0.257
NP_441004.1_1 Reverse -336 -355 -14.9469 0.271
NP_442366.1_3 Reverse -102 -120 -5.68405 0.292
NP_442366.1_5 Reverse -100 -110 15.4175 0.0374
NP_440129.1_10 Forward -119 -105 6.3911 0.177
NP_442873.1_3 Forward -122 -103 6.29183 0.236
NP_442873.1_9 Reverse -166 -185 3.73524 0.287
NP_440296.1_10 Forward -217 -198 -14.9469 0.279
NP_440296.1_10 Forward -237 -218 -15.0452 0.281
NP_442206.1_1 Forward -287 -268 7.57094 0.0457
NP_442206.1_3 Forward -349 -331 8.67227 0.286
NP_442206.1_10 Reverse -380 -395 4.79811 0.178
NP_442206.1_10 Forward -112 -97 3.32315 0.186
NP_442206.1_10 Reverse -103 -118 0.373221 0.261
NP_442854.1_6 Forward -338 -319 0.884433 0.287
NP_443054.1_2 Forward -114 -100 3.44117 0.24
NP_441966.1_6 Reverse -222 -241 6.29264 0.289
NP_441851.1_10 Forward -113 -103 17.4829 0.0027
NP_441851.1_10 Reverse -102 -112 15.8113 0.00552
NP_441851.1_10 Forward -390 -380 8.33817 0.118
NP_441851.1_10 Reverse -379 -389 8.1415 0.122
NP_441851.1_10 Reverse -277 -287 4.40493 0.271
NP_442622.1_8 Reverse -103 -121 -9.32229 0.145
NP_442622.1_8 Reverse -380 -398 -18.8604 0.285
NP_441501.1_2 Reverse -107 -126 14.8474 0.263
NP_441668.1_4 Reverse -93 -112 7.96426 0.151
NP_442515.1_1 Forward -113 -99 13.2743 0.0278
NP_442515.1_1 Reverse -102 -116 12.3893 0.0339
NP_442515.1_1 Forward -390 -376 2.35953 0.137
NP_442515.1_1 Reverse -379 -393 0.786239 0.18
NP_441982.1_6 Reverse -11 -20 14.2042 0.274
NP_440463.1_8 Forward -31 -12 7.79033 0.264
NP_440940.1_7 Forward -122 -104 6.99988 0.213
NP_441349.1_10 Reverse -93 -112 1.86774 0.0795
NP_441349.1_10 Forward -399 -380 -0.4922 0.0947
NP_441349.1_10 Forward -122 -103 -6.98204 0.239
NP_441349.1_10 Forward -195 -176 -8.55534 0.278
NP_441409.1_6 Reverse -374 -393 2.3594 0.0584
NP_440432.1_9 Reverse -104 -119 9.02635 0.0427
NP_442843.1_1 Forward -111 -92 6.98095 0.139
NP_442843.1_1 Reverse -381 -400 -4.03212 0.232
NP_442843.1_1 Forward -240 -221 -5.60541 0.244
NP_442843.1_1 Forward -337 -318 -10.522 0.278
NP_442450.1_5 Reverse -378 -388 19.4496 0.0103
NP_442450.1_5 Forward -114 -104 19.1546 0.0103
NP_442450.1_5 Forward -391 -381 9.32148 0.115
NP_442450.1_5 Reverse -101 -111 7.55152 0.13
NP_442168.1_5 Forward -111 -92 1.96607 0.232
NP_440588.1_2 Reverse -94 -113 -2.55715 0.167
NP_440588.1_2 Forward -398 -379 -2.65548 0.17
NP_441003.1_9 Forward -153 -134 8.25926 0.224
NP_441003.1_9 Reverse -94 -113 5.99764 0.255
NP_443047.1_7 Reverse -104 -123 3.34271 0.3
NP_441570.1_1 Reverse -103 -121 9.95058 0.00991
NP_441570.1_1 Forward -338 -320 9.55725 0.0106
NP_441570.1_1 Forward -389 -371 3.16574 0.0223
NP_441570.1_1 Reverse -380 -398 2.28076 0.0252
NP_441570.1_1 Forward -112 -94 -4.79907 0.075
NP_441078.1_4 Forward -112 -103 19.6659 0.0007
NP_441078.1_4 Reverse -103 -112 19.6659 0.0007
NP_441078.1_4 Forward -389 -380 9.93116 0.0203
