Your browser is old and dusty. Try Google Chrome!

Details for ssl1498

ORF ssl1498
Accession NP_441463.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -224 -238 8.25939 0.0917
NP_441061.1_2 Forward -243 -229 1.76955 0.183
NP_440795.1_7 Forward -231 -224 14.6904 0.0123
NP_440795.1_7 Reverse -224 -231 14.6904 0.0123
NP_441418.1_6 Reverse -223 -242 -10.0303 0.031
NP_441418.1_6 Forward -232 -213 -20.5517 0.117
NP_441418.1_6 Forward -244 -225 -29.1065 0.216
NP_440897.1_6 Forward -232 -213 1.08032 0.171
NP_441453.1_1 Forward -137 -119 2.77167 0.286
NP_441453.1_4 Reverse -223 -231 16.539 0.00633
NP_441453.1_4 Forward -232 -224 16.539 0.00633
NP_441453.1_4 Forward -244 -236 3.95266 0.275
NP_441453.1_4 Forward -394 -386 3.85433 0.284
NP_441960.1_9 Reverse -136 -155 17.2074 0.23
NP_442151.1_6 Reverse -193 -207 8.65272 0.167
NP_440561.1_2 Reverse -171 -190 15.0441 0.213
NP_441818.1_1 Forward -393 -382 11.0712 0.203
NP_441818.1_1 Reverse -224 -235 9.69459 0.232
NP_440226.1_1 Reverse -223 -242 13.3725 0.0366
NP_440226.1_1 Forward -232 -213 6.39097 0.129
NP_440226.1_1 Forward -394 -375 4.12936 0.202
NP_441465.1_8 Forward -374 -356 4.6407 0.299
NP_442623.1_3 Forward -243 -224 -19.2734 0.284
NP_442173.1_1 Forward -231 -223 15.4574 0.00633
NP_442173.1_1 Reverse -224 -232 15.4574 0.00633
NP_442752.1_4 Forward -232 -225 13.8055 0.0199
NP_442752.1_4 Reverse -223 -230 13.8055 0.0199
NP_443027.1_4 Forward -234 -224 14.828 0.0437
NP_443027.1_4 Forward -246 -236 9.22315 0.172
NP_443027.1_4 Forward -396 -386 8.53483 0.199
NP_443027.1_4 Reverse -221 -231 5.87989 0.294
NP_441812.1_3 Reverse -222 -236 14.9459 0.106
NP_442975.1_10 Forward -236 -222 13.8636 0.0459
NP_442975.1_10 Reverse -219 -233 2.16228 0.283
NP_440784.1_7 Forward -231 -224 15.9687 0.0123
NP_440784.1_7 Reverse -224 -231 15.9687 0.0123
NP_440784.1_7 Forward -393 -386 8.59391 0.129
NP_440061.1_9 Forward -396 -382 10.6187 0.124
NP_442062.1_8 Forward -232 -222 19.4496 0.000558
NP_442062.1_8 Reverse -223 -233 19.4496 0.000558
NP_442062.1_8 Forward -244 -234 8.4365 0.075
NP_442062.1_8 Forward -394 -384 4.0116 0.237
NP_441859.1_3 Forward -245 -226 7.07848 0.165
NP_441859.1_3 Reverse -222 -241 6.1935 0.182
NP_440304.1_4 Forward -234 -224 10.8948 0.051
NP_440304.1_4 Reverse -221 -231 1.84832 0.299
NP_442242.1_4 Forward -231 -224 14.3954 0.0124
NP_442242.1_4 Reverse -224 -231 14.3954 0.0124
NP_440044.1_8 Reverse -224 -243 5.11266 0.106
NP_439918.1_2 Forward -109 -90 -4.13045 0.268
NP_439918.1_2 Reverse -164 -183 -5.01543 0.295
NP_441352.1_2 Forward -239 -220 5.11266 0.207
NP_441200.1_4 Reverse -52 -71 11.5042 0.172
NP_441594.1_6 Forward -241 -222 1.76941 0.262
NP_442110.1_7 Reverse -223 -237 1.57289 0.222
NP_442110.1_7 Forward -244 -230 0.491246 0.259
NP_441082.1_10 Forward -215 -202 8.77074 0.262
NP_440856.1_4 Forward -239 -220 -3.14714 0.226
NP_441083.1_3 Reverse -67 -77 15.5158 0.138
NP_441083.1_5 Forward -232 -222 11.3864 0.0159
NP_441083.1_5 Reverse -223 -233 11.3864 0.0159
NP_441434.1_7 Forward -230 -216 1.76955 0.295
NP_441738.1_2 Forward -230 -223 15.28 0.0102
NP_441738.1_2 Reverse -225 -232 15.28 0.0102
NP_441558.1_5 Forward -396 -377 6.58763 0.21
NP_441558.1_5 Forward -234 -215 6.4893 0.214
NP_441942.1_6 Forward -239 -220 16.8093 0.235
NP_440209.1_1 Reverse -223 -231 18.1123 0.00295
NP_440209.1_1 Forward -232 -224 18.1123 0.00295
NP_442889.1_8 Forward -235 -221 13.1753 0.0588
NP_442889.1_8 Reverse -220 -234 9.73373 0.0945
NP_440178.1_7 Reverse -222 -241 -12.7836 0.124
NP_442570.1_8 Forward -219 -201 13.2938 0.179
NP_441716.1_1 Reverse -252 -266 7.27608 0.173
NP_442111.1_4 Forward -233 -219 7.76774 0.0867
NP_441831.1_6 Reverse -141 -160 18.7807 0.0436
NP_440906.1_5 Forward -231 -224 15.8704 0.0124
NP_440906.1_5 Reverse -224 -231 15.8704 0.0124
NP_440747.1_10 Reverse -220 -232 5.34885 0.0141
NP_440747.1_10 Forward -235 -223 -2.02597 0.0196
NP_440747.1_10 Forward -397 -385 -12.2524 0.254
NP_440747.1_10 Reverse -382 -394 -12.4491 0.282
NP_441486.1_1 Forward -235 -221 21.2391 0.00239
NP_441486.1_1 Reverse -220 -234 10.3243 0.0209
NP_442330.1_4 Reverse -134 -153 15.3365 0.263
NP_442634.1_4 Reverse -250 -264 0.687908 0.149
NP_442634.1_4 Reverse -383 -397 -5.01529 0.228
NP_441014.1_10 Reverse -222 -241 0.883656 0.236
NP_442848.1_1 Forward -238 -224 -3.63866 0.268
