Your browser is old and dusty. Try Google Chrome!

Details for ssl1552

ORF ssl1552
Accession NP_442449.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -12 -26 -0.000409212 0.219
NP_441061.1_2 Forward -66 -52 -0.885388 0.242
NP_440795.1_7 Forward -19 -12 14.6904 0.0123
NP_440795.1_7 Reverse -12 -19 14.6904 0.0123
NP_441418.1_6 Forward -20 -1 -22.5183 0.179
NP_441418.1_6 Reverse -11 -30 -28.5165 0.205
NP_441453.1_1 Reverse -4 -22 9.85146 0.144
NP_441453.1_4 Reverse -11 -19 16.539 0.00633
NP_441453.1_4 Forward -20 -12 16.539 0.00633
NP_441453.1_4 Forward -314 -306 3.85433 0.284
NP_441623.1_1 Forward -36 -18 -3.6191 0.262
NP_442151.1_6 Forward -20 -6 13.7659 0.0457
NP_442151.1_6 Reverse -11 -25 8.75105 0.164
NP_441818.1_1 Forward -19 -8 14.2178 0.0541
NP_440226.1_1 Forward -20 -1 11.9958 0.0484
NP_440226.1_1 Reverse -11 -30 5.50599 0.154
NP_443002.1_5 Forward -66 -48 10.1465 0.262
NP_442173.1_1 Forward -19 -11 15.4574 0.00633
NP_442173.1_1 Reverse -12 -20 15.4574 0.00633
NP_442173.1_1 Reverse -161 -169 5.72262 0.203
NP_442752.1_4 Forward -20 -13 13.8055 0.0199
NP_442752.1_4 Reverse -11 -18 13.8055 0.0199
NP_443027.1_4 Reverse -9 -19 7.35486 0.24
NP_441812.1_3 Forward -21 -7 8.55439 0.251
NP_442975.1_10 Reverse -7 -21 3.73557 0.252
NP_441225.1_1 Reverse -307 -326 -3.24547 0.188
NP_441675.1_8 Forward -17 -3 18.0918 0.289
NP_440784.1_7 Forward -19 -12 15.9687 0.0123
NP_440784.1_7 Reverse -12 -19 15.9687 0.0123
NP_440061.1_9 Forward -22 -8 10.422 0.124
NP_440928.1_5 Reverse -53 -71 17.4237 0.075
NP_441054.1_2 Forward -84 -65 10.0292 0.284
NP_441054.1_4 Reverse -1 -19 16.5388 0.0361
NP_442062.1_8 Forward -20 -10 17.6796 0.00193
NP_442062.1_8 Reverse -11 -21 17.3846 0.00193
NP_442062.1_8 Forward -67 -57 9.02648 0.069
NP_440304.1_4 Reverse -9 -19 18.9579 0.00406
NP_440304.1_4 Forward -22 -12 1.84832 0.299
NP_442242.1_4 Forward -19 -12 14.3954 0.0124
NP_442242.1_4 Reverse -12 -19 14.3954 0.0124
NP_440044.1_8 Reverse -12 -31 8.94757 0.0723
NP_442602.1_3 Reverse -163 -182 -1.86883 0.246
NP_441935.1_1 Forward -76 -57 5.30933 0.293
NP_441619.1_8 Forward -26 -12 8.75042 0.237
NP_440370.1_10 Reverse -296 -315 15.7324 0.0782
NP_442110.1_1 Forward -270 -251 17.1983 0.198
NP_441082.1_10 Forward -194 -181 8.67241 0.264
NP_441083.1_5 Reverse -11 -21 20.3345 0.00053
NP_441083.1_5 Forward -20 -10 19.3512 0.000718
NP_441083.1_5 Reverse -305 -315 -0.904945 0.283
NP_441738.1_2 Forward -18 -11 15.28 0.0102
NP_441738.1_2 Reverse -13 -20 15.28 0.0102
NP_441558.1_5 Forward -316 -297 4.62101 0.276
NP_440209.1_1 Reverse -11 -19 18.1123 0.00295
NP_440209.1_1 Forward -20 -12 18.1123 0.00295
NP_442889.1_1 Forward -73 -54 -13.5702 0.262
NP_442889.1_8 Reverse -8 -22 19.1735 0.0084
NP_440407.1_6 Reverse -232 -246 10.521 0.28
NP_441713.1_1 Reverse -5 -24 -12.2919 0.244
NP_441770.1_4 Forward -75 -56 -4.72043 0.204
NP_442570.1_3 Forward -69 -50 -8.65367 0.291
NP_441716.1_1 Forward -20 -6 4.62115 0.254
NP_442111.1_3 Reverse -63 -76 14.1946 0.244
NP_442111.1_4 Forward -21 -7 9.93102 0.0575
NP_440906.1_5 Forward -19 -12 15.8704 0.0124
NP_440906.1_5 Reverse -12 -19 15.8704 0.0124
NP_440747.1_10 Forward -23 -11 14.887 0.00223
NP_440747.1_10 Reverse -8 -20 -2.02597 0.0196
NP_440747.1_10 Reverse -149 -161 -2.71429 0.0639
NP_440747.1_10 Reverse -55 -67 -4.18925 0.0817
NP_441130.1_10 Reverse -303 -317 14.9459 0.0387
NP_441486.1_1 Forward -23 -9 12.8809 0.00979
NP_441486.1_1 Reverse -8 -22 5.80112 0.0344
NP_440403.1_4 Forward -29 -10 -6.68705 0.235
NP_440842.1_10 Reverse -8 -22 0.982901 0.296
NP_442848.1_5 Reverse -378 -396 -1.45582 0.276
NP_443018.1_3 Forward -19 -12 14.8871 0.0123
NP_443018.1_3 Reverse -12 -19 14.8871 0.0123
NP_443018.1_3 Reverse -306 -313 10.6589 0.0967
NP_443018.1_3 Forward -313 -306 4.16902 0.278
NP_441316.1_7 Reverse -9 -24 4.40479 0.131
NP_441634.1_8 Forward -316 -302 -4.62196 0.295
NP_440376.1_1 Forward -20 -11 19.4693 0.000692
NP_440376.1_1 Reverse -11 -20 19.4693 0.000692
NP_440376.1_1 Forward -67 -58 4.32629 0.163
NP_441588.1_4 Reverse -13 -23 15.9097 0.0369
NP_441588.1_4 Reverse -307 -317 5.97822 0.221
NP_442687.1_7 Reverse -10 -20 18.5646 0.0028
