Your browser is old and dusty. Try Google Chrome!

Details for ssl1464

ORF ssl1464
Accession NP_442642.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -117 -103 10.0294 0.0651
NP_441061.1_2 Reverse -110 -124 3.63784 0.161
NP_440795.1_7 Forward -117 -110 14.6904 0.0123
NP_440795.1_7 Reverse -110 -117 14.6904 0.0123
NP_441418.1_6 Reverse -109 -128 -21.83 0.16
NP_441418.1_6 Forward -118 -99 -30.0898 0.256
NP_440815.1_5 Forward -41 -22 3.24438 0.286
NP_441453.1_4 Reverse -109 -117 16.539 0.00633
NP_441453.1_4 Forward -118 -110 16.539 0.00633
NP_441453.1_4 Reverse -215 -223 4.24765 0.259
NP_442151.1_6 Reverse -109 -123 16.3225 0.0158
NP_442151.1_6 Forward -118 -104 9.04604 0.159
NP_441818.1_9 Forward -342 -323 -3.54046 0.227
NP_440226.1_1 Forward -224 -205 4.916 0.174
NP_440226.1_1 Reverse -109 -128 4.81767 0.178
NP_442173.1_1 Forward -117 -109 15.4574 0.00633
NP_442173.1_1 Reverse -110 -118 15.4574 0.00633
NP_442752.1_4 Forward -118 -111 13.8055 0.0199
NP_442752.1_4 Reverse -109 -116 13.8055 0.0199
NP_443027.1_4 Forward -120 -110 15.3197 0.0437
NP_443027.1_4 Reverse -107 -117 13.1564 0.0521
NP_443027.1_4 Forward -389 -379 10.1081 0.144
NP_443027.1_4 Reverse -250 -260 6.76487 0.269
NP_441812.1_3 Reverse -108 -122 9.14437 0.245
NP_442975.1_10 Forward -122 -108 20.6484 0.00165
NP_440784.1_7 Forward -117 -110 15.9687 0.0123
NP_440784.1_7 Reverse -110 -117 15.9687 0.0123
NP_440061.1_9 Forward -120 -106 10.5204 0.124
NP_440110.1_4 Reverse -98 -117 9.63589 0.125
NP_441054.1_1 Forward -125 -111 13.3726 0.274
NP_441054.1_2 Reverse -22 -41 17.2074 0.113
NP_441476.1_5 Forward -123 -104 -2.95047 0.231
NP_440878.1_9 Reverse -99 -118 3.73603 0.174
NP_442062.1_8 Forward -118 -108 17.3846 0.00193
NP_442062.1_8 Reverse -109 -119 10.3048 0.0493
NP_442062.1_8 Reverse -215 -225 2.83163 0.293
NP_441859.1_3 Reverse -108 -127 9.43841 0.129
NP_441859.1_3 Forward -225 -206 4.12856 0.228
NP_440304.1_4 Forward -120 -110 18.9579 0.00406
NP_440304.1_4 Reverse -107 -117 9.91146 0.051
NP_440304.1_4 Forward -226 -216 6.96153 0.137
NP_442242.1_4 Forward -117 -110 14.3954 0.0124
NP_442242.1_4 Reverse -110 -117 14.3954 0.0124
NP_440044.1_8 Reverse -110 -129 4.71934 0.11
NP_440044.1_8 Forward -117 -98 1.57275 0.17
NP_441208.1_9 Reverse -106 -120 18.2892 0.0647
NP_441208.1_9 Forward -121 -107 6.6861 0.234
NP_441594.1_6 Forward -127 -108 11.3075 0.116
NP_442276.1_2 Reverse -97 -116 5.11266 0.295
NP_442110.1_7 Reverse -109 -123 18.9775 0.0138
NP_442110.1_7 Forward -118 -104 -0.492064 0.291
NP_441083.1_5 Forward -118 -108 20.3345 0.00053
NP_441083.1_5 Reverse -109 -119 11.2881 0.0159
NP_442827.1_8 Forward -126 -107 -3.14789 0.298
NP_441738.1_2 Forward -116 -109 15.28 0.0102
NP_441738.1_2 Reverse -111 -118 15.28 0.0102
NP_441738.1_2 Reverse -380 -387 6.03696 0.295
NP_441558.1_5 Reverse -107 -126 13.9625 0.0531
NP_441558.1_5 Reverse -213 -232 7.96426 0.166