NP_443018.1_3 Forward -231 -224 14.8871 0.0123
NP_443018.1_3 Reverse -224 -231 14.8871 0.0123
NP_443018.1_3 Forward -243 -236 11.3472 0.0846
NP_443018.1_3 Reverse -236 -243 4.16902 0.278
NP_441634.1_8 Reverse -221 -235 -4.4253 0.295
NP_440376.1_1 Forward -232 -223 19.4693 0.000692
NP_440376.1_1 Reverse -223 -232 19.4693 0.000692
NP_441857.1_6 Forward -104 -94 13.7464 0.269
NP_441588.1_4 Forward -230 -220 14.238 0.0773
NP_441588.1_4 Reverse -225 -235 6.96153 0.178
NP_443065.1_6 Reverse -219 -238 3.24438 0.221
NP_443065.1_9 Reverse -136 -155 10.9142 0.231
NP_442687.1_7 Forward -233 -223 15.8113 0.0125
NP_442687.1_7 Reverse -222 -232 15.8113 0.0125
NP_442687.1_7 Forward -203 -193 5.68323 0.189
NP_442485.1_3 Forward -272 -253 -5.01543 0.287
NP_441846.1_10 Reverse -130 -149 -22.8133 0.266
NP_442296.1_9 Forward -231 -212 11.2092 0.0897
NP_442296.1_9 Reverse -224 -243 -2.55715 0.228
NP_441763.1_10 Forward -243 -224 8.94676 0.204
NP_442658.1_1 Reverse -221 -231 15.9091 0.00966
NP_442658.1_1 Forward -234 -224 15.9091 0.00966
NP_440141.1_8 Forward -33 -14 7.86593 0.232
NP_442782.1_2 Reverse -223 -237 1.37622 0.281
NP_441414.1_9 Forward -232 -213 11.6025 0.0179
NP_442300.1_5 Reverse -221 -240 11.6025 0.282
NP_441958.1_5 Forward -233 -223 12.2714 0.00183
NP_441958.1_5 Reverse -222 -232 12.2714 0.00183
NP_441958.1_5 Forward -395 -385 0.373358 0.154
NP_441127.1_1 Reverse -130 -144 16.9125 0.1
NP_440995.1_8 Reverse -213 -232 -0.885524 0.288
NP_440984.1_7 Reverse -218 -232 11.701 0.122
NP_440984.1_7 Forward -399 -385 6.88276 0.195
NP_442911.1_2 Reverse -213 -232 9.0459 0.0185
NP_442911.1_2 Forward -242 -223 -0.4922 0.0759
NP_441580.1_6 Forward -243 -224 1.96607 0.117
NP_440369.1_5 Reverse -266 -285 13.7658 0.189
NP_443055.1_6 Forward -240 -222 2.28001 0.216
NP_441099.1_5 Forward -333 -314 -10.9153 0.266
NP_441099.1_5 Forward -242 -223 -11.8986 0.291
NP_442002.1_9 Forward -233 -226 10.7572 0.185
NP_442002.1_9 Reverse -222 -229 10.7572 0.185
NP_440809.1_9 Forward -241 -223 -7.84733 0.225
NP_441294.1_7 Forward -229 -215 8.86667 0.274
NP_441646.1_1 Forward -268 -249 4.12936 0.199
NP_441646.1_1 Reverse -216 -235 2.65439 0.216
NP_441646.1_1 Reverse -168 -187 -0.39387 0.264
NP_442438.1_10 Forward -237 -223 10.9143 0.0478
NP_442438.1_10 Reverse -218 -232 5.1128 0.139
NP_442431.1_10 Reverse -249 -267 2.37909 0.238
NP_442431.1_10 Reverse -379 -397 -0.865831 0.296
NP_441752.1_6 Forward -332 -313 2.55606 0.235
NP_441000.1_6 Reverse -222 -236 13.2743 0.0396
NP_441000.1_6 Forward -233 -219 4.81781 0.0933
NP_442771.1_1 Forward -234 -216 -8.14232 0.182
NP_441674.1_6 Forward -343 -324 4.22769 0.261
NP_440147.1_4 Reverse -221 -234 11.3273 0.0326
NP_440147.1_4 Forward -396 -383 10.5407 0.0355
NP_440147.1_4 Forward -234 -221 2.18257 0.209
NP_441550.1_8 Reverse -221 -231 8.3377 0.124
NP_441550.1_8 Forward -396 -386 7.55106 0.154
NP_441550.1_8 Forward -234 -224 6.0761 0.214
NP_441916.1_7 Forward -232 -222 18.4663 0.00144
NP_441916.1_7 Reverse -223 -233 18.4663 0.00144
NP_441916.1_7 Reverse -385 -395 7.05986 0.0779
NP_441916.1_7 Reverse -235 -245 2.63497 0.246
NP_440345.1_3 Reverse -87 -101 10.6112 0.277
NP_441041.1_4 Reverse -223 -242 9.24257 0.033
NP_441041.1_7 Forward -235 -223 10.916 0.0864
NP_441041.1_7 Reverse -220 -232 9.55551 0.109
NP_442396.1_5 Reverse -219 -232 17.9155 0.0262
NP_442396.1_5 Forward -101 -88 8.27909 0.16
NP_441725.1_5 Reverse -224 -234 11.2881 0.0247
NP_441725.1_5 Forward -231 -221 2.04498 0.115
NP_439966.1_7 Forward -234 -224 18.4657 0.00473
NP_439966.1_7 Reverse -221 -231 9.91099 0.0968
NP_439966.1_9 Forward -234 -225 0.983037 0.253
NP_439966.1_9 Reverse -221 -230 0.884706 0.253
NP_442941.1_3 Reverse -224 -234 11.4848 0.0116
NP_442941.1_3 Forward -393 -383 4.3066 0.14
NP_442941.1_3 Forward -231 -221 2.63497 0.14
NP_442941.1_3 Reverse -386 -396 -0.0199663 0.244
NP_440289.1_2 Forward -235 -222 14.6706 0.0107
NP_440289.1_2 Reverse -220 -233 -3.61896 0.267
NP_442281.1_1 Forward -237 -223 18.7801 0.00389
NP_442281.1_1 Forward -266 -252 4.8172 0.18
NP_442281.1_1 Reverse -218 -232 3.73557 0.221
NP_442281.1_1 Reverse -268 -282 3.44058 0.231
NP_441334.1_7 Forward -246 -227 -20.8467 0.281
NP_440437.1_1 Reverse -217 -236 2.3594 0.135
NP_441556.1_4 Forward -241 -222 9.81228 0.293
NP_441556.1_10 Reverse -217 -231 11.6819 0.219