NP_442687.1_7 Forward -21 -11 8.92815 0.0994
NP_442485.1_3 Reverse -270 -289 -3.73712 0.277
NP_442530.1_2 Reverse -63 -73 14.828 0.203
NP_442658.1_1 Reverse -9 -19 14.8275 0.0188
NP_442658.1_1 Forward -22 -12 6.76441 0.214
NP_442658.1_1 Reverse -303 -313 6.0761 0.238
NP_442198.1_3 Forward -29 -10 13.8641 0.129
NP_440141.1_4 Forward -70 -51 -7.67036 0.298
NP_440141.1_8 Reverse -230 -249 11.5042 0.206
NP_441414.1_9 Reverse -11 -30 6.39097 0.0404
NP_441414.1_9 Forward -20 -1 2.94938 0.0612
NP_440800.1_7 Reverse -290 -304 11.6026 0.267
NP_441487.1_9 Forward -256 -237 -1.86883 0.289
NP_442937.1_5 Forward -319 -300 8.45592 0.22
NP_442937.1_5 Forward -25 -6 7.96426 0.237
NP_442937.1_5 Forward -72 -53 6.88262 0.268
NP_441958.1_5 Reverse -10 -20 20.5312 0.000966
NP_441958.1_5 Forward -21 -11 12.2714 0.00183
NP_441127.1_1 Reverse -302 -316 8.84938 0.284
NP_439905.1_1 Forward -313 -300 7.78743 0.244
NP_439905.1_1 Forward -19 -6 6.90245 0.272
NP_440984.1_7 Forward -25 -11 11.0127 0.122
NP_439990.1_5 Reverse -6 -19 7.78743 0.186
NP_439990.1_5 Forward -25 -12 7.6891 0.186
NP_441338.2_4 Reverse -227 -246 23.4022 0.0194
NP_442911.1_2 Reverse -1 -20 18.3873 0.00604
NP_442911.1_2 Forward -30 -11 -3.14714 0.109
NP_442571.1_9 Forward -357 -338 14.5524 0.146
NP_440369.1_5 Reverse -339 -358 11.0125 0.251
NP_442064.1_4 Reverse -48 -67 7.07848 0.246
NP_442064.1_4 Forward -71 -52 4.71854 0.285
NP_443055.1_3 Reverse -143 -162 13.7963 0.156
NP_443055.1_6 Forward -169 -151 8.17984 0.148
NP_440993.1_4 Forward -67 -50 12.4285 0.171
NP_442210.1_9 Forward -71 -53 10.3439 0.242
NP_441099.1_5 Reverse -1 -20 -9.34199 0.219
NP_442002.1_1 Forward -93 -75 -8.73231 0.27
NP_442002.1_9 Reverse -10 -17 14.1004 0.074
NP_440809.1_9 Reverse -296 -314 -6.76569 0.225
NP_440809.1_9 Reverse -2 -20 -8.04399 0.225
NP_441294.1_7 Reverse -176 -190 8.86667 0.274
NP_442431.1_10 Reverse -348 -366 2.87075 0.228
NP_441000.1_6 Reverse -304 -318 2.85119 0.126
NP_440147.1_4 Forward -22 -9 11.6223 0.0326
NP_440147.1_4 Forward -171 -158 4.34585 0.164
NP_440147.1_4 Reverse -9 -22 4.05085 0.173
NP_440147.1_4 Forward -163 -150 1.29759 0.233
NP_441550.1_8 Reverse -9 -19 15.4175 0.0132
NP_441550.1_8 Forward -22 -12 14.6309 0.0132
NP_441550.1_8 Forward -316 -306 6.0761 0.214
NP_441916.1_7 Forward -20 -10 16.893 0.00407
NP_441916.1_7 Reverse -11 -21 10.3048 0.0261
NP_441041.1_7 Forward -317 -305 5.27969 0.265
NP_441041.1_9 Forward -386 -372 13.5686 0.275
NP_442396.1_5 Forward -24 -11 21.1604 0.00421
NP_442396.1_5 Reverse -7 -20 9.36073 0.13
NP_441547.1_2 Forward -200 -182 13.2938 0.102
NP_440703.1_9 Reverse -58 -71 8.37683 0.233
NP_441725.1_5 Forward -19 -9 21.0229 0.00533
NP_441725.1_5 Reverse -12 -22 2.04498 0.115
NP_439966.1_7 Reverse -9 -19 9.12434 0.119
NP_439966.1_7 Reverse -303 -313 7.45273 0.15
NP_439966.1_7 Forward -22 -12 7.25606 0.15
NP_439966.1_7 Forward -316 -306 4.10949 0.289
NP_439966.1_9 Forward -316 -307 0.884706 0.253
NP_442941.1_3 Forward -19 -9 11.3864 0.0116
NP_442941.1_3 Reverse -12 -22 11.0914 0.0116
NP_440289.1_2 Reverse -8 -21 13.0973 0.0132
NP_440289.1_2 Forward -23 -10 -2.144 0.251
NP_440983.1_5 Reverse -180 -199 -4.6221 0.26
NP_440983.1_5 Forward -366 -347 -8.35868 0.295
NP_440260.1_8 Reverse -49 -67 -2.43913 0.243
NP_440260.1_8 Forward -29 -11 -3.52077 0.252
NP_439908.1_5 Forward -69 -50 10.1275 0.298
NP_442281.1_1 Forward -25 -11 8.94708 0.0747
NP_442281.1_1 Reverse -6 -20 2.94893 0.249
NP_441644.1_6 Reverse -11 -21 17.3841 0.00127
NP_441644.1_6 Forward -20 -10 15.7125 0.0048
NP_441644.1_6 Reverse -305 -315 5.48612 0.188
NP_442215.1_2 Forward -22 -6 4.87675 0.0815
NP_442215.1_2 Forward -69 -53 4.68009 0.0831
NP_442215.1_2 Forward -204 -188 -7.51295 0.297
NP_442247.1_8 Forward -22 -8 10.9143 0.247
NP_440253.1_2 Reverse -152 -170 3.46073 0.116
NP_440253.1_2 Forward -20 -2 -2.73412 0.274
NP_440253.1_2 Reverse -11 -29 -3.52077 0.294
NP_440929.1_8 Forward -20 -11 19.2726 0.000701
NP_440929.1_8 Reverse -11 -20 19.2726 0.000701
NP_442933.1_10 Forward -20 -11 17.601 0.00325
NP_442933.1_10 Reverse -11 -20 17.601 0.00325
NP_441751.2_8 Forward -19 -5 3.34284 0.0678