NP_441078.1_4 Reverse -380 -389 9.83282 0.0226
NP_441078.1_4 Reverse -278 -287 5.60459 0.111
NP_441078.1_4 Forward -185 -176 -1.86856 0.272
NP_442729.1_7 Forward -25 -7 7.29564 0.276
NP_442729.1_8 Reverse -99 -112 10.639 0.125
NP_441663.1_8 Forward -344 -325 2.85105 0.196
NP_441663.1_8 Forward -118 -99 2.16274 0.206
NP_440526.1_3 Reverse -381 -392 10.1862 0.0646
NP_440526.1_3 Reverse -104 -115 8.61296 0.118
NP_440526.1_3 Forward -111 -100 1.04151 0.267
NP_440526.1_3 Reverse -206 -217 0.54986 0.275
NP_441432.1_8 Reverse -102 -111 16.8143 0.00595
NP_441432.1_8 Forward -390 -381 16.8143 0.00595
NP_441432.1_8 Forward -113 -104 8.35786 0.0755
NP_441432.1_8 Reverse -20 -29 2.75299 0.287
NP_441432.1_8 Forward -339 -330 2.55633 0.298
NP_441432.1_9 Reverse -357 -370 11.3132 0.232
NP_442320.1_8 Forward -395 -381 3.14618 0.0674
NP_442320.1_8 Forward -118 -104 -4.81863 0.188
NP_442320.1_8 Reverse -97 -111 -4.81863 0.188
NP_441732.1_2 Forward -116 -100 -7.61128 0.0861
NP_441732.1_2 Reverse -376 -392 -17.641 0.281
NP_442815.1_2 Reverse -10 -28 4.34571 0.243
NP_440760.1_1 Forward -112 -93 -3.44213 0.0342
NP_442797.1_2 Forward -117 -99 13.629 0.239
NP_442797.1_6 Forward -28 -9 7.25546 0.294
NP_442797.1_7 Reverse -373 -391 14.4738 0.11
NP_440199.1_10 Forward -392 -382 16.7946 0.0381
NP_440578.1_4 Reverse -266 -285 14.3558 0.247
NP_439935.1_7 Reverse -377 -391 20.5508 0.232
NP_440713.1_4 Reverse -370 -389 6.68596 0.187
NP_440713.1_4 Forward -241 -222 2.55606 0.26
NP_442489.1_7 Forward -112 -103 20.1576 0.000695
NP_442489.1_7 Reverse -103 -112 20.1576 0.000695
NP_442489.1_7 Forward -389 -380 10.4228 0.0151
NP_442489.1_7 Reverse -380 -389 10.3245 0.0193
NP_442489.1_7 Forward -185 -176 -1.18024 0.18
NP_442489.1_7 Reverse -278 -287 -1.6719 0.235
NP_442489.1_7 Forward -287 -278 -1.96689 0.28
NP_440565.1_7 Forward -229 -210 0.196116 0.249
NP_442079.1_7 Reverse -104 -123 10.0292 0.111
NP_442079.1_7 Forward -111 -92 7.96426 0.13
NP_442079.1_7 Reverse -381 -400 7.86593 0.13
NP_442079.1_7 Forward -388 -369 3.14605 0.212
NP_440559.1_1 Forward -111 -102 17.4043 0.00658
NP_440559.1_1 Reverse -381 -390 17.4043 0.00658
NP_440559.1_1 Reverse -104 -113 17.306 0.00658
NP_440559.1_1 Forward -388 -379 9.14451 0.0586
NP_441659.2_8 Reverse -103 -113 19.3512 0.000966
NP_441659.2_8 Forward -112 -102 18.1713 0.00133
NP_441659.2_8 Forward -389 -379 9.81313 0.0269
NP_441659.2_8 Reverse -380 -390 8.63316 0.0405
NP_441659.2_8 Reverse -176 -186 3.32329 0.164
NP_440363.1_9 Forward -295 -277 15.4571 0.187
NP_442913.1_10 Forward -194 -175 0.786102 0.151
NP_442913.1_10 Reverse -269 -288 -5.21209 0.26
NP_439956.1_7 Reverse -272 -291 4.22769 0.257
NP_440779.1_5 Reverse -103 -120 -14.4158 0.246
NP_442346.1_5 Forward -113 -103 17.9746 0.00128
NP_442346.1_5 Reverse -102 -112 16.6963 0.00248