NP_440498.1_1 Forward -241 -223 7.09898 0.0845
NP_440498.1_1 Reverse -214 -232 -2.73412 0.245
NP_441644.1_6 Forward -261 -251 12.3692 0.0339
NP_441644.1_6 Forward -232 -222 10.1076 0.0628
NP_441644.1_6 Reverse -223 -233 10.1076 0.0628
NP_441644.1_6 Reverse -385 -395 5.19112 0.204
NP_442215.1_2 Forward -234 -218 -1.71142 0.187
NP_442215.1_2 Reverse -221 -237 -1.71142 0.187
NP_440253.1_2 Reverse -223 -241 7.88563 0.0643
NP_440253.1_2 Forward -232 -214 -3.52077 0.294
NP_440929.1_8 Forward -232 -223 19.2726 0.000701
NP_440929.1_8 Reverse -223 -232 19.2726 0.000701
NP_440929.1_8 Forward -225 -216 2.16301 0.262
NP_440929.1_9 Forward -332 -318 13.7659 0.279
NP_442933.1_10 Forward -232 -223 17.601 0.00325
NP_442933.1_10 Reverse -223 -232 17.601 0.00325
NP_442933.1_10 Reverse -385 -394 10.6195 0.0484
NP_441751.2_8 Reverse -224 -238 -3.93365 0.157
NP_442926.1_3 Reverse -224 -243 2.3594 0.295
NP_442926.1_5 Reverse -218 -237 21.7253 0.0294
NP_442554.1_8 Reverse -224 -234 13.8447 0.0145
NP_442554.1_8 Forward -231 -221 13.2547 0.0187
NP_442554.1_8 Forward -260 -250 7.25653 0.0955
NP_442554.1_8 Reverse -386 -396 6.66654 0.111
NP_442554.1_8 Reverse -253 -263 5.28991 0.153
NP_442554.1_8 Forward -243 -233 4.20827 0.193
NP_441762.1_7 Forward -233 -221 19.3118 0.00342
NP_441762.1_7 Reverse -222 -234 12.0354 0.0142
NP_442313.1_4 Forward -103 -84 9.0459 0.286
NP_442142.1_4 Forward -235 -222 18.4065 0.0255
NP_442142.1_4 Forward -264 -251 8.2785 0.118
NP_442142.1_4 Reverse -220 -233 7.19687 0.144
NP_442142.1_4 Forward -397 -384 7.09854 0.148
NP_442292.1_1 Forward -231 -222 9.63616 0.0183
NP_442292.1_1 Reverse -224 -233 9.63616 0.0183
NP_442292.1_1 Forward -243 -234 5.21127 0.152
NP_442476.1_2 Reverse -2 -20 13.8282 0.265
NP_442476.1_6 Forward -231 -217 3.34284 0.158
NP_442381.1_8 Reverse -220 -239 -14.1602 0.28
NP_442381.1_8 Forward -235 -216 -14.1602 0.28
NP_442381.1_8 Reverse -249 -268 -14.6519 0.284
NP_443009.1_5 Reverse -222 -233 11.6612 0.0602
NP_443009.1_5 Forward -233 -222 11.6612 0.0602
NP_441715.1_4 Reverse -224 -234 16.303 0.0117
NP_441715.1_4 Forward -231 -221 9.41981 0.097
NP_441715.1_4 Forward -393 -383 6.27322 0.155
NP_441468.1_1 Forward -231 -224 15.8704 0.0124
NP_441468.1_1 Reverse -224 -231 15.8704 0.0124
NP_441468.1_1 Reverse -386 -393 4.26735 0.246
NP_441468.1_1 Reverse -236 -243 3.97235 0.277
NP_441020.2_6 Reverse -221 -238 17.6401 0.0176
NP_441020.2_6 Forward -234 -217 16.7551 0.025
NP_441015.1_10 Forward -237 -218 -4.81876 0.212
NP_441673.1_1 Forward -232 -223 20.8459 0.000698
NP_441673.1_1 Reverse -223 -232 20.8459 0.000698
NP_442490.1_9 Forward -244 -225 -6.68705 0.273
NP_442868.1_6 Forward -234 -224 0.963343 0.205
NP_442868.1_6 Reverse -221 -231 0.865012 0.205
NP_442719.1_2 Reverse -79 -97 -2.83317 0.192
NP_441056.1_1 Reverse -223 -242 -3.3438 0.225
NP_440785.1_1 Reverse -365 -384 3.53937 0.178
NP_441612.1_2 Reverse -371 -381 6.80666 0.277
NP_442361.1_3 Forward -238 -225 8.77074 0.285
NP_442808.1_1 Forward -233 -223 18.4657 0.00201
NP_442808.1_1 Reverse -222 -232 18.4657 0.00201
NP_442050.1_1 Reverse -128 -147 9.73422 0.247
NP_442050.1_5 Forward -234 -224 9.12434 0.193
NP_442342.1_9 Forward -263 -247 2.02515 0.294
NP_441114.1_3 Reverse -274 -283 14.5527 0.193
NP_440558.1_2 Forward -264 -245 -5.70374 0.264
NP_441518.1_3 Forward -242 -223 0.982764 0.0744
NP_441878.1_6 Forward -262 -252 10.5014 0.0176
NP_441878.1_6 Forward -233 -223 10.4031 0.0176
NP_441878.1_6 Reverse -222 -232 10.4031 0.0176
NP_441878.1_6 Reverse -315 -325 1.25834 0.108
NP_441878.1_6 Reverse -251 -261 0.668351 0.139
NP_441036.1_8 Forward -233 -223 17.7779 0.000554
NP_441036.1_8 Reverse -222 -232 17.7779 0.000554
NP_441557.1_5 Forward -232 -223 19.9609 0.000699
NP_441557.1_5 Reverse -223 -232 19.9609 0.000699
NP_441557.1_5 Forward -394 -385 -0.885252 0.26
NP_441445.1_1 Forward -241 -222 11.0125 0.0895
NP_442777.1_3 Forward -302 -284 2.87 0.274
NP_442419.1_2 Reverse -218 -237 -0.4922 0.246
NP_441308.1_8 Forward -234 -224 10.1081 0.22
NP_440101.1_3 Reverse -218 -237 3.53937 0.227
NP_442183.1_1 Reverse -223 -237 17.2075 0.0118
NP_440440.1_4 Forward -243 -224 14.8474 0.297
NP_441574.1_1 Forward -244 -225 -2.0655 0.224
NP_441574.1_1 Reverse -211 -230 -2.55715 0.226
NP_441574.1_1 Reverse -223 -242 -5.40875 0.26