NP_440209.1_1 Reverse -109 -117 18.1123 0.00295
NP_440209.1_1 Forward -118 -110 18.1123 0.00295
NP_442889.1_8 Forward -121 -107 9.6354 0.0952
NP_441713.1_1 Reverse -103 -122 -2.65548 0.113
NP_441713.1_3 Reverse -246 -265 4.32602 0.256
NP_441713.1_5 Forward -116 -97 12.5858 0.211
NP_441770.1_5 Reverse -201 -220 -2.45882 0.296
NP_440178.1_7 Forward -184 -165 -12.0953 0.112
NP_440178.1_7 Reverse -108 -127 -12.4886 0.121
NP_442570.1_3 Forward -33 -14 -9.34199 0.298
NP_441716.1_1 Forward -118 -104 8.84938 0.13
NP_442111.1_4 Reverse -108 -122 13.2743 0.0394
NP_442111.1_4 Forward -119 -105 1.86788 0.293
NP_440906.1_5 Forward -117 -110 15.8704 0.0124
NP_440906.1_5 Reverse -110 -117 15.8704 0.0124
NP_440747.1_10 Reverse -106 -118 17.2469 0.000522
NP_440747.1_10 Forward -121 -109 -1.92764 0.0192
NP_441130.1_10 Reverse -107 -121 14.9459 0.0387
NP_441486.1_1 Forward -121 -107 -3.04867 0.175
NP_442634.1_4 Forward -120 -106 14.0609 0.0209
NP_442634.1_4 Reverse -107 -121 4.52282 0.0764
NP_442634.1_4 Reverse -245 -259 -5.60527 0.264
NP_442848.1_1 Forward -124 -110 14.6509 0.0189
NP_442848.1_1 Reverse -103 -117 -2.16369 0.263
NP_443018.1_3 Forward -117 -110 14.8871 0.0123
NP_443018.1_3 Reverse -110 -117 14.8871 0.0123
NP_443018.1_3 Reverse -216 -223 10.7572 0.0907
NP_443018.1_3 Forward -223 -216 4.56234 0.241
NP_441316.1_7 Forward -120 -105 12.4679 0.0549
NP_441634.1_8 Reverse -107 -121 5.21113 0.114
NP_441634.1_8 Reverse -169 -183 -2.26202 0.295
NP_441643.1_3 Reverse -363 -382 8.75091 0.255
NP_440376.1_1 Forward -118 -109 19.4693 0.000692
NP_440376.1_1 Reverse -109 -118 19.4693 0.000692
NP_441588.1_4 Reverse -111 -121 6.66654 0.185
NP_442687.1_7 Forward -119 -109 9.02648 0.0994
NP_442687.1_7 Reverse -108 -118 8.92815 0.0994
NP_442687.1_7 Forward -275 -265 4.50326 0.245
NP_442191.1_4 Reverse -110 -124 12.7383 0.192
NP_442958.1_3 Reverse -98 -117 9.63589 0.142
NP_441422.1_7 Reverse -107 -124 -2.22277 0.21
NP_442658.1_1 Forward -120 -110 15.9091 0.00966
NP_442658.1_1 Forward -226 -216 10.5993 0.114
NP_442658.1_1 Reverse -107 -117 9.616 0.147
NP_442658.1_1 Reverse -172 -182 6.0761 0.238
NP_440528.1_1 Forward -230 -217 15.8793 0.26
NP_442205.1_9 Forward -124 -108 6.05672 0.119
NP_441414.1_9 Forward -118 -99 -3.04881 0.128
NP_441414.1_9 Reverse -247 -266 -10.7186 0.293
NP_442937.1_5 Forward -123 -104 8.94757 0.205
NP_442937.1_5 Reverse -104 -123 6.09597 0.288
NP_441958.1_5 Forward -119 -109 21.2195 0.000805
NP_441958.1_5 Reverse -108 -118 12.2714 0.00183
NP_441958.1_5 Forward -225 -215 0.471689 0.143
NP_440203.1_5 Forward -115 -105 11.1893 0.202
NP_439905.1_1 Reverse -216 -229 6.31247 0.293
NP_440984.1_7 Reverse -104 -118 10.3243 0.126
NP_439990.1_5 Reverse -104 -117 9.75405 0.133
NP_439990.1_5 Forward -123 -110 8.67241 0.166
NP_439990.1_5 Reverse -210 -223 5.82081 0.272
NP_442911.1_2 Reverse -99 -118 6.19431 0.03