NP_441751.2_8 Reverse -12 -26 -3.04867 0.134
NP_442554.1_8 Reverse -12 -22 15.3197 0.00882
NP_442554.1_8 Forward -19 -9 14.828 0.0108
NP_442554.1_8 Reverse -306 -316 5.09324 0.161
NP_442554.1_8 Forward -313 -303 3.02829 0.245
NP_442554.1_8 Reverse -153 -163 2.92996 0.249
NP_441762.1_7 Reverse -10 -22 8.9871 0.0142
NP_441762.1_7 Forward -315 -303 4.07055 0.0572
NP_441762.1_7 Reverse -304 -316 -5.46756 0.212
NP_441762.1_7 Forward -21 -9 -6.94252 0.284
NP_442142.1_4 Reverse -8 -21 5.91857 0.178
NP_442142.1_4 Forward -317 -304 3.36198 0.258
NP_442292.1_1 Reverse -12 -21 18.486 0.00229
NP_442292.1_1 Forward -19 -10 9.53783 0.0183
NP_440919.1_1 Forward -88 -69 0.58944 0.221
NP_440919.1_1 Reverse -233 -252 -8.16202 0.286
NP_442476.1_6 Reverse -12 -26 10.9143 0.0601
NP_442476.1_6 Forward -19 -5 3.63784 0.155
NP_443009.1_5 Forward -21 -10 15.7911 0.0107
NP_443009.1_5 Reverse -10 -21 11.1696 0.066
NP_442406.1_9 Forward -68 -49 -0.0988766 0.291
NP_441715.1_4 Reverse -12 -22 7.94484 0.107
NP_441715.1_4 Forward -19 -9 7.25653 0.108
NP_440015.1_9 Forward -20 -2 2.67408 0.203
NP_441448.1_2 Reverse -182 -201 -0.39464 0.256
NP_441198.1_8 Reverse -9 -19 13.076 0.108
NP_440379.1_5 Forward -70 -51 -7.67036 0.247
NP_440379.1_5 Reverse -49 -68 -11.7019 0.3
NP_440464.1_10 Reverse -12 -22 13.0082 0.169
NP_441468.1_1 Forward -19 -12 15.8704 0.0124
NP_441468.1_1 Reverse -12 -19 15.8704 0.0124
NP_441468.1_1 Reverse -306 -313 3.97235 0.277
NP_441673.1_1 Forward -20 -11 20.8459 0.000698
NP_441673.1_1 Reverse -11 -20 20.8459 0.000698
NP_441673.1_1 Reverse -58 -67 -8.06341 0.254
NP_441876.1_9 Reverse -300 -310 12.1726 0.267
NP_441637.1_9 Forward -136 -118 -2.0458 0.292
NP_441637.1_9 Reverse -35 -53 -3.42244 0.296
NP_442868.1_6 Forward -22 -12 9.81313 0.038
NP_442868.1_6 Reverse -9 -19 9.22315 0.0527
NP_442719.1_2 Reverse -35 -53 -0.76823 0.168
NP_442719.1_2 Reverse -253 -271 -9.32298 0.263
NP_441612.1_2 Reverse -11 -21 8.54929 0.21
NP_442427.1_8 Reverse -2 -21 22.1239 0.012
NP_442427.1_8 Forward -29 -10 6.68596 0.232
NP_442808.1_1 Reverse -304 -314 10.206 0.0481
NP_442808.1_1 Reverse -10 -20 8.73102 0.0481
NP_442808.1_1 Forward -21 -11 8.63269 0.0481
NP_442050.1_1 Forward -273 -254 9.83255 0.247
NP_442050.1_5 Reverse -9 -19 15.8108 0.0091
NP_442050.1_5 Forward -22 -12 7.64939 0.243
NP_440274.1_2 Reverse -180 -194 15.0436 0.236
NP_441878.1_6 Reverse -10 -20 20.2362 0.0046
NP_441878.1_6 Forward -21 -11 10.4031 0.0176
NP_441878.1_6 Reverse -57 -67 -7.19813 0.21
NP_441878.1_6 Forward -68 -58 -7.78811 0.266
NP_441036.1_8 Reverse -10 -20 8.4365 0.174
NP_441036.1_8 Forward -21 -11 8.33817 0.174
NP_441557.1_5 Forward -20 -11 19.9609 0.000699
NP_441557.1_5 Reverse -11 -20 19.9609 0.000699
NP_441557.1_8 Forward -160 -150 12.8609 0.235
NP_441445.1_1 Reverse -2 -21 7.27595 0.136
NP_441445.1_1 Forward -29 -10 1.67108 0.248
NP_441445.1_1 Reverse -143 -162 -0.0988766 0.286
NP_441590.1_4 Reverse -181 -200 1.6703 0.299
NP_442267.1_6 Forward -31 -12 18.0924 0.155
NP_442066.2_9 Forward -24 -11 11.1307 0.154
NP_441433.1_8 Forward -66 -47 6.29264 0.174
NP_441433.1_8 Reverse -53 -72 0.884433 0.238
NP_441433.1_8 Forward -65 -46 -0.0988766 0.244
NP_442777.1_1 Reverse -75 -94 10.6184 0.194
NP_440744.1_2 Reverse -339 -358 14.916 0.276
NP_440084.1_8 Reverse -210 -224 15.4813 0.18
NP_441739.1_2 Reverse -173 -189 2.61447 0.288
NP_441458.1_10 Reverse -49 -68 6.58763 0.197
NP_442183.1_1 Forward -20 -6 12.8809 0.05
NP_442183.1_1 Reverse -11 -25 11.5043 0.0702
NP_441459.1_8 Reverse -4 -17 13.1956 0.286
NP_441574.1_1 Forward -32 -13 -6.1954 0.276
NP_442347.1_2 Reverse -12 -21 12.4878 0.056
NP_442347.1_2 Reverse -255 -264 4.0313 0.284
NP_442347.1_2 Forward -19 -10 3.34298 0.284
NP_442645.1_2 Forward -75 -56 -16.8151 0.242
NP_442645.1_2 Forward -28 -9 -22.125 0.29
NP_441037.1_4 Reverse -9 -19 9.65667 0.21
NP_441037.1_4 Forward -22 -12 7.9999 0.237
NP_441633.1_3 Forward -22 -9 10.5407 0.0286
NP_440136.1_2 Forward -19 -12 15.9687 0.0123
NP_440136.1_2 Reverse -12 -19 15.9687 0.0123
NP_442998.1_5 Forward -306 -296 13.1564 0.158
NP_442998.1_5 Reverse -236 -246 10.6981 0.206
NP_442998.1_5 Reverse -63 -73 7.74818 0.284