NP_442347.1_2 Forward -231 -222 11.1111 0.056
NP_442347.1_2 Reverse -224 -233 11.1111 0.056
NP_442645.1_2 Forward -240 -221 -13.7669 0.164
NP_442645.1_2 Reverse -215 -234 -21.83 0.29
NP_442888.1_6 Reverse -374 -393 4.22769 0.228
NP_441037.1_4 Reverse -221 -231 14.7245 0.028
NP_441037.1_4 Forward -234 -224 7.02532 0.237
NP_442317.1_6 Forward -266 -247 5.50599 0.24
NP_442317.1_6 Reverse -247 -266 4.22769 0.247
NP_441633.1_3 Reverse -221 -234 10.7374 0.0286
NP_441633.1_3 Forward -234 -221 3.65753 0.0699
NP_442764.1_8 Reverse -324 -343 1.76941 0.298
NP_440136.1_2 Forward -231 -224 15.9687 0.0123
NP_440136.1_2 Reverse -224 -231 15.9687 0.0123
NP_442998.1_10 Forward -230 -223 15.5754 0.0102
NP_442998.1_10 Reverse -225 -232 15.5754 0.0102
NP_440899.1_5 Forward -212 -193 5.30933 0.242
NP_440299.1_1 Reverse -219 -232 16.8333 0.00835
NP_440299.1_1 Forward -236 -223 2.28034 0.292
NP_441799.1_1 Reverse -219 -233 16.1252 0.0153
NP_441799.1_1 Forward -398 -384 11.897 0.0503
NP_441799.1_1 Forward -236 -222 11.307 0.0591
NP_441007.1_10 Reverse -230 -243 -0.570702 0.287
NP_442201.1_10 Reverse -212 -231 -3.73712 0.152
NP_440256.1_1 Forward -235 -216 6.19431 0.0314
NP_440256.1_1 Reverse -220 -239 3.44104 0.0523
NP_440256.1_1 Forward -397 -378 -1.27885 0.102
NP_440915.1_6 Reverse -219 -233 2.5562 0.115
NP_440915.1_6 Reverse -248 -262 1.67122 0.132
NP_440915.1_6 Forward -236 -222 -3.147 0.29
NP_441704.1_8 Forward -349 -330 6.39016 0.262
NP_441464.1_10 Forward -106 -92 11.406 0.22
NP_441464.1_10 Forward -105 -91 7.9644 0.287
NP_441113.1_3 Forward -204 -190 14.8469 0.27
NP_440695.1_5 Forward -244 -225 -1.57384 0.285
NP_440695.1_5 Reverse -223 -242 -1.67217 0.287
NP_441939.1_3 Reverse -224 -243 11.5042 0.112
NP_442993.1_1 Reverse -223 -239 9.59664 0.0182
NP_442386.1_9 Reverse -222 -231 15.7322 0.0144
NP_442386.1_9 Forward -233 -224 15.7322 0.0144
NP_441750.1_1 Forward -193 -174 -11.0136 0.3
NP_441340.1_5 Forward -231 -224 15.6737 0.0124
NP_441340.1_5 Reverse -224 -231 15.6737 0.0124
NP_441340.1_5 Forward -243 -236 4.07068 0.239
NP_440211.1_1 Forward -335 -316 17.7965 0.13
NP_440586.1_8 Forward -231 -224 13.2151 0.026
NP_440586.1_8 Reverse -224 -231 13.2151 0.026
NP_440586.1_8 Forward -243 -236 12.8218 0.0395
NP_440586.1_8 Forward -393 -386 9.28187 0.164
NP_440586.1_9 Reverse -55 -74 10.8159 0.258
NP_442251.1_6 Forward -231 -224 15.2804 0.0124
NP_442251.1_6 Reverse -224 -231 15.2804 0.0124
NP_441262.1_3 Reverse -223 -230 14.7888 0.0223
NP_441262.1_3 Forward -232 -225 14.7888 0.0223
NP_443051.1_1 Reverse -222 -231 10.4228 0.00754
NP_443051.1_1 Forward -233 -224 10.4228 0.00754
NP_443051.1_1 Forward -395 -386 -0.000272808 0.245
NP_441232.1_10 Forward -243 -224 4.62101 0.193
NP_439937.1_9 Forward -233 -216 -8.51661 0.176
NP_440408.1_7 Forward -282 -263 7.07928 0.292
NP_440626.1_1 Forward -231 -212 12.1917 0.204
NP_440439.1_1 Forward -235 -222 8.37742 0.0537
NP_440439.1_1 Reverse -220 -233 1.29759 0.157
NP_440372.1_2 Forward -231 -224 16.3621 0.0124
NP_440372.1_2 Reverse -224 -231 16.3621 0.0124
NP_440316.1_10 Reverse -129 -139 6.8632 0.251
NP_441803.1_2 Forward -237 -218 -0.4922 0.279
NP_439977.1_5 Forward -250 -231 3.34271 0.159
NP_440139.1_1 Forward -238 -219 14.4533 0.0484
NP_440139.1_1 Reverse -217 -236 8.16011 0.118
NP_441572.1_1 Reverse -221 -240 -1.27885 0.212
NP_442384.1_10 Forward -232 -219 15.0639 0.0117
NP_442384.1_10 Reverse -385 -398 14.6706 0.0138
NP_442262.1_10 Forward -231 -224 14.1988 0.0123
NP_442262.1_10 Reverse -224 -231 14.1988 0.0123
NP_442262.1_10 Forward -243 -236 10.3639 0.153
NP_441689.1_5 Forward -234 -224 8.53436 0.132
NP_442244.1_6 Reverse -266 -285 7.07928 0.225
NP_440163.1_10 Forward -235 -225 15.2213 0.0762
NP_440344.1_10 Forward -239 -222 18.2301 0.00262
NP_440344.1_10 Reverse -216 -233 -1.43612 0.0537
NP_440282.1_10 Forward -242 -223 -5.9004 0.25
NP_440531.1_6 Forward -192 -173 -3.44213 0.266
NP_442123.1_3 Reverse -223 -242 17.2074 0.0891
NP_441060.1_9 Forward -161 -142 23.6972 0.0413
NP_441965.1_10 Reverse -382 -398 10.8749 0.107
NP_440297.1_9 Reverse -224 -234 9.32148 0.0917
NP_440297.1_9 Forward -231 -221 -0.118297 0.282
NP_440297.1_9 Reverse -253 -263 -0.314959 0.282
NP_440350.1_2 Reverse -222 -241 6.78429 0.248
NP_440350.1_5 Reverse -2 -21 -5.60541 0.292
NP_442280.1_10 Reverse -350 -368 6.23363 0.28