NP_442911.1_2 Forward -128 -109 -1.67217 0.0886
NP_441580.1_6 Forward -129 -110 -8.06369 0.252
NP_440153.1_5 Reverse -110 -124 4.22782 0.199
NP_442051.1_1 Reverse -220 -239 9.63589 0.24
NP_440993.1_2 Forward -123 -107 12.8416 0.0675
NP_440993.1_2 Reverse -104 -120 3.79511 0.256
NP_441099.1_5 Reverse -99 -118 -9.73531 0.231
NP_442567.1_4 Forward -100 -81 15.0441 0.24
NP_441294.1_7 Forward -122 -108 15.4899 0.0239
NP_441646.1_1 Forward -125 -106 -0.688862 0.271
NP_441646.1_1 Reverse -102 -121 -1.27885 0.281
NP_442438.1_10 Forward -123 -109 9.43936 0.0637
NP_442438.1_10 Reverse -104 -118 3.44117 0.162
NP_442885.1_5 Reverse -111 -130 15.1416 0.236
NP_440147.1_4 Forward -120 -107 13.0973 0.0326
NP_440147.1_4 Reverse -107 -120 10.934 0.0346
NP_440147.1_4 Forward -226 -213 7.98409 0.0579
NP_441175.1_2 Reverse -94 -113 7.86593 0.226
NP_441175.1_7 Forward -163 -144 9.0459 0.192
NP_441550.1_8 Forward -120 -110 17.4824 0.00754
NP_441550.1_8 Reverse -107 -117 16.7941 0.00906
NP_441916.1_7 Reverse -109 -119 18.9579 0.00144
NP_441916.1_7 Forward -118 -108 10.3048 0.0261
NP_441916.1_10 Forward -126 -107 2.0644 0.253
NP_440465.1_10 Forward -121 -102 0.196116 0.29
NP_441041.1_4 Reverse -109 -128 -2.26216 0.109
NP_441041.1_7 Forward -121 -109 18.3015 0.00558
NP_441041.1_7 Reverse -106 -118 9.1668 0.12
NP_442642.1_1 Forward -262 -244 20.472 0.065
NP_442642.1_2 Forward -203 -184 23.6972 0.0402
NP_442642.1_3 Forward -336 -318 20.8653 0.2
NP_442642.1_4 Forward -66 -47 22.7139 0.0272
NP_442642.1_9 Forward -125 -108 25.1132 0.0149
NP_442004.1_6 Reverse -109 -123 7.17775 0.165
NP_442004.1_6 Forward -118 -104 4.71948 0.204
NP_441725.1_4 Forward -123 -109 3.14559 0.279
NP_441725.1_5 Forward -117 -107 9.02648 0.0553
NP_441725.1_5 Reverse -110 -120 8.92815 0.0553
NP_439966.1_7 Reverse -107 -117 14.8275 0.0177
NP_439966.1_7 Forward -120 -110 13.8442 0.0234
NP_439966.1_9 Forward -120 -111 0.983037 0.253
NP_439966.1_9 Reverse -107 -116 0.884706 0.253
NP_442941.1_3 Forward -117 -107 10.9931 0.0116
NP_442941.1_3 Reverse -110 -120 10.9931 0.0116
NP_440289.1_2 Forward -121 -108 11.7207 0.018
NP_440289.1_2 Reverse -106 -119 -4.7006 0.294
NP_440983.1_5 Forward -169 -150 -4.6221 0.26
NP_440983.1_9 Reverse -258 -277 4.81767 0.285
NP_442281.1_1 Reverse -104 -118 15.0436 0.0144
NP_442281.1_1 Forward -123 -109 13.5686 0.0256
NP_441334.1_7 Forward -258 -239 -13.1769 0.194
NP_441334.1_7 Reverse -107 -126 -18.5851 0.275
NP_441334.1_7 Forward -120 -101 -19.2734 0.275
NP_440437.1_1 Forward -124 -105 -1.08219 0.194
NP_440647.1_9 Reverse -245 -263 7.19731 0.219
NP_442012.1_1 Reverse -103 -122 10.6192 0.079
NP_441644.1_6 Reverse -109 -119 19.0557 0.000803
NP_441644.1_6 Forward -118 -108 17.3841 0.00127
NP_441644.1_6 Reverse -215 -225 10.9926 0.058
NP_442215.1_2 Reverse -107 -123 -2.79306 0.204
NP_440253.1_2 Forward -224 -206 7.4923 0.0692