NP_442998.1_10 Forward -18 -11 15.5754 0.0102
NP_442998.1_10 Reverse -13 -20 15.5754 0.0102
NP_442998.1_10 Reverse -162 -169 9.28223 0.117
NP_442998.1_10 Reverse -307 -314 6.23397 0.157
NP_440299.1_1 Forward -24 -11 12.9984 0.0319
NP_440299.1_1 Reverse -7 -20 9.75346 0.0661
NP_440299.1_1 Forward -165 -152 4.05029 0.221
NP_441799.1_1 Reverse -7 -21 13.2736 0.0337
NP_441799.1_1 Forward -24 -10 9.24208 0.0966
NP_441007.1_10 Forward -25 -12 8.27909 0.115
NP_441007.1_10 Reverse -6 -19 1.69091 0.203
NP_441007.1_10 Reverse -349 -362 -0.570702 0.287
NP_440087.1_1 Forward -29 -10 0.687771 0.167
NP_441559.1_8 Forward -156 -142 -7.08024 0.283
NP_441270.1_5 Forward -199 -180 11.2376 0.294
NP_440915.1_6 Forward -24 -10 1.57289 0.134
NP_442158.1_4 Forward -198 -188 10.8948 0.283
NP_441931.1_2 Forward -280 -261 15.3391 0.193
NP_442452.1_3 Reverse -285 -304 0.392778 0.294
NP_441464.1_8 Forward -169 -155 16.8142 0.083
NP_441464.1_8 Forward -20 -6 6.78443 0.226
NP_441464.1_10 Forward -191 -177 11.2093 0.228
NP_440695.1_5 Forward -32 -13 0.491109 0.284
NP_442993.1_1 Forward -20 -4 -9.67623 0.19
NP_442993.1_1 Reverse -305 -321 -10.2662 0.214
NP_442386.1_9 Forward -21 -12 13.8639 0.0289
NP_442386.1_9 Reverse -304 -313 11.799 0.0835
NP_442386.1_9 Forward -62 -53 6.9808 0.219
NP_442386.1_9 Reverse -10 -19 6.39082 0.219
NP_442386.1_9 Reverse -57 -66 5.9975 0.23
NP_442386.1_9 Reverse -51 -60 4.62087 0.294
NP_442386.1_9 Forward -315 -306 4.52254 0.297
NP_442386.1_10 Forward -92 -79 3.06754 0.292
NP_441340.1_5 Forward -19 -12 15.6737 0.0124
NP_441340.1_5 Reverse -12 -19 15.6737 0.0124
NP_441340.1_5 Forward -313 -306 11.3472 0.0526
NP_441297.1_8 Reverse -39 -57 10.4414 0.253
NP_442484.1_2 Forward -31 -12 4.71934 0.184
NP_440168.1_2 Reverse -50 -69 -2.95047 0.276
NP_440168.1_8 Forward -73 -54 4.81767 0.216
NP_440194.1_3 Forward -30 -11 3.14605 0.271
NP_442714.1_5 Forward -60 -41 0.687771 0.253
NP_442714.1_7 Reverse -12 -31 13.0775 0.126
NP_440211.1_3 Forward -358 -339 13.0775 0.287
NP_440586.1_1 Forward -36 -17 -6.39206 0.299
NP_440586.1_8 Forward -19 -12 13.2151 0.026
NP_440586.1_8 Reverse -12 -19 13.2151 0.026
NP_440586.1_8 Reverse -306 -313 5.74197 0.283
NP_442251.1_6 Forward -19 -12 15.2804 0.0124
NP_442251.1_6 Reverse -12 -19 15.2804 0.0124
NP_440684.1_9 Forward -26 -12 12.586 0.168
NP_441262.1_3 Reverse -11 -18 14.7888 0.0223
NP_441262.1_3 Forward -20 -13 14.7888 0.0223
NP_440027.1_3 Reverse -186 -204 9.6548 0.184
NP_443051.1_1 Reverse -10 -19 18.0926 0.00402
NP_443051.1_1 Forward -21 -12 10.4228 0.00754
NP_441232.1_10 Forward -31 -12 6.88262 0.16
NP_439937.1_9 Forward -315 -298 -10.0899 0.221
NP_439937.1_9 Forward -21 -4 -14.9081 0.287
NP_440372.1_2 Forward -19 -12 16.3621 0.0124
NP_440372.1_2 Reverse -12 -19 16.3621 0.0124
NP_440574.1_2 Forward -251 -232 11.0125 0.209
NP_441789.1_7 Reverse -66 -85 -2.65624 0.258
NP_440316.1_10 Forward -315 -305 11.7798 0.214
NP_442384.1_10 Forward -20 -7 16.4406 0.00838
NP_442384.1_10 Reverse -11 -24 15.8506 0.00946
NP_442384.1_10 Reverse -58 -71 1.9859 0.24
NP_441018.1_7 Forward -71 -52 10.4225 0.205
NP_440530.1_9 Reverse -200 -219 20.8447 0.11
NP_442790.1_4 Forward -29 -10 -8.55534 0.172
NP_442262.1_10 Forward -19 -12 14.1988 0.0123
NP_442262.1_10 Reverse -12 -19 14.1988 0.0123
NP_442262.1_10 Reverse -306 -313 12.0355 0.062
NP_442262.1_10 Reverse -161 -168 7.90559 0.266
NP_441689.1_5 Reverse -9 -19 8.63269 0.132
NP_441689.1_5 Forward -22 -12 5.78111 0.197
NP_440344.1_10 Reverse -4 -21 0.628827 0.0349
NP_440344.1_10 Forward -27 -10 -11.2692 0.208
NP_440075.1_5 Reverse -252 -271 13.2733 0.272
NP_440531.1_6 Reverse -3 -22 -3.3438 0.265
NP_440531.1_8 Forward -31 -12 7.7676 0.221
NP_440531.1_8 Reverse -127 -146 2.3594 0.298
NP_441060.1_9 Forward -20 -1 14.3558 0.161
NP_442910.1_1 Forward -27 -8 4.03102 0.118
NP_440826.1_5 Reverse -237 -255 13.35 0.297
NP_441965.1_10 Reverse -8 -24 12.6449 0.105
NP_440297.1_9 Forward -19 -9 19.0562 0.0359
NP_440297.1_9 Reverse -12 -22 -0.118297 0.282
NP_441592.1_4 Reverse -245 -264 -3.24547 0.279
NP_441592.1_4 Reverse -152 -171 -4.03212 0.293
NP_440888.1_2 Forward -20 -6 7.07881 0.208