NP_441103.1_9 Forward -135 -125 12.5872 0.291
NP_440894.1_2 Reverse -230 -249 0.196116 0.246
NP_440999.1_9 Reverse -248 -262 0.982901 0.172
NP_440888.1_2 Reverse -223 -237 15.4369 0.0107
NP_440888.1_2 Forward -232 -218 11.7003 0.0611
NP_440491.1_1 Forward -235 -216 9.4509 0.214
NP_440052.1_5 Reverse -212 -231 -3.93378 0.247
NP_442277.1_4 Forward -334 -315 10.1267 0.0959
NP_442077.1_8 Forward -320 -301 18.4848 0.0489
NP_441543.1_2 Forward -231 -222 18.486 0.00236
NP_441543.1_2 Reverse -224 -233 18.486 0.00236
NP_441543.1_2 Forward -393 -384 8.55452 0.0988
NP_441469.1_8 Reverse -222 -231 16.126 0.00797
NP_441469.1_8 Forward -233 -224 16.126 0.00797
NP_441469.1_8 Forward -262 -253 7.66954 0.227
NP_442578.1_7 Forward -231 -224 14.5921 0.026
NP_442578.1_7 Reverse -224 -231 14.5921 0.026
NP_441462.1_2 Forward -232 -222 11.5831 0.00406
NP_441462.1_2 Reverse -223 -233 11.5831 0.00406
NP_441621.1_7 Forward -234 -220 -3.54032 0.19
NP_441621.1_7 Reverse -221 -235 -3.83532 0.195
NP_443062.1_1 Reverse -223 -241 15.664 0.0359
NP_443062.1_1 Reverse -235 -253 11.7637 0.0936
NP_443062.1_1 Forward -232 -214 3.37804 0.3
NP_443062.1_6 Reverse -215 -234 3.6377 0.231
NP_440519.1_3 Reverse -241 -260 16.9124 0.092
NP_442204.1_2 Forward -242 -223 5.89931 0.292
NP_441560.1_10 Forward -336 -317 8.75091 0.239
NP_441560.1_10 Forward -332 -313 8.65258 0.239
NP_442537.1_3 Reverse -354 -373 13.6675 0.239
NP_440516.1_6 Reverse -354 -368 6.48882 0.293
NP_440516.1_8 Forward -232 -223 16.9127 0.00442
NP_440516.1_8 Reverse -223 -232 16.9127 0.00442
NP_441785.1_1 Reverse -223 -237 12.6414 0.244
NP_441033.1_2 Forward -242 -223 -8.26035 0.293
NP_442428.1_5 Forward -231 -224 15.8704 0.0124
NP_442428.1_5 Reverse -224 -231 15.8704 0.0124
NP_442428.1_5 Reverse -386 -393 11.4455 0.062
NP_442428.1_5 Reverse -236 -243 4.36568 0.271
NP_442120.1_10 Reverse -223 -242 -8.35868 0.234
NP_440673.1_3 Forward -230 -223 12.4288 0.0426
NP_440673.1_3 Reverse -225 -232 12.4288 0.0426
NP_441052.1_2 Forward -232 -222 10.5014 0.0285
NP_441052.1_2 Reverse -223 -233 10.5014 0.0285
NP_441052.1_2 Forward -394 -384 4.0116 0.168
NP_441052.1_2 Reverse -252 -262 1.94665 0.221
NP_441052.1_2 Forward -261 -251 1.16001 0.25
NP_442219.1_9 Forward -231 -222 8.35786 0.0681
NP_442219.1_9 Reverse -224 -233 8.35786 0.0681
NP_440436.1_4 Forward -231 -222 18.1905 0.00233
NP_440436.1_4 Reverse -224 -233 18.1905 0.00233
NP_441884.1_9 Forward -235 -216 -22.42 0.278
NP_441719.1_4 Forward -231 -224 16.3621 0.0124
NP_441719.1_4 Reverse -224 -231 16.3621 0.0124
NP_441733.1_10 Forward -235 -222 10.2457 0.106
NP_441733.1_10 Reverse -220 -233 7.39411 0.153
NP_442366.1_3 Reverse -222 -240 13.2938 0.0265
NP_442366.1_3 Forward -233 -215 -1.35749 0.211
NP_442366.1_5 Reverse -220 -230 13.3526 0.0775
NP_440129.1_10 Forward -239 -225 3.8345 0.189
NP_440296.1_10 Reverse -313 -332 -4.42544 0.209
NP_440296.1_10 Forward -264 -245 -14.9469 0.279
NP_441115.1_4 Forward -233 -215 18.2096 0.0152
NP_442854.1_7 Reverse -227 -246 10.3242 0.116
NP_440328.1_4 Reverse -379 -398 3.14605 0.186
NP_443054.1_2 Forward -234 -220 11.3077 0.0761
NP_443054.1_2 Reverse -221 -235 3.53951 0.24
NP_441851.1_10 Forward -233 -223 16.008 0.00552
NP_441851.1_10 Reverse -222 -232 16.008 0.00552
NP_441851.1_10 Reverse -234 -244 4.10993 0.287
NP_442011.1_1 Forward -233 -214 -2.75381 0.282
NP_440593.1_9 Forward -80 -66 11.996 0.24
NP_441349.1_10 Forward -242 -223 -9.63698 0.297
NP_440474.1_8 Reverse -224 -238 16.6169 0.0481
NP_440474.1_8 Forward -231 -217 7.96378 0.196
NP_440474.1_8 Reverse -236 -250 5.40719 0.25
NP_441124.1_5 Forward -47 -37 10.5254 0.286
NP_442450.1_5 Forward -234 -224 9.32148 0.115
NP_442450.1_5 Reverse -221 -231 7.55152 0.13
NP_440195.1_5 Forward -238 -219 4.12936 0.273
NP_441003.1_9 Reverse -243 -262 13.9625 0.213
NP_441570.1_1 Reverse -223 -241 -0.669169 0.0498
NP_441078.1_4 Forward -232 -223 19.6659 0.0007
NP_441078.1_4 Reverse -223 -232 19.6659 0.0007
NP_441078.1_4 Forward -261 -252 -1.47524 0.266
NP_441078.1_4 Reverse -252 -261 -1.77023 0.266
NP_441663.1_7 Reverse -220 -239 8.45592 0.209
NP_440526.1_3 Forward -243 -232 6.94134 0.172
NP_440526.1_3 Reverse -224 -235 1.92649 0.267
NP_441432.1_8 Reverse -222 -231 8.25953 0.0755
NP_441432.1_8 Forward -233 -224 8.25953 0.0755
NP_441432.1_8 Forward -395 -386 5.89959 0.13