NP_442346.1_5 Reverse -379 -389 14.1397 0.0164
NP_442346.1_5 Forward -390 -380 8.23984 0.143
NP_442346.1_5 Reverse -277 -287 4.79825 0.272
NP_442346.1_5 Reverse -175 -185 4.3066 0.291
NP_440545.1_3 Reverse -99 -116 -4.87771 0.235
NP_441786.1_10 Reverse -94 -113 11.6025 0.157
NP_441786.1_10 Forward -398 -379 5.80098 0.287
NP_441786.1_10 Reverse -269 -288 5.80098 0.287
NP_441943.1_8 Reverse -160 -179 -12.5869 0.261
NP_442551.1_4 Forward -289 -274 10.5013 0.12
NP_442551.1_4 Reverse -275 -290 0.176559 0.245
NP_442603.1_7 Forward -389 -375 11.4053 0.117
NP_442603.1_7 Reverse -329 -343 8.3571 0.176
NP_442603.1_7 Forward -338 -324 7.3738 0.208
NP_442603.1_7 Forward -112 -98 7.17714 0.211
NP_442603.1_7 Reverse -380 -394 6.39049 0.245
NP_442603.1_7 Reverse -103 -117 6.19383 0.253
NP_440449.1_6 Reverse -163 -181 6.21331 0.255
NP_441948.1_4 Reverse -373 -391 1.29745 0.133
NP_441833.1_4 Forward -388 -381 15.9687 0.0124
NP_441833.1_4 Reverse -381 -388 15.9687 0.0124
NP_441833.1_4 Forward -111 -104 15.9687 0.0124
NP_441833.1_4 Reverse -104 -111 15.9687 0.0124
NP_442162.1_9 Forward -388 -381 16.2637 0.0124
NP_442162.1_9 Reverse -381 -388 16.2637 0.0124
NP_442162.1_9 Forward -111 -104 16.2637 0.0124
NP_442162.1_9 Reverse -104 -111 16.2637 0.0124
NP_440671.1_2 Reverse -160 -174 14.1593 0.28
NP_440671.1_4 Reverse -323 -337 9.04604 0.187
NP_440671.1_4 Forward -118 -104 9.04604 0.187
NP_440671.1_4 Forward -395 -381 8.06273 0.204
NP_442140.1_3 Forward -111 -101 12.2714 0.0632
NP_442140.1_3 Forward -388 -378 7.45319 0.14
NP_442140.1_3 Reverse -104 -114 5.68323 0.198
NP_442140.1_3 Reverse -381 -391 4.40493 0.243
NP_441696.1_4 Reverse -349 -362 15.8506 0.19
NP_440875.1_9 Forward -183 -173 7.496 0.262
NP_441813.1_5 Reverse -378 -388 16.1063 0.01
NP_441813.1_5 Forward -114 -104 16.1063 0.01
NP_441813.1_5 Forward -391 -381 15.9097 0.01
NP_441813.1_5 Reverse -101 -111 8.63316 0.0367
NP_441813.1_5 Reverse -327 -337 2.92996 0.181
NP_440590.1_4 Forward -111 -98 0.805932 0.143
NP_440590.1_4 Reverse -381 -394 -4.40561 0.261
NP_440567.1_1 Forward -388 -374 11.0127 0.0305
NP_440567.1_1 Reverse -104 -118 4.91614 0.109
NP_440567.1_1 Reverse -381 -395 3.34284 0.145
NP_440567.1_1 Forward -111 -97 2.35953 0.176
NP_442497.1_10 Reverse -104 -113 19.8626 0.00532
NP_442497.1_10 Forward -388 -379 10.8161 0.0087
NP_442497.1_10 Forward -111 -102 10.4228 0.0087
NP_442497.1_10 Reverse -381 -390 10.4228 0.0087
NP_442497.1_10 Reverse -330 -339 0.196389 0.208
NP_440821.1_4 Forward -114 -104 19.8429 0.00399
NP_440821.1_4 Forward -391 -381 18.2696 0.00448
NP_440821.1_4 Reverse -378 -388 17.4829 0.00613
NP_440821.1_4 Reverse -101 -111 9.41981 0.0286
NP_441239.1_9 Forward -114 -102 11.7404 0.0551
NP_441239.1_9 Reverse -378 -390 11.4454 0.0607
NP_441239.1_9 Reverse -101 -113 6.92215 0.173