NP_440888.1_2 Reverse -11 -25 7.07881 0.208
NP_440888.1_2 Forward -67 -53 5.01387 0.298
NP_440822.1_1 Reverse -179 -198 15.9781 0.155
NP_441543.1_2 Reverse -12 -21 16.9127 0.00359
NP_441543.1_2 Forward -19 -10 9.34117 0.0818
NP_442845.1_2 Forward -26 -12 13.2743 0.0955
NP_442845.1_2 Reverse -5 -19 5.70279 0.225
NP_442845.1_2 Forward -195 -181 4.03116 0.271
NP_441834.1_7 Forward -326 -307 14.4541 0.263
NP_441469.1_8 Reverse -10 -19 13.3727 0.073
NP_441469.1_8 Forward -21 -12 6.48957 0.227
NP_441469.1_8 Forward -315 -306 5.11294 0.289
NP_443064.1_6 Forward -20 -10 13.8273 0.0796
NP_443064.1_6 Reverse -11 -21 12.5669 0.0796
NP_442337.1_6 Forward -196 -177 21.0614 0.0528
NP_442578.1_7 Forward -19 -12 14.5921 0.026
NP_442578.1_7 Reverse -12 -19 14.5921 0.026
NP_441462.1_2 Forward -20 -10 20.1379 0.000967
NP_441462.1_2 Reverse -11 -21 11.5831 0.00406
NP_441621.1_7 Forward -316 -302 6.09611 0.068
NP_441621.1_7 Reverse -303 -317 -3.34366 0.188
NP_443062.1_1 Reverse -305 -323 13.8113 0.0569
NP_443062.1_1 Reverse -11 -29 3.57305 0.293
NP_440519.1_8 Forward -32 -16 3.50012 0.244
NP_442204.1_1 Reverse -148 -159 -0.137991 0.286
NP_440516.1_8 Forward -20 -11 16.9127 0.00442
NP_440516.1_8 Reverse -11 -20 16.9127 0.00442
NP_440516.1_8 Forward -314 -305 9.14451 0.0354
NP_442428.1_5 Forward -19 -12 15.8704 0.0124
NP_442428.1_5 Reverse -12 -19 15.8704 0.0124
NP_442428.1_5 Reverse -306 -313 4.36568 0.271
NP_441068.1_2 Forward -130 -111 9.93088 0.234
NP_440783.1_3 Reverse -250 -269 1.76941 0.266
NP_442120.1_10 Forward -187 -168 -14.3569 0.288
NP_441867.1_2 Reverse -229 -248 -14.2585 0.28
NP_440603.1_9 Forward -66 -47 1.27776 0.278
NP_440673.1_2 Forward -30 -11 17.6084 0.0498
NP_440673.1_3 Forward -18 -11 12.4288 0.0426
NP_440673.1_3 Reverse -13 -20 12.4288 0.0426
NP_441052.1_2 Reverse -11 -21 19.9412 0.00106
NP_441052.1_2 Forward -20 -10 10.4031 0.0285
NP_442219.1_8 Forward -171 -152 7.58731 0.267
NP_442219.1_9 Reverse -12 -21 17.7976 0.00718
NP_442219.1_9 Forward -19 -10 8.25953 0.0681
NP_440436.1_4 Reverse -12 -21 17.2072 0.00233
NP_440436.1_4 Forward -19 -10 15.9289 0.00508
NP_441884.1_8 Forward -206 -187 -8.16202 0.261
NP_441884.1_9 Reverse -8 -27 -16.8151 0.138
NP_441884.1_9 Forward -317 -298 -22.8133 0.284
NP_441884.1_9 Forward -32 -13 -25.1733 0.29
NP_440314.1_9 Reverse -12 -31 20.649 0.00614
NP_441719.1_4 Forward -19 -12 16.3621 0.0124
NP_441719.1_4 Reverse -12 -19 16.3621 0.0124
NP_441733.1_10 Forward -317 -304 10.8357 0.106
NP_441733.1_10 Forward -23 -10 5.32916 0.218
NP_441004.1_1 Reverse -232 -251 -14.9469 0.271
NP_442366.1_5 Forward -23 -13 15.4175 0.0374
NP_442139.1_7 Forward -25 -6 7.96426 0.279
NP_442206.1_10 Reverse -11 -26 4.30646 0.178
NP_443054.1_2 Reverse -9 -23 3.44117 0.24
NP_443054.1_2 Reverse -303 -317 2.06454 0.245
NP_441851.1_10 Reverse -10 -20 17.4829 0.0027
NP_441851.1_10 Forward -21 -11 15.8113 0.00552
NP_441668.1_4 Forward -30 -11 7.47261 0.151
NP_442515.1_1 Forward -21 -7 22.9107 0.00549
NP_442515.1_1 Reverse -10 -24 13.2743 0.0278
NP_442515.1_1 Forward -170 -156 0.982901 0.174
NP_440593.1_3 Forward -72 -53 -4.03212 0.244
NP_441046.1_2 Forward -31 -12 5.50599 0.227
NP_441349.1_10 Forward -265 -246 -2.16383 0.114
NP_441349.1_10 Forward -30 -11 -4.91709 0.186
NP_441409.1_6 Reverse -5 -24 -4.81876 0.095
NP_441409.1_6 Reverse -299 -318 -15.3402 0.29
NP_440389.1_5 Forward -275 -256 14.5362 0.221
NP_440432.1_9 Reverse -12 -27 -1.98672 0.167
NP_440432.1_9 Forward -19 -4 -3.06836 0.179
NP_442843.1_1 Reverse -12 -31 -2.75381 0.212
NP_442843.1_1 Forward -277 -258 -11.4069 0.291
NP_440474.1_8 Reverse -306 -320 8.94708 0.172
NP_440396.1_10 Reverse -59 -75 10.1859 0.242
NP_440431.1_3 Forward -21 -2 -5.11376 0.181
NP_442450.1_5 Reverse -9 -19 19.1546 0.0103
NP_442450.1_5 Forward -22 -12 7.55152 0.13
NP_442168.1_5 Reverse -12 -31 -2.45882 0.264
NP_440588.1_2 Forward -70 -51 -6.1954 0.273
NP_442006.1_2 Forward -61 -44 -9.3026 0.197
NP_442006.1_2 Forward -240 -223 -17.9557 0.285
NP_441570.1_1 Reverse -11 -29 -15.5171 0.231
NP_441078.1_4 Forward -20 -11 19.6659 0.0007
NP_441078.1_4 Reverse -11 -20 19.6659 0.0007
NP_441078.1_4 Reverse -58 -67 -1.27858 0.246