NP_442320.1_8 Forward -238 -224 15.1426 0.011
NP_442320.1_8 Reverse -217 -231 -3.24533 0.113
NP_442344.1_7 Forward -231 -212 2.16274 0.0644
NP_442344.1_7 Reverse -224 -243 0.786102 0.0908
NP_442797.1_7 Forward -233 -215 0.904127 0.271
NP_440199.1_10 Forward -235 -225 14.533 0.0861
NP_441057.1_3 Forward -127 -108 -9.93197 0.205
NP_442353.1_4 Reverse -19 -38 0.490334 0.268
NP_442353.1_4 Reverse -361 -380 -0.787962 0.291
NP_440713.1_4 Reverse -225 -244 4.81767 0.222
NP_440713.1_4 Forward -230 -211 1.37609 0.287
NP_442489.1_2 Forward -243 -224 15.5357 0.126
NP_442489.1_7 Forward -232 -223 20.1576 0.000695
NP_442489.1_7 Reverse -223 -232 20.1576 0.000695
NP_442489.1_7 Forward -261 -252 -1.6719 0.235
NP_442489.1_7 Reverse -385 -394 -1.6719 0.235
NP_442489.1_7 Reverse -252 -261 -1.77023 0.247
NP_442079.1_7 Reverse -236 -255 21.2389 0.0744
NP_442079.1_7 Reverse -224 -243 4.12936 0.198
NP_440559.1_1 Reverse -224 -233 8.75118 0.0586
NP_440559.1_1 Forward -231 -222 8.75118 0.0586
NP_441659.2_8 Forward -232 -222 11.9764 0.0147
NP_441659.2_8 Reverse -223 -233 11.9764 0.0147
NP_441659.2_8 Forward -244 -234 0.963343 0.254
NP_441022.1_1 Forward -86 -77 12.5054 0.232
NP_442913.1_10 Reverse -243 -262 -4.32711 0.234
NP_442913.1_10 Reverse -376 -395 -5.80207 0.279
NP_441040.1_5 Reverse -218 -237 5.89931 0.229
NP_440779.1_5 Reverse -252 -269 -14.7108 0.269
NP_440779.1_5 Reverse -223 -240 -14.8091 0.274
NP_442346.1_2 Forward -255 -236 6.19431 0.281
NP_442346.1_5 Forward -262 -252 12.6647 0.0375
NP_442346.1_5 Forward -395 -385 11.2881 0.0706
NP_442346.1_5 Reverse -251 -261 9.91146 0.114
NP_442346.1_5 Reverse -384 -394 9.32148 0.118
NP_442346.1_5 Forward -233 -223 9.02648 0.118
NP_442346.1_5 Reverse -222 -232 9.02648 0.118
NP_440545.1_3 Forward -265 -248 3.38209 0.0847
NP_440545.1_3 Reverse -312 -329 -3.8944 0.214
NP_440545.1_3 Reverse -248 -265 -4.38605 0.224
NP_441653.1_2 Forward -243 -224 11.5502 0.111
NP_440847.1_3 Forward -138 -124 10.5204 0.291
NP_442603.1_9 Reverse -245 -263 4.14905 0.293
NP_441585.1_5 Forward -156 -137 -1.18128 0.298
NP_440449.1_6 Reverse -244 -262 10.0066 0.164
NP_441948.1_4 Reverse -216 -234 15.1621 0.0267
NP_441948.1_4 Forward -239 -221 6.60732 0.0633
NP_441833.1_4 Forward -231 -224 15.9687 0.0124
NP_441833.1_4 Reverse -224 -231 15.9687 0.0124
NP_442162.1_9 Forward -231 -224 16.2637 0.0124
NP_442162.1_9 Reverse -224 -231 16.2637 0.0124
NP_440671.1_4 Forward -238 -224 9.14437 0.184
NP_440671.1_4 Forward -334 -320 7.27608 0.222
NP_442045.1_5 Forward -241 -222 -2.0655 0.292
NP_442199.1_5 Forward -240 -221 26.6471 0.0029
NP_442199.1_5 Reverse -227 -246 -3.44213 0.206
NP_442140.1_3 Forward -231 -221 16.2046 0.0255
NP_442140.1_3 Reverse -224 -234 8.33817 0.119
NP_442723.1_1 Forward -147 -128 12.29 0.238
NP_441609.1_1 Reverse -152 -171 9.43923 0.12
NP_441609.1_1 Forward -168 -149 7.86593 0.152
NP_440875.1_9 Reverse -387 -397 12.2655 0.127
NP_440875.1_9 Reverse -225 -235 8.37203 0.233
NP_441813.1_5 Forward -234 -224 17.188 0.00979
NP_441813.1_5 Reverse -221 -231 9.91146 0.021
NP_441813.1_9 Forward -42 -23 12.5858 0.256
NP_440594.1_8 Reverse -236 -249 9.5568 0.186
NP_442089.1_1 Forward -235 -216 7.57094 0.123
NP_442089.1_1 Reverse -220 -239 0.786102 0.252
NP_440590.1_4 Forward -231 -218 8.47575 0.0446
NP_440590.1_4 Reverse -224 -237 3.26421 0.0749
NP_440567.1_1 Forward -231 -217 16.1259 0.0166
NP_440567.1_1 Reverse -224 -238 8.65272 0.0554
NP_442497.1_10 Forward -231 -222 10.4228 0.0087
NP_442497.1_10 Reverse -224 -233 10.4228 0.0087
NP_440821.1_4 Forward -234 -224 19.0562 0.00399
NP_440821.1_4 Reverse -221 -231 10.2065 0.0163
NP_441239.1_5 Reverse -308 -327 18.0953 0.264
NP_441239.1_9 Forward -234 -222 15.8703 0.0178
NP_441239.1_9 Reverse -221 -233 14.887 0.0247
NP_441239.1_9 Reverse -250 -262 8.88877 0.12
NP_441239.1_9 Forward -263 -251 4.8572 0.239
NP_442568.1_8 Reverse -25 -39 9.14437 0.26
NP_441727.1_3 Reverse -228 -247 8.25926 0.213
NP_441892.1_1 Forward -241 -224 -2.22277 0.219
NP_441892.1_1 Forward -253 -236 -5.1727 0.275
NP_440863.1_1 Reverse -128 -142 15.0642 0.236
NP_440354.1_7 Reverse -217 -235 11.2289 0.224
NP_440354.1_7 Forward -238 -220 11.0322 0.224
NP_442138.1_10 Reverse -223 -242 -7.67036 0.29
NP_440546.1_4 Forward -232 -222 11.8882 0.0679