NP_441009.1_4 Reverse -103 -122 11.3075 0.257
NP_441009.1_7 Reverse -379 -398 21.2389 0.0463
NP_441727.1_3 Reverse -96 -115 3.93269 0.275
NP_441892.1_1 Forward -121 -104 6.92201 0.0931
NP_441892.1_1 Reverse -371 -388 -0.747806 0.191
NP_441892.1_1 Forward -398 -381 -3.00942 0.231
NP_440604.1_6 Reverse -103 -122 8.75091 0.0797
NP_442193.1_1 Reverse -156 -174 9.75391 0.233
NP_442193.1_8 Reverse -377 -396 12.29 0.234
NP_440833.1_6 Forward -372 -358 7.27547 0.282
NP_440876.1_5 Forward -110 -91 5.01433 0.283
NP_440949.1_7 Forward -397 -378 11.7 0.229
NP_442052.1_8 Reverse -168 -178 12.1731 0.285
NP_440546.1_4 Forward -389 -379 14.0213 0.0459
NP_440546.1_4 Reverse -103 -113 12.8578 0.0572
NP_440546.1_4 Forward -112 -102 10.046 0.109
NP_440546.1_4 Reverse -380 -390 7.33119 0.246
NP_440675.1_1 Reverse -100 -119 4.32602 0.238
NP_440462.1_6 Forward -114 -104 7.84651 0.0699
NP_440462.1_6 Forward -391 -381 7.74818 0.0699
NP_440462.1_6 Reverse -378 -388 6.8632 0.0967
NP_440462.1_6 Reverse -101 -111 1.35667 0.294
NP_440868.1_4 Reverse -376 -388 10.3637 0.0388
NP_440868.1_4 Forward -393 -381 8.20045 0.0602
NP_440868.1_4 Reverse -99 -111 8.10212 0.0602
NP_440868.1_4 Forward -116 -104 6.23383 0.0878
NP_440868.1_4 Reverse -370 -382 0.825626 0.199
NP_440401.1_8 Reverse -359 -378 5.40766 0.197
NP_442499.1_1 Forward -394 -375 2.26107 0.289
NP_441879.1_1 Forward -20 -1 1.86774 0.237
NP_441249.1_8 Forward -231 -212 3.24438 0.276
NP_442479.1_9 Forward -102 -83 -9.93197 0.266
NP_441868.1_1 Forward -164 -145 10.7424 0.261
NP_441474.1_1 Forward -122 -103 -2.06626 0.27
NP_441084.1_6 Forward -114 -100 14.4828 0.0972
NP_441084.1_6 Forward -102 -88 9.15021 0.292
NP_442358.1_6 Reverse -16 -34 14.9655 0.129
NP_442039.1_4 Forward -388 -381 15.1821 0.0124
NP_442039.1_4 Reverse -381 -388 15.1821 0.0124
NP_442039.1_4 Forward -111 -104 15.1821 0.0124
NP_442039.1_4 Reverse -104 -111 15.1821 0.0124
NP_441811.1_8 Reverse -374 -388 11.111 0.219
NP_440825.1_7 Forward -111 -101 12.9096 0.152
NP_442696.1_3 Reverse -270 -289 -0.4922 0.214
NP_442837.1_3 Forward -388 -381 15.7721 0.0124
NP_442837.1_3 Reverse -381 -388 15.7721 0.0124
NP_442837.1_3 Forward -111 -104 15.7721 0.0124
NP_442837.1_3 Reverse -104 -111 15.7721 0.0124
NP_442053.1_1 Forward -112 -103 18.3876 0.0007
NP_442053.1_1 Reverse -103 -112 18.3876 0.0007
NP_442053.1_1 Forward -389 -380 17.601 0.00138
NP_442053.1_1 Reverse -380 -389 16.2243 0.00451
NP_442053.1_1 Reverse -374 -383 8.94785 0.07
NP_442053.1_1 Reverse -329 -338 4.71961 0.228
NP_440505.1_3 Forward -391 -381 16.303 0.00696
NP_440505.1_3 Reverse -101 -111 9.22315 0.122
NP_440505.1_3 Forward -114 -104 7.55152 0.151
NP_440505.1_3 Forward -289 -279 5.19158 0.241
NP_440914.1_1 Forward -112 -102 17.5935 0.000537
NP_440914.1_1 Reverse -380 -390 15.0561 0.00832