NP_440253.1_2 Reverse -109 -127 3.16574 0.122
NP_440253.1_2 Forward -118 -100 -1.84914 0.252
NP_440929.1_8 Forward -118 -109 19.2726 0.000701
NP_440929.1_8 Reverse -109 -118 19.2726 0.000701
NP_442933.1_10 Forward -118 -109 17.601 0.00325
NP_442933.1_10 Reverse -109 -118 17.601 0.00325
NP_442933.1_10 Forward -224 -215 4.52295 0.24
NP_441751.2_8 Forward -117 -103 13.7659 0.015
NP_441751.2_8 Reverse -110 -124 2.85119 0.0759
NP_442554.1_8 Reverse -110 -120 19.1546 0.00369
NP_442554.1_8 Forward -117 -107 18.0729 0.00543
NP_442554.1_8 Reverse -216 -226 6.07655 0.126
NP_442554.1_8 Reverse -248 -258 2.92996 0.249
NP_441762.1_7 Forward -119 -107 2.79224 0.0676
NP_441762.1_7 Reverse -108 -120 2.59558 0.0676
NP_442142.1_4 Reverse -106 -119 14.08 0.0317
NP_442142.1_4 Forward -121 -108 11.6217 0.054
NP_442142.1_4 Reverse -212 -225 2.18201 0.299
NP_442292.1_1 Forward -117 -108 18.486 0.00229
NP_442292.1_1 Reverse -110 -119 17.5026 0.00435
NP_442292.1_1 Reverse -216 -225 4.71961 0.172
NP_442476.1_6 Forward -117 -103 19.5675 0.0268
NP_442381.1_8 Forward -121 -102 -6.09707 0.152
NP_443009.1_5 Reverse -108 -119 14.5128 0.02
NP_443009.1_5 Forward -119 -108 10.1862 0.0792
NP_443009.1_5 Reverse -214 -225 4.48308 0.244
NP_441715.1_4 Forward -117 -107 7.84651 0.107
NP_441715.1_4 Reverse -110 -120 7.25653 0.108
NP_440881.1_10 Forward -117 -104 13.4906 0.249
NP_440279.1_2 Reverse -98 -117 15.2408 0.0671
NP_441198.1_8 Forward -120 -110 15.4199 0.0427
NP_441198.1_8 Forward -226 -216 10.8298 0.239
NP_441468.1_1 Forward -117 -110 15.8704 0.0124
NP_441468.1_1 Reverse -110 -117 15.8704 0.0124
NP_441468.1_1 Forward -223 -216 4.07068 0.263
NP_441020.2_6 Reverse -107 -124 13.8052 0.0663
NP_441020.2_6 Forward -120 -103 6.23369 0.27
NP_441015.1_10 Forward -123 -104 -5.21209 0.219
NP_441673.1_1 Forward -118 -109 20.8459 0.000698
NP_441673.1_1 Reverse -109 -118 20.8459 0.000698
NP_441731.1_3 Reverse -101 -120 -4.03212 0.284
NP_441826.1_2 Forward -124 -110 5.21113 0.0978
NP_441826.1_2 Reverse -103 -117 3.34284 0.111
NP_442490.1_9 Reverse -97 -116 -8.26035 0.287
NP_442868.1_6 Reverse -107 -117 17.4829 0.012
NP_442868.1_6 Forward -120 -110 8.63316 0.0555
NP_442868.1_6 Forward -276 -266 0.471689 0.226
NP_442719.1_2 Reverse -32 -50 -3.22649 0.2
NP_442719.1_2 Reverse -368 -386 -11.7812 0.296
NP_441612.1_2 Forward -118 -108 8.54929 0.21
NP_442427.1_8 Forward -127 -108 11.8975 0.152
NP_442808.1_1 Forward -119 -109 8.73102 0.0481
NP_442808.1_1 Reverse -108 -118 8.63269 0.0481
NP_442808.1_1 Reverse -14 -24 3.8145 0.222
NP_440145.1_3 Forward -128 -109 0.294447 0.137
NP_440145.1_3 Reverse -99 -118 -0.0988766 0.138
NP_441906.1_2 Forward -369 -350 10.3234 0.152
NP_442718.1_2 Forward -330 -311 7.07928 0.112
NP_442718.1_2 Reverse -247 -266 -2.85214 0.277
NP_442050.1_5 Forward -120 -110 17.1874 0.00812
NP_442050.1_5 Reverse -107 -117 15.6142 0.01