NP_440546.1_4 Reverse -223 -233 11.8882 0.0679
NP_441230.1_5 Reverse -267 -286 4.12936 0.188
NP_441230.1_5 Reverse -255 -274 1.67108 0.238
NP_440462.1_6 Forward -234 -224 15.418 0.0142
NP_440462.1_6 Reverse -221 -231 9.02648 0.0498
NP_440462.1_6 Forward -246 -236 5.68323 0.145
NP_441184.1_3 Reverse -177 -196 5.80098 0.249
NP_440868.1_4 Reverse -219 -231 8.6921 0.0582
NP_440868.1_4 Forward -236 -224 8.49544 0.0602
NP_442479.1_9 Reverse -150 -169 -6.68705 0.266
NP_442402.1_4 Forward -155 -136 -8.35941 0.281
NP_440653.1_10 Forward -231 -212 10.4225 0.151
NP_440653.1_10 Forward -243 -224 7.66927 0.201
NP_442882.1_7 Reverse -216 -230 18.4851 0.24
NP_442039.1_4 Forward -231 -224 15.1821 0.0124
NP_442039.1_4 Reverse -224 -231 15.1821 0.0124
NP_441811.1_4 Forward -234 -215 6.58763 0.178
NP_440825.1_7 Forward -231 -221 12.4217 0.155
NP_442837.1_3 Forward -231 -224 15.7721 0.0124
NP_442837.1_3 Reverse -224 -231 15.7721 0.0124
NP_442053.1_1 Forward -232 -223 18.3876 0.0007
NP_442053.1_1 Reverse -223 -232 18.3876 0.0007
NP_440505.1_3 Forward -234 -224 13.8447 0.0247
NP_440505.1_3 Reverse -221 -231 6.76487 0.169
NP_442360.1_5 Forward -209 -199 14.1397 0.242
NP_441408.2_7 Forward -246 -227 -4.52377 0.281
NP_440914.1_1 Forward -232 -222 8.6151 0.186
NP_440914.1_1 Reverse -223 -233 8.6151 0.186
NP_441011.1_8 Forward -231 -222 16.9127 0.00602
NP_441011.1_8 Reverse -224 -233 16.9127 0.00602
NP_441011.1_8 Reverse -386 -395 10.3245 0.108
NP_442533.1_6 Forward -232 -223 17.2076 0.00137
NP_442533.1_6 Reverse -223 -232 17.2076 0.00137
NP_442533.1_6 Forward -261 -252 13.9627 0.0155
NP_442533.1_6 Forward -394 -385 12.8811 0.0253
NP_442533.1_6 Reverse -252 -261 6.68623 0.105
NP_442533.1_6 Forward -325 -316 3.24465 0.219
NP_442229.1_1 Reverse -221 -235 10.8154 0.18
NP_441482.1_7 Forward -238 -224 -9.04686 0.193
NP_439944.1_9 Reverse -224 -234 10.3048 0.0887
NP_441028.1_6 Forward -305 -295 5.09279 0.267
NP_441028.1_6 Forward -349 -339 4.30615 0.278
NP_440116.1_5 Forward -228 -211 5.05372 0.176
NP_441527.1_7 Forward -144 -125 10.815 0.282
NP_440007.1_4 Forward -243 -224 12.4875 0.22
NP_440007.1_9 Reverse -149 -163 6.48943 0.223
NP_439965.1_1 Reverse -214 -233 -9.93197 0.3
NP_441170.1_4 Reverse -214 -232 6.50899 0.205
NP_441972.1_5 Reverse -224 -243 -3.83545 0.201
NP_441972.1_5 Forward -243 -224 -4.42544 0.211
NP_441972.1_5 Forward -260 -241 -8.45701 0.265
NP_441106.1_1 Reverse -222 -231 18.191 0.0028
NP_441106.1_1 Forward -233 -224 18.191 0.0028
NP_440429.1_2 Forward -343 -324 14.0608 0.176
NP_442306.1_10 Reverse -218 -237 -20.945 0.237
NP_441286.1_1 Reverse -222 -234 4.95553 0.027
NP_441286.1_1 Forward -233 -221 -3.50094 0.145
NP_440092.1_9 Reverse -248 -267 20.7473 0.149
NP_440670.1_8 Forward -232 -223 18.3876 0.000699
NP_440670.1_8 Reverse -223 -232 18.3876 0.000699
NP_440670.1_8 Forward -225 -216 4.0313 0.207
NP_440886.1_7 Forward -233 -223 17.7774 0.0011
NP_440886.1_7 Reverse -222 -232 17.7774 0.0011
NP_442072.1_9 Forward -233 -215 -12.2722 0.0831
NP_442072.1_9 Reverse -222 -240 -22.007 0.216
NP_440907.2_8 Forward -231 -221 14.2375 0.0312
NP_440907.2_8 Reverse -224 -234 7.84605 0.117
NP_441021.1_1 Forward -243 -224 -3.14714 0.153
NP_441021.1_1 Reverse -224 -243 -5.70374 0.177
NP_441021.1_8 Reverse -218 -236 10.8356 0.122
NP_441021.1_8 Forward -237 -219 1.10079 0.281
NP_441463.1_3 Forward -242 -223 27.7288 0.000659
NP_441463.1_3 Reverse -213 -232 1.0811 0.128
NP_441463.1_3 Reverse -225 -244 -3.63879 0.181
NP_441463.1_5 Forward -395 -381 20.4524 0.188
NP_441463.1_7 Forward -292 -273 17.699 0.16
NP_441463.1_8 Forward -92 -73 21.4356 0.0882
NP_441626.1_2 Forward -231 -224 15.7721 0.0124
NP_441626.1_2 Reverse -224 -231 15.7721 0.0124
NP_442794.1_1 Forward -242 -230 4.75886 0.249
NP_442615.1_1 Reverse -214 -232 18.2104 0.00559
NP_442615.1_1 Forward -241 -223 7.68896 0.0306
NP_441962.1_4 Forward -266 -247 -14.5535 0.29
NP_440387.1_1 Forward -232 -216 7.33503 0.0282
NP_440387.1_1 Reverse -223 -239 -2.10475 0.146
NP_441431.1_2 Forward -235 -221 9.93039 0.172
NP_441836.1_2 Forward -250 -231 6.4893 0.115
NP_440467.1_3 Forward -243 -224 11.6469 0.268
NP_440114.1_10 Reverse -223 -237 17.8958 0.00824
NP_440114.1_10 Forward -232 -218 10.4227 0.148
NP_442437.1_8 Forward -243 -224 10.4225 0.187
NP_440287.1_5 Forward -147 -128 9.24175 0.286