NP_440914.1_1 Reverse -278 -288 13.885 0.022
NP_440914.1_1 Forward -338 -328 10.2742 0.147
NP_440914.1_1 Reverse -103 -113 8.51751 0.186
NP_440914.1_1 Forward -389 -379 7.24882 0.242
NP_441011.1_8 Reverse -104 -113 14.356 0.0249
NP_441011.1_8 Forward -388 -379 12.7828 0.0397
NP_441011.1_8 Reverse -381 -390 8.25953 0.144
NP_441011.1_8 Forward -111 -102 8.25953 0.144
NP_442101.1_10 Forward -120 -101 -7.37537 0.211
NP_442533.1_6 Forward -112 -103 17.2076 0.00137
NP_442533.1_6 Reverse -103 -112 17.2076 0.00137
NP_442533.1_6 Forward -389 -380 7.86621 0.0862
NP_442533.1_6 Reverse -380 -389 7.37455 0.0898
NP_442533.1_6 Reverse -278 -287 6.98123 0.0992
NP_442533.1_6 Reverse -176 -185 5.01461 0.16
NP_442322.1_4 Reverse -219 -236 -7.23831 0.279
NP_442229.1_1 Reverse -101 -115 5.99717 0.242
NP_443016.1_1 Forward -293 -274 -3.83545 0.225
NP_441482.1_7 Forward -118 -104 7.86607 0.0233
NP_441482.1_7 Forward -395 -381 -1.47537 0.0721
NP_441482.1_7 Reverse -97 -111 -3.147 0.11
NP_439944.1_9 Reverse -381 -391 19.0562 0.00329
NP_439944.1_9 Reverse -104 -114 17.3846 0.00516
NP_439944.1_9 Forward -111 -101 10.5014 0.0887
NP_439944.1_9 Forward -388 -378 8.33817 0.111
NP_441028.1_6 Forward -361 -351 5.19112 0.265
NP_440116.1_5 Reverse -100 -117 5.15205 0.176
NP_440116.1_8 Reverse -381 -400 -8.26035 0.25
NP_440116.1_8 Forward -111 -92 -8.65367 0.256
NP_441527.1_7 Forward -35 -16 15.7316 0.227
NP_440115.1_6 Forward -341 -331 13.4514 0.0733
NP_440115.1_6 Forward -115 -105 9.7148 0.115
NP_440007.1_9 Forward -393 -379 6.29277 0.229
NP_440007.1_9 Forward -342 -328 4.52282 0.267
NP_440007.1_9 Forward -116 -102 3.14618 0.275
NP_440007.1_9 Reverse -344 -358 2.5562 0.277
NP_439965.1_7 Reverse -90 -109 15.8678 0.215
NP_441972.1_5 Forward -111 -92 2.45773 0.121
NP_441972.1_5 Reverse -381 -400 -4.91709 0.212
NP_441106.1_1 Forward -113 -104 9.73449 0.0311
NP_441106.1_1 Forward -390 -381 9.63616 0.0311
NP_441106.1_1 Reverse -102 -111 9.63616 0.0311
NP_440429.1_2 Forward -184 -165 7.86593 0.279
NP_439903.1_6 Forward -115 -96 7.66846 0.151
NP_442306.1_10 Reverse -273 -292 -21.7317 0.286
NP_441286.1_1 Reverse -102 -114 23.9334 0.000767
NP_441286.1_1 Forward -390 -378 22.9501 0.00189
NP_441286.1_1 Forward -113 -101 3.48056 0.0467
NP_441286.1_1 Reverse -379 -391 2.69391 0.0562
NP_442674.1_3 Forward -397 -378 11.2084 0.174
NP_442674.1_3 Forward -120 -101 3.24359 0.294
NP_442674.1_3 Reverse -95 -114 2.85027 0.297
NP_440670.1_8 Forward -112 -103 18.3876 0.000699
NP_440670.1_8 Reverse -103 -112 18.3876 0.000699
NP_440670.1_8 Forward -389 -380 9.04618 0.0606
NP_440670.1_8 Reverse -380 -389 8.75118 0.0606
NP_441930.1_2 Reverse -277 -287 16.6963 0.19
NP_441930.1_2 Forward -287 -277 16.4013 0.19
NP_440886.1_7 Reverse -379 -389 8.04271 0.0805
NP_440886.1_7 Forward -113 -103 8.04271 0.0805