NP_442729.1_8 Reverse -7 -20 19.4888 0.0312
NP_442729.1_8 Forward -24 -11 10.639 0.125
NP_441663.1_6 Reverse -144 -163 17.994 0.196
NP_442348.1_2 Forward -183 -174 7.57121 0.28
NP_442443.1_1 Forward -158 -139 5.11266 0.157
NP_442443.1_1 Reverse -230 -249 -3.24547 0.265
NP_442443.1_1 Forward -146 -127 -6.39206 0.294
NP_440526.1_3 Forward -359 -348 3.40144 0.267
NP_440526.1_3 Forward -19 -8 1.6315 0.267
NP_440526.1_3 Reverse -12 -23 1.04151 0.267
NP_441432.1_8 Forward -21 -12 16.8143 0.00595
NP_441432.1_8 Reverse -10 -19 8.35786 0.0755
NP_441432.1_8 Reverse -57 -66 5.60459 0.147
NP_441432.1_8 Forward -170 -161 5.40793 0.158
NP_443024.1_2 Forward -248 -235 17.8166 0.156
NP_442320.1_8 Forward -26 -12 4.62115 0.0472
NP_442320.1_8 Reverse -5 -19 -2.26202 0.0871
NP_441732.1_2 Reverse -7 -23 -16.5594 0.174
NP_440685.1_6 Reverse -305 -324 16.4199 0.217
NP_440760.1_1 Reverse -11 -30 -5.31042 0.0493
NP_440760.1_1 Forward -20 -1 -9.44032 0.0835
NP_440760.1_1 Reverse -58 -77 -23.305 0.293
NP_440199.1_10 Forward -317 -307 6.66654 0.287
NP_442489.1_7 Forward -20 -11 20.1576 0.000695
NP_442489.1_7 Reverse -11 -20 20.1576 0.000695
NP_442489.1_7 Reverse -58 -67 -1.27858 0.185
NP_442489.1_7 Reverse -305 -314 -1.57357 0.213
NP_442489.1_7 Reverse -152 -161 -1.6719 0.235
NP_442489.1_7 Forward -67 -58 -1.77023 0.247
NP_440565.1_3 Forward -70 -51 14.8062 0.257
NP_442079.1_7 Reverse -12 -31 9.83255 0.111
NP_440559.1_1 Reverse -12 -21 17.4043 0.00658
NP_440559.1_1 Forward -19 -10 17.306 0.00658
NP_441659.2_8 Forward -20 -10 19.3512 0.000966
NP_441659.2_8 Reverse -11 -21 18.1713 0.00133
NP_441022.1_1 Forward -10 -1 12.4095 0.232
NP_442346.1_5 Reverse -10 -20 17.9746 0.00128
NP_442346.1_5 Forward -21 -11 16.6963 0.00248
NP_442346.1_5 Reverse -151 -161 4.89658 0.269
NP_440545.1_3 Forward -24 -7 -5.66436 0.256
NP_441856.1_3 Forward -23 -4 -2.95047 0.272
NP_441923.1_6 Forward -194 -180 18.0925 0.109
NP_442603.1_7 Forward -20 -6 16.2235 0.0337
NP_442603.1_7 Reverse -11 -25 7.17714 0.211
NP_442603.1_7 Forward -314 -300 6.0955 0.259
NP_441047.1_2 Forward -66 -47 2.26107 0.239
NP_441833.1_4 Forward -19 -12 15.9687 0.0124
NP_441833.1_4 Reverse -12 -19 15.9687 0.0124
NP_442699.1_8 Reverse -56 -75 -10.7186 0.238
NP_442162.1_9 Forward -19 -12 16.2637 0.0124
NP_442162.1_9 Reverse -12 -19 16.2637 0.0124
NP_442140.1_3 Reverse -306 -316 14.4347 0.0486
NP_442140.1_3 Reverse -12 -22 12.2714 0.0632
NP_442140.1_3 Forward -313 -303 6.17489 0.184
NP_442140.1_3 Forward -19 -9 5.68323 0.198
NP_442140.1_3 Forward -60 -50 3.71661 0.283
NP_440875.1_9 Reverse -307 -317 17.4244 0.0126
NP_441813.1_5 Reverse -9 -19 16.1063 0.01
NP_441813.1_5 Forward -22 -12 8.63316 0.0367
NP_440594.1_8 Forward -19 -6 11.8184 0.152
NP_442254.1_1 Reverse -40 -59 -0.688862 0.282
NP_440590.1_4 Reverse -12 -25 0.805932 0.143
NP_440590.1_4 Forward -19 -6 -5.29059 0.277
NP_440590.1_4 Reverse -306 -319 -5.48725 0.28
NP_440590.1_4 Forward -313 -300 -5.68391 0.286
NP_440567.1_1 Reverse -12 -26 11.406 0.0286
NP_440567.1_1 Forward -19 -5 5.40779 0.103
NP_440567.1_1 Forward -370 -356 -0.492064 0.287
NP_442497.1_10 Forward -19 -10 19.8626 0.00532
NP_442497.1_10 Reverse -12 -21 10.4228 0.0087
NP_440821.1_4 Reverse -9 -19 19.8429 0.00399
NP_440821.1_4 Forward -22 -12 9.41981 0.0286
NP_440821.1_4 Forward -316 -306 -0.806614 0.296
NP_440821.1_10 Reverse -78 -96 16.3793 0.284
NP_441239.1_9 Reverse -303 -315 16.5586 0.0166
NP_441239.1_9 Reverse -9 -21 11.7404 0.0551
NP_441239.1_9 Forward -22 -10 6.92215 0.173
NP_442568.1_8 Reverse -97 -111 8.94771 0.274
NP_441727.1_3 Forward -27 -8 10.0292 0.171
NP_440400.1_1 Forward -358 -339 -2.06626 0.285
NP_440665.1_2 Reverse -229 -248 -1.27885 0.208
NP_442193.1_1 Reverse -339 -357 14.2771 0.187
NP_442270.1_9 Reverse -47 -66 -7.27704 0.213
NP_442643.1_5 Reverse -54 -73 -2.45882 0.277
NP_441874.1_1 Forward -199 -185 11.701 0.24
NP_441874.1_1 Forward -192 -178 9.73436 0.276
NP_440833.1_6 Reverse -18 -32 8.16044 0.277
NP_440833.1_6 Reverse -65 -79 6.88214 0.296
NP_442216.1_4 Reverse -175 -183 8.1805 0.255
NP_442216.1_4 Reverse -77 -85 8.08217 0.255
NP_442052.1_7 Forward -65 -51 12.7826 0.257