NP_440766.1_4 Forward -236 -222 8.35772 0.0871
NP_439988.1_7 Forward -230 -216 13.6669 0.292
NP_441237.1_9 Forward -243 -233 12.0747 0.139
NP_441311.1_2 Reverse -217 -231 13.2736 0.23
NP_439910.1_2 Forward -240 -223 -2.3211 0.0305
NP_440457.1_1 Reverse -219 -231 0.825626 0.25
NP_440457.1_1 Forward -236 -224 0.0389777 0.25
NP_440798.1_6 Forward -231 -218 14.6706 0.0423
NP_440798.1_6 Reverse -217 -230 3.06754 0.153
NP_441981.1_3 Reverse -370 -384 16.9373 0.268
NP_441332.1_4 Reverse -24 -43 8.65258 0.234
NP_442509.1_9 Forward -232 -222 16.2041 0.00739
NP_442509.1_9 Reverse -223 -233 16.2041 0.00739
NP_441489.1_3 Reverse -28 -42 9.17885 0.232
NP_443037.1_8 Forward -112 -93 8.65258 0.242
NP_440554.1_4 Reverse -224 -234 14.6313 0.02
NP_440554.1_4 Forward -231 -221 7.35486 0.103
NP_442862.1_3 Reverse -153 -170 8.88863 0.236
NP_441885.1_5 Forward -232 -222 11.4848 0.00668
NP_441885.1_5 Reverse -223 -233 11.4848 0.00668
NP_441885.1_5 Forward -394 -384 0.963343 0.116
NP_440478.1_4 Forward -273 -254 10.6192 0.273
NP_442341.1_7 Reverse -222 -236 10.0294 0.0682
NP_442341.1_7 Forward -233 -219 9.34103 0.0751
NP_442341.1_9 Forward -327 -313 8.84875 0.164
NP_442341.1_9 Reverse -221 -235 7.76712 0.187
NP_441756.1_5 Reverse -54 -73 -3.93378 0.29
NP_443000.1_7 Forward -234 -224 8.73149 0.0437
NP_443000.1_7 Forward -396 -386 7.64985 0.0734
NP_443000.1_7 Reverse -383 -393 6.66654 0.119
NP_443000.1_7 Reverse -221 -231 1.94665 0.226
NP_440507.2_3 Forward -241 -222 13.8633 0.144
NP_441842.1_10 Reverse -216 -230 16.6175 0.0301
NP_441842.1_10 Forward -239 -225 16.6175 0.0301
NP_440275.1_3 Forward -234 -224 8.4365 0.0602
NP_440275.1_3 Reverse -221 -231 8.33817 0.0602
NP_440560.1_5 Forward -204 -185 10.679 0.259
NP_440560.1_7 Forward -46 -27 4.52188 0.292
NP_440091.1_1 Forward -236 -224 18.3285 0.0114
NP_440091.1_1 Reverse -219 -231 3.2839 0.163
NP_441902.1_3 Reverse -368 -378 12.7873 0.235
NP_443010.1_10 Forward -150 -133 1.80445 0.295
NP_441122.1_1 Reverse -331 -346 3.71647 0.28
NP_442495.1_4 Reverse -389 -399 13.648 0.187
NP_442495.1_4 Forward -289 -279 12.2714 0.235
NP_442149.1_4 Forward -77 -58 11.4058 0.251
NP_440149.1_8 Reverse -223 -242 3.93269 0.0884
NP_440149.1_8 Forward -238 -219 -3.3438 0.187
NP_442127.1_4 Forward -88 -69 7.96426 0.17
NP_440216.1_1 Forward -232 -218 16.5192 0.00277
NP_440216.1_1 Reverse -223 -237 6.29277 0.0156
NP_440216.1_1 Forward -394 -380 -11.3085 0.178
NP_440216.1_1 Reverse -385 -399 -12.1934 0.247
NP_440172.1_1 Forward -232 -222 8.73149 0.0586
NP_440172.1_1 Reverse -223 -233 8.73149 0.0586
NP_440172.1_1 Forward -394 -384 4.79825 0.166
NP_440172.1_1 Forward -261 -251 2.33998 0.279
NP_442015.1_10 Reverse -219 -232 1.78924 0.204
NP_442015.1_10 Forward -236 -223 0.904263 0.216
NP_442015.1_10 Reverse -381 -394 -0.275709 0.259
NP_441226.1_7 Forward -231 -224 14.4934 0.0123
NP_441226.1_7 Reverse -224 -231 14.4934 0.0123
NP_441226.1_7 Forward -224 -217 6.82361 0.246
NP_441111.1_7 Forward -231 -223 18.7023 0.00294
NP_441111.1_7 Reverse -224 -232 18.7023 0.00294
NP_441766.1_2 Forward -232 -223 17.5026 0.00297
NP_441766.1_2 Reverse -223 -232 17.5026 0.00297
NP_442417.1_5 Forward -232 -218 8.75105 0.147
NP_442252.1_3 Forward -239 -221 17.6204 0.0602
NP_440416.1_9 Reverse -216 -235 0.392778 0.0527
NP_440416.1_9 Forward -239 -220 -4.52377 0.0776
NP_443052.1_8 Forward -242 -223 -0.885524 0.075
NP_443052.1_8 Forward -271 -252 -3.54046 0.103
NP_440845.1_1 Forward -263 -244 3.6377 0.156
NP_442403.1_8 Reverse -225 -244 0.982764 0.241
NP_440261.1_5 Reverse -386 -399 4.73917 0.0532
NP_440261.1_5 Forward -231 -218 -10.4038 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTCCAGGCCATCACTAGCTGTTTTTTGCCCTACGAAGACCAAGGAGTACGTTTTCATCTATTGCAAACCAGGCAGGCCGGCTCCCAGTCTTTTATTTCCTTCCATGTCCTAGTGCCTGGACATTGGACTGTGCAACGGGGCCATGACCTCTGTGAAGCCATCGAAACGGCGATCGCCGAACGGATTACTGGCTCTAGGGTAACCACCCATTTGGAGCCCCTGGAAGACCCTAAATCTTGGCAACATCCTGACGAGTTTCCCCCCTCTGCCCCTTTAAACCGGGATAAGCCCAATTAGGTTTTGGGGTATCATGCAAAAACTTGGCTCCGGCAGATTCCGGCTCCGGGTAGCATAACAAACTTTTTTGTCATTTACGACAACAGGAGAACTTTAAAAAAT

CDS

ATGAACAACTATACTAAAGACGATGATGGACGGCTGAATAATTTTGCCGTTGAACCCAAGATCTATGCGGCCGATGCTCCCAGTAAAGCCGACAAACGAAATTATTTGATTATGGCGGCCATTACCGTTGTGCTGGTGGCGGGGCTGATTGCGGTGGCTGTGGTAGCTTCCGGGGCTAGCACCTAA

Protein

MNNYTKDDDGRLNNFAVEPKIYAADAPSKADKRNYLIMAAITVVLVAGLIAVAVVASGAST