NP_440886.1_7 Reverse -102 -112 7.94438 0.0805
NP_440886.1_7 Forward -390 -380 6.66608 0.115
NP_440886.1_7 Forward -296 -286 3.42118 0.282
NP_442614.1_2 Forward -389 -375 17.2075 0.0588
NP_442614.1_2 Reverse -176 -190 5.99778 0.295
NP_441753.1_10 Forward -121 -102 13.0775 0.101
NP_440823.1_4 Reverse -368 -387 4.71934 0.191
NP_440907.2_8 Reverse -104 -114 9.81266 0.103
NP_440907.2_8 Forward -111 -101 7.64939 0.117
NP_442264.1_2 Forward -393 -376 13.2152 0.155
NP_440326.1_5 Reverse -101 -114 15.2606 0.179
NP_440841.1_4 Forward -114 -95 -7.08038 0.22
NP_442459.1_8 Forward -117 -98 11.5042 0.179
NP_441463.1_3 Forward -122 -103 8.35759 0.0487
NP_441463.1_3 Reverse -370 -389 1.47442 0.127
NP_441463.1_3 Reverse -93 -112 -0.590531 0.133
NP_441463.1_3 Forward -399 -380 -2.36049 0.153
NP_441463.1_6 Forward -391 -377 10.2813 0.242
NP_441463.1_6 Reverse -101 -115 6.51256 0.269
NP_441626.1_2 Forward -388 -381 15.7721 0.0124
NP_441626.1_2 Reverse -381 -388 15.7721 0.0124
NP_441626.1_2 Forward -111 -104 15.7721 0.0124
NP_441626.1_2 Reverse -104 -111 15.7721 0.0124
NP_442365.1_7 Forward -393 -374 -0.4922 0.179
NP_442794.1_1 Reverse -99 -111 9.28209 0.0795
NP_442794.1_1 Reverse -325 -337 6.72548 0.163
NP_442794.1_1 Forward -399 -387 3.38223 0.286
NP_442615.1_1 Reverse -94 -112 -2.0458 0.138
NP_441962.1_4 Reverse -375 -394 -7.27704 0.187
NP_441962.1_4 Forward -117 -98 -12.2919 0.255
NP_441962.1_4 Forward -291 -272 -12.9802 0.268
NP_440387.1_1 Forward -112 -96 11.8583 0.0149
NP_440387.1_1 Reverse -103 -119 6.15506 0.0288
NP_441431.1_2 Forward -115 -101 9.53707 0.183
NP_441431.1_7 Forward -243 -224 14.5416 0.269
NP_441836.1_2 Forward -237 -218 -2.65548 0.23
NP_441993.1_1 Reverse -103 -122 3.21363 0.239
NP_440814.1_4 Forward -398 -379 -10.4236 0.223
NP_440814.1_4 Reverse -94 -113 -10.6203 0.223
NP_440814.1_8 Reverse -9 -28 2.3594 0.269
NP_442805.1_5 Forward -265 -246 -5.40949 0.277
NP_440114.1_10 Forward -389 -375 10.7177 0.138
NP_440114.1_10 Reverse -380 -394 8.75105 0.195
NP_440114.1_10 Reverse -103 -117 8.65272 0.198
NP_441510.2_7 Forward -395 -381 12.782 0.28
NP_440287.1_5 Forward -302 -283 8.06178 0.286
NP_442087.1_2 Forward -112 -93 15.9226 0.158
NP_440293.1_3 Forward -294 -275 7.57094 0.184
NP_440293.1_9 Reverse -121 -135 9.12168 0.291
NP_440293.1_10 Reverse -339 -358 0.982764 0.219
NP_440293.1_10 Reverse -167 -186 -1.18052 0.271
NP_440766.1_4 Forward -393 -379 6.98109 0.097
NP_440766.1_4 Forward -270 -256 3.24451 0.151
NP_439988.1_10 Reverse -1 -20 12.3837 0.213
NP_441237.1_9 Forward -111 -101 14.828 0.0242
NP_441237.1_9 Reverse -278 -288 10.1081 0.248
NP_442743.1_1 Forward -24 -5 8.94676 0.262
NP_442743.1_4 Forward -233 -214 -6.58872 0.279
NP_442635.1_3 Forward -187 -168 14.5524 0.116
NP_439910.1_2 Reverse -372 -389 -21.594 0.183