NP_440546.1_4 Forward -20 -10 12.8578 0.0572
NP_440546.1_4 Forward -314 -304 12.373 0.0679
NP_440546.1_4 Reverse -11 -21 10.046 0.109
NP_440546.1_4 Forward -341 -331 6.55553 0.291
NP_440546.1_6 Reverse -286 -305 8.45592 0.256
NP_440675.1_1 Reverse -350 -369 1.96607 0.28
NP_440462.1_6 Reverse -9 -19 7.84651 0.0699
NP_440462.1_6 Reverse -303 -313 4.3066 0.205
NP_440462.1_6 Forward -22 -12 1.35667 0.294
NP_442340.1_3 Forward -65 -46 -6.68705 0.225
NP_440868.1_4 Forward -24 -12 8.10212 0.0602
NP_440868.1_4 Reverse -301 -313 3.77555 0.133
NP_440868.1_4 Reverse -7 -19 1.41561 0.183
NP_442479.1_9 Reverse -294 -313 -10.6203 0.273
NP_440812.1_1 Reverse -180 -199 2.0644 0.267
NP_441084.1_6 Reverse -9 -23 14.4828 0.0972
NP_440696.1_3 Forward -205 -187 1.98577 0.217
NP_442039.1_4 Forward -19 -12 15.1821 0.0124
NP_442039.1_4 Reverse -12 -19 15.1821 0.0124
NP_442039.1_7 Reverse -54 -64 6.76487 0.299
NP_441811.1_1 Reverse -151 -170 3.73603 0.3
NP_441811.1_8 Reverse -5 -19 6.09611 0.287
NP_440825.1_7 Reverse -12 -22 12.9096 0.152
NP_442696.1_6 Reverse -17 -36 -13.7669 0.291
NP_442837.1_3 Forward -19 -12 15.7721 0.0124
NP_442837.1_3 Reverse -12 -19 15.7721 0.0124
NP_442053.1_1 Forward -20 -11 18.3876 0.0007
NP_442053.1_1 Reverse -11 -20 18.3876 0.0007
NP_442053.1_1 Reverse -305 -314 4.71961 0.228
NP_440505.1_3 Forward -22 -12 9.22315 0.122
NP_440505.1_3 Reverse -9 -19 7.55152 0.151
NP_441536.1_1 Forward -239 -220 9.53756 0.298
NP_441203.1_5 Forward -352 -333 15.7324 0.118
NP_440914.1_1 Reverse -11 -21 17.5935 0.000537
NP_440914.1_1 Reverse -58 -68 11.3477 0.097
NP_440914.1_1 Forward -20 -10 8.51751 0.186
NP_440914.1_2 Forward -187 -168 15.6341 0.297
NP_441011.1_8 Forward -19 -10 14.356 0.0249
NP_441011.1_8 Reverse -12 -21 8.25953 0.144
NP_441011.1_8 Reverse -363 -372 6.5879 0.186
NP_442101.1_10 Forward -28 -9 -8.06369 0.227
NP_442533.1_6 Forward -20 -11 17.2076 0.00137
NP_442533.1_6 Reverse -11 -20 17.2076 0.00137
NP_442533.1_6 Reverse -305 -314 3.44131 0.212
NP_443016.1_1 Forward -167 -148 -8.65367 0.3
NP_441482.1_7 Reverse -5 -19 -1.67204 0.0787
NP_439944.1_9 Forward -19 -9 17.3846 0.00516
NP_439944.1_9 Reverse -12 -22 10.5014 0.0887
NP_442269.1_10 Forward -31 -12 7.66927 0.194
NP_441028.1_6 Forward -243 -233 5.78111 0.243
NP_441527.1_5 Reverse -9 -28 14.2504 0.287
NP_440007.1_9 Reverse -7 -21 0.786239 0.29
NP_439965.1_10 Reverse -190 -209 17.7965 0.282
NP_440608.1_6 Reverse -12 -31 11.7983 0.225
NP_441972.1_5 Reverse -12 -31 -2.95047 0.194
NP_441106.1_1 Reverse -10 -19 9.73449 0.0311
NP_441106.1_1 Forward -21 -12 9.63616 0.0311
NP_439903.1_1 Reverse -366 -385 1.96607 0.231
NP_439903.1_6 Reverse -8 -27 -0.29631 0.28
NP_439903.1_6 Forward -70 -51 -1.08295 0.292
NP_442306.1_10 Reverse -300 -319 -12.4886 0.178
NP_441286.1_1 Forward -21 -9 23.9334 0.000767
NP_441286.1_1 Reverse -10 -22 3.48056 0.0467
NP_440670.1_8 Forward -20 -11 18.3876 0.000699
NP_440670.1_8 Reverse -11 -20 18.3876 0.000699
NP_440670.1_8 Forward -161 -152 3.44131 0.267
NP_440886.1_7 Reverse -10 -20 8.04271 0.0805
NP_440886.1_7 Forward -21 -11 7.94438 0.0805
NP_440886.1_7 Reverse -304 -314 6.76441 0.114
NP_440886.1_7 Forward -315 -305 6.56775 0.118
NP_442614.1_2 Forward -20 -6 10.226 0.234
NP_442382.1_6 Reverse -381 -394 17.0346 0.177
NP_442401.1_2 Forward -170 -151 9.53674 0.204
NP_440907.2_8 Forward -19 -9 9.81266 0.103
NP_440907.2_8 Reverse -12 -22 7.64939 0.117
NP_440907.2_8 Reverse -306 -316 5.97777 0.182
NP_442264.1_5 Forward -67 -53 13.9626 0.232
NP_440326.1_5 Forward -22 -9 15.2606 0.179
NP_440841.1_4 Reverse -9 -28 -7.27704 0.226
NP_441626.1_2 Forward -19 -12 15.7721 0.0124
NP_441626.1_2 Reverse -12 -19 15.7721 0.0124
NP_442794.1_1 Forward -24 -12 9.28209 0.0795
NP_442794.1_1 Reverse -54 -66 7.4138 0.138
NP_442615.1_1 Forward -29 -11 -1.65248 0.131
NP_442615.1_1 Reverse -2 -20 -4.50408 0.188
NP_441962.1_4 Reverse -53 -72 -2.65548 0.135
NP_441962.1_4 Reverse -6 -25 -12.7836 0.265
NP_441962.1_4 Reverse -352 -371 -13.2752 0.271
NP_440387.1_1 Reverse -11 -27 5.17175 0.0343
NP_440387.1_1 Forward -20 -4 -2.30141 0.147
NP_441431.1_2 Reverse -302 -316 11.897 0.131