NP_439910.1_2 Forward -120 -103 -21.594 0.183
NP_440457.1_1 Reverse -376 -388 11.642 0.092
NP_440457.1_1 Forward -116 -104 11.1504 0.092
NP_440457.1_1 Forward -342 -330 2.89058 0.205
NP_440457.1_1 Forward -393 -381 -0.0593532 0.25
NP_440798.1_6 Reverse -104 -117 1.88757 0.192
NP_441436.1_8 Reverse -102 -121 11.3075 0.261
NP_440473.1_9 Forward -123 -104 -7.08038 0.236
NP_442509.1_9 Reverse -103 -113 17.3841 0.00128
NP_442509.1_9 Forward -389 -379 15.9091 0.00953
NP_442509.1_9 Reverse -329 -339 10.796 0.159
NP_442509.1_9 Forward -112 -102 8.14104 0.192
NP_440554.1_4 Reverse -381 -391 7.05986 0.106
NP_440554.1_4 Reverse -104 -114 6.96153 0.107
NP_442862.1_3 Reverse -86 -103 15.6735 0.137
NP_441885.1_5 Forward -112 -102 20.9245 0.000538
NP_441885.1_5 Reverse -103 -113 11.3864 0.00668
NP_441885.1_5 Reverse -380 -390 11.0914 0.00874
NP_441885.1_5 Forward -389 -379 2.24165 0.0822
NP_441885.1_5 Forward -338 -328 0.0783647 0.183
NP_441885.1_5 Reverse -278 -288 -0.216628 0.189
NP_440478.1_10 Forward -216 -202 6.19444 0.294
NP_442341.1_7 Forward -113 -99 11.406 0.0555
NP_442341.1_7 Reverse -102 -116 5.1128 0.167
NP_442341.1_7 Reverse -379 -393 2.2612 0.263
NP_442341.1_9 Reverse -101 -115 11.307 0.127
NP_442341.1_9 Forward -340 -326 9.14375 0.156
NP_442341.1_9 Forward -391 -377 7.27547 0.202
NP_442341.1_9 Reverse -378 -392 5.21053 0.277
NP_441173.1_9 Forward -360 -352 14.3753 0.161
NP_440423.1_6 Forward -346 -327 -14.2585 0.224
NP_440423.1_6 Forward -120 -101 -16.0285 0.229
NP_443000.1_7 Forward -391 -381 17.0896 0.00865
NP_443000.1_7 Reverse -101 -111 10.3048 0.0345
NP_443000.1_7 Forward -114 -104 8.82982 0.0437
NP_440507.2_3 Forward -121 -102 9.04509 0.236
NP_443059.1_10 Forward -137 -118 11.8967 0.149
NP_443059.1_10 Reverse -372 -391 1.6703 0.239
NP_440275.1_3 Forward -114 -104 10.0098 0.0454
NP_440275.1_3 Forward -391 -381 8.1415 0.0602
NP_440275.1_3 Reverse -101 -111 8.04317 0.0602
NP_440275.1_3 Forward -340 -330 4.69992 0.178
NP_440275.1_3 Reverse -378 -388 1.35667 0.29
NP_440091.1_1 Forward -393 -381 8.88877 0.0567
NP_440091.1_1 Reverse -376 -388 1.51394 0.197
NP_440091.1_1 Forward -116 -104 -0.354346 0.273
NP_442354.1_7 Forward -115 -96 15.6341 0.0637
NP_441397.1_8 Forward -376 -363 11.8073 0.289
NP_443010.1_10 Forward -392 -375 13.2072 0.0767
NP_443010.1_10 Reverse -377 -394 3.6405 0.252
NP_443010.1_10 Reverse -173 -190 2.48089 0.275
NP_440175.1_7 Reverse -87 -105 9.36312 0.28
NP_442495.1_4 Reverse -161 -171 13.8447 0.184
NP_440149.1_8 Reverse -380 -399 -0.39387 0.147
NP_440149.1_8 Forward -112 -93 -1.18052 0.157
NP_440149.1_8 Reverse -103 -122 -5.50708 0.228
NP_441105.1_3 Forward -394 -375 -9.047 0.283
NP_440216.1_1 Reverse -103 -117 5.60446 0.0191
NP_440216.1_1 Forward -389 -375 -1.77037 0.0383
NP_440216.1_1 Reverse -329 -343 -4.52363 0.111
NP_440216.1_1 Forward -112 -98 -10.6202 0.145
NP_440172.1_1 Forward -389 -379 17.2863 0.00544
NP_440172.1_1 Reverse -103 -113 16.303 0.00854
NP_440172.1_1 Forward -112 -102 15.0247 0.00945
NP_440172.1_1 Reverse -380 -390 5.19158 0.149
NP_440172.1_1 Forward -338 -328 3.42162 0.228
NP_442015.1_3 Forward -140 -121 17.3048 0.155
NP_442015.1_10 Forward -116 -103 10.049 0.0415
NP_442015.1_10 Reverse -376 -389 3.36254 0.183
NP_442015.1_10 Reverse -99 -112 1.39592 0.204
NP_442329.1_8 Forward -178 -159 7.7676 0.188
NP_441226.1_7 Forward -388 -381 14.4934 0.0123
NP_441226.1_7 Reverse -381 -388 14.4934 0.0123
NP_441226.1_7 Forward -111 -104 14.4934 0.0123
NP_441226.1_7 Reverse -104 -111 14.4934 0.0123
NP_441757.1_3 Forward -390 -371 11.0125 0.0857
NP_441111.1_7 Forward -111 -103 18.7023 0.00294
NP_441111.1_7 Reverse -381 -389 18.7023 0.00294
NP_441111.1_7 Reverse -104 -112 18.7023 0.00294
NP_441111.1_7 Forward -388 -380 8.96754 0.0463
NP_442379.1_10 Forward -119 -102 -2.81276 0.245
NP_441766.1_2 Reverse -380 -389 18.2893 0.00297
NP_441766.1_2 Forward -112 -103 17.5026 0.00297
NP_441766.1_2 Reverse -103 -112 17.5026 0.00297
NP_441766.1_2 Forward -389 -380 9.14451 0.0337
NP_441766.1_2 Reverse -329 -338 4.91628 0.154
NP_441766.1_9 Forward -346 -327 -0.0988766 0.255
NP_440416.1_9 Forward -294 -275 -16.7168 0.22
NP_440416.1_9 Reverse -96 -115 -17.4051 0.239
NP_443052.1_8 Forward -122 -103 -3.44213 0.102
NP_443052.1_8 Reverse -370 -389 -7.67036 0.162
NP_443052.1_8 Forward -224 -205 -11.5053 0.231
NP_442116.1_2 Forward -92 -73 10.815 0.289
NP_442403.1_8 Reverse -105 -124 0.0977854 0.241
NP_442403.1_9 Reverse -91 -110 9.73422 0.177
NP_440591.1_9 Forward -221 -203 17.1287 0.0619
NP_442154.1_1 Reverse -118 -136 -7.55234 0.143
NP_442154.1_6 Reverse -166 -185 6.19431 0.234
NP_440261.1_5 Reverse -330 -343 6.31247 0.038
NP_440261.1_5 Reverse -104 -117 -0.865694 0.0655
NP_440261.1_5 Forward -388 -375 -4.60227 0.158
NP_440261.1_5 Forward -286 -273 -6.47056 0.201
NP_440261.1_5 Forward -111 -98 -10.3055 0.201
NP_440261.1_5 Reverse -381 -394 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCCTAATAATGGCGATCGCGCTCCAGGTCAAAAATTGCCTTTTCCCAATACCAGTGCTCCGGGCGATCAGGATGTTTGGCCCGTAGATTGGTTACCAGTCTTTCCGCTACCTGGGCATTGCCCGCAATACGAATTAGATCCCGCCGTAACTTACCGGGCACCCTGGGTGATGTTGGGCGGGAAGCTTGGATGGCCTGCTTGAAACCTGATGAATGACGACGGCCTCTGCTCCAGGCAATTTTCCGACCTGATCTACGCCTAGCCCACCAGATCAAGCCCCACAACAGGGCGATCGCCAAAATTAGGGCCAACATTGCCTTGTTCTCCGAAGGTTAGTCACTTCTGTTCTGTTTGAGCCTAACATTATCCTCCCGTTGCCTTTTTCACCACAGACTTGCC

CDS

ATGGGCGCAATACTCTGTTACATTTATTTACATAGACAACCCTCCCAGCTCGTAATTACATTCTTAACCATGAACAACGAAAACTCTAAATTTGGATTCACTGCTTTCGCCGAAAACTGGAATGGTCGCTTGGCCATGATCGGTTTTTCCTCTGCCCTGATCCTCGAGCTTGTCTCTGGGCAAGGTGTACTTCACTTCTTCGGCATTCTGTAA

Protein

MGAILCYIYLHRQPSQLVITFLTMNNENSKFGFTAFAENWNGRLAMIGFSSALILELVSGQGVLHFFGIL