NP_441431.1_2 Forward -317 -303 9.83206 0.176
NP_441431.1_2 Reverse -246 -260 6.88214 0.257
NP_441431.1_3 Forward -195 -176 18.0924 0.155
NP_441836.1_1 Reverse -47 -66 16.7589 0.108
NP_441836.1_2 Forward -167 -148 -4.13045 0.254
NP_441836.1_2 Reverse -5 -24 -5.70374 0.284
NP_442805.1_5 Reverse -131 -150 -4.72118 0.269
NP_440114.1_10 Forward -20 -6 11.7993 0.103
NP_440114.1_10 Reverse -305 -319 7.66941 0.229
NP_440293.1_10 Reverse -351 -370 1.86774 0.219
NP_440766.1_2 Forward -241 -225 15.3974 0.279
NP_440766.1_4 Forward -318 -304 2.5562 0.179
NP_441237.1_9 Reverse -12 -22 14.828 0.0242
NP_441133.1_1 Reverse -346 -365 12.0942 0.273
NP_439910.1_2 Reverse -3 -20 -3.20608 0.0362
NP_439910.1_2 Reverse -297 -314 -22.479 0.25
NP_440457.1_1 Reverse -7 -19 9.77374 0.092
NP_440801.1_8 Reverse -10 -29 2.55606 0.229
NP_442509.1_9 Forward -20 -10 17.3841 0.00128
NP_442509.1_9 Reverse -11 -21 8.14104 0.192
NP_442509.1_9 Reverse -75 -85 7.0594 0.24
NP_442439.1_8 Reverse -51 -70 9.83255 0.253
NP_442514.1_5 Reverse -50 -69 -9.34271 0.295
NP_440554.1_4 Forward -19 -9 6.96153 0.107
NP_442862.1_3 Reverse -122 -139 4.26707 0.29
NP_441885.1_5 Reverse -11 -21 20.9245 0.000538
NP_441885.1_5 Forward -20 -10 11.3864 0.00668
NP_440022.1_4 Reverse -30 -49 15.7324 0.246
NP_442341.1_7 Forward -21 -7 12.3893 0.0454
NP_442341.1_7 Reverse -10 -24 11.406 0.0555
NP_442341.1_7 Forward -315 -301 4.42448 0.191
NP_441173.1_9 Forward -243 -235 12.0154 0.214
NP_440423.1_6 Forward -322 -303 -19.1751 0.236
NP_443000.1_7 Forward -22 -12 10.3048 0.0345
NP_443000.1_7 Reverse -9 -19 8.82982 0.0437
NP_441842.1_10 Forward -27 -13 7.86607 0.241
NP_440275.1_3 Reverse -9 -19 10.0098 0.0454
NP_440275.1_3 Forward -22 -12 8.04317 0.0602
NP_440275.1_3 Forward -316 -306 5.5849 0.14
NP_440091.1_1 Forward -318 -306 0.628964 0.241
NP_442354.1_7 Reverse -55 -74 4.62101 0.281
NP_440149.1_8 Reverse -11 -30 -8.06369 0.298
NP_441105.1_3 Forward -72 -53 3.24438 0.0932
NP_440216.1_1 Forward -20 -6 -2.45868 0.0513
NP_440216.1_1 Reverse -11 -25 -10.6202 0.145
NP_440216.1_9 Reverse -54 -63 7.57121 0.286
NP_440216.1_9 Reverse -168 -177 5.70292 0.29
NP_440172.1_1 Forward -20 -10 16.303 0.00854
NP_440172.1_1 Reverse -11 -21 15.0247 0.00945
NP_440249.1_2 Reverse -370 -380 14.3359 0.284
NP_442015.1_10 Reverse -54 -67 5.03416 0.154
NP_442015.1_10 Forward -24 -11 1.39592 0.204
NP_442015.1_10 Reverse -7 -20 1.29759 0.206
NP_441226.1_7 Forward -19 -12 14.4934 0.0123
NP_441226.1_7 Reverse -12 -19 14.4934 0.0123
NP_441226.1_7 Forward -313 -306 12.4284 0.0404
NP_441226.1_7 Forward -354 -347 6.52862 0.253
NP_441757.1_3 Forward -21 -2 6.09597 0.145
NP_441111.1_7 Forward -19 -11 18.7023 0.00294
NP_441111.1_7 Reverse -12 -20 18.7023 0.00294
NP_441766.1_2 Forward -20 -11 17.5026 0.00297
NP_441766.1_2 Reverse -11 -20 17.5026 0.00297
NP_441766.1_2 Reverse -305 -314 5.01461 0.148
NP_440416.1_9 Reverse -50 -69 -20.3551 0.284
NP_443052.1_8 Reverse -236 -255 -11.8003 0.237
NP_442116.1_2 Forward -312 -293 18.5831 0.156
NP_442154.1_1 Reverse -352 -370 -13.7472 0.217
NP_442564.1_10 Reverse -250 -264 13.5693 0.244
NP_440261.1_5 Forward -19 -6 6.90245 0.0316
NP_440261.1_5 Reverse -12 -25 -10.3055 0.201
NP_440988.1_5 Forward -172 -153 14.5178 0.228
NP_440988.1_10 Forward -362 -348 6.15739 0.232
NP_440988.1_10 Reverse -178 -192 3.34982 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTAATCCGGTGTTGTTGGAGCCAATTTTGAGCGTTAACGTCACCACCCCAACGGAATTTACCTCTCGGGTGTTGCAACTAGTAAGCGGCCATCGGGGCCAAATTCTTGGTTACGAAGCCCGTTCCGACTGGAAAAGTTGGGACCAGGTGGCTGCCCATTTACCCCAAGCAGAAATGCAGAACTTCATTATTGAACTGCGTTCTTTGACCTTGGGGGTGGGGAATTTTACTTGGCAATCTGACCATCTCCAGGAAGTGCCGGATAAGTTTGCGCCTAATTTACGTCCAGATTGATTGTCTTCCTTAAGAGATGCTTGGGGGATTAGGTAATTTTGGCCTTTGCCAAGGCGGAAAATCAGGATAACCTTAAGGGGCTATTTTGGCGATCGCCCTAAAATTTT

CDS

ATGGTTTTCCCTTCCCCCAATGGTGGTGGCTCCGATCAAGGTAACTCTAATTTTGACGAATACGACGACATCACGGGAGCTCGTCGGGAAGAGGCTCTGAAAAAAGCCCGCAACTGGTTTGTCATTTTGGTGGTGGGAGGACTGGTGCTGGGGGTAGTGGTGGCCTTTGGCGTGGTGCAGGTTCTCAATAGCTTGGGATTAACGGAAAAACCTGATGCTCCCCTCCGCATTGAGATGGAGCGGGAAAATCCACCCCAGCAATAG

Protein

MVFPSPNGGGSDQGNSNFDEYDDITGARREEALKKARNWFVILVVGGLVLGVVVAFGVVQVLNSLGLTEKPDAPLRIEMERENPPQQ