NP_442342.1_9 Reverse -107 -123 13.4315 0.0991
NP_440630.1_3 Reverse -98 -117 6.78429 0.168
NP_441114.1_3 Reverse -217 -226 7.27622 0.247
NP_440558.1_2 Reverse -106 -125 5.211 0.147
NP_440558.1_2 Forward -259 -240 -0.885524 0.205
NP_442688.1_8 Reverse -140 -159 15.2408 0.292
NP_441878.1_6 Forward -119 -109 10.5014 0.0176
NP_441878.1_6 Reverse -108 -118 10.4031 0.0176
NP_441878.1_6 Forward -225 -215 -7.49312 0.231
NP_441036.1_8 Forward -119 -109 15.713 0.00724
NP_441036.1_8 Reverse -108 -118 8.33817 0.174
NP_441557.1_4 Reverse -198 -212 13.1759 0.291
NP_441557.1_5 Forward -118 -109 19.9609 0.000699
NP_441557.1_5 Reverse -109 -118 19.9609 0.000699
NP_441557.1_5 Forward -224 -215 -0.786921 0.239
NP_441445.1_1 Forward -127 -108 -0.000545616 0.283
NP_442066.2_9 Reverse -105 -118 10.5407 0.154
NP_442066.2_9 Forward -122 -109 9.85238 0.159
NP_442066.2_9 Forward -19 -6 7.78743 0.208
NP_441308.1_8 Forward -120 -110 12.4681 0.218
NP_442183.1_1 Reverse -109 -123 17.5025 0.0107
NP_442183.1_1 Forward -118 -104 17.2075 0.0118
NP_441549.1_9 Reverse -105 -123 1.69077 0.101
NP_442347.1_2 Forward -117 -108 12.4878 0.056
NP_442347.1_2 Reverse -110 -119 3.34298 0.284
NP_442888.1_6 Reverse -204 -223 12.5858 0.148
NP_441037.1_4 Forward -120 -110 16.5761 0.0168
NP_441037.1_4 Reverse -107 -117 9.55921 0.21
NP_442317.1_6 Reverse -104 -123 12.5858 0.159
NP_442317.1_6 Forward -229 -210 3.73603 0.262
NP_441633.1_3 Reverse -107 -120 3.65753 0.0699
NP_441633.1_3 Forward -120 -107 -3.4223 0.177
NP_441633.1_6 Reverse -378 -397 6.29264 0.298
NP_440136.1_2 Forward -117 -110 15.9687 0.0123
NP_440136.1_2 Reverse -110 -117 15.9687 0.0123
NP_442998.1_5 Forward -342 -332 9.02648 0.256
NP_442998.1_10 Forward -116 -109 15.5754 0.0102
NP_442998.1_10 Reverse -111 -118 15.5754 0.0102
NP_440299.1_1 Reverse -105 -118 12.1134 0.0425
NP_440299.1_1 Forward -122 -109 4.44361 0.207
NP_441799.1_1 Reverse -105 -119 15.4369 0.0182
NP_441799.1_1 Forward -228 -214 5.21053 0.218
NP_441799.1_1 Forward -122 -108 4.91554 0.232
NP_441007.1_10 Reverse -104 -117 18.4072 0.0299
NP_441007.1_10 Forward -123 -110 14.3756 0.0499
NP_440256.1_1 Reverse -106 -125 7.47261 0.0257
NP_441559.1_8 Reverse -11 -25 -6.78525 0.279
NP_441559.1_8 Forward -123 -109 -7.47356 0.294
NP_440915.1_6 Forward -122 -108 14.0609 0.0187
NP_440915.1_6 Reverse -105 -119 12.7826 0.0206
NP_441179.1_1 Reverse -262 -281 2.65439 0.263
NP_440695.1_5 Reverse -109 -128 -0.197208 0.284
NP_441939.1_3 Reverse -110 -129 10.7175 0.122
NP_441494.1_6 Forward -123 -110 9.85238 0.227
NP_442993.1_1 Reverse -109 -125 -10.9545 0.231
NP_440677.1_6 Reverse -100 -119 8.45592 0.277
NP_442386.1_9 Reverse -108 -117 13.8639 0.0289
NP_442386.1_9 Forward -119 -110 6.39082 0.219
NP_441340.1_5 Forward -117 -110 15.6737 0.0124
NP_441340.1_5 Reverse -110 -117 15.6737 0.0124
NP_441340.1_5 Reverse -216 -223 3.97235 0.274
NP_441271.1_1 Forward -124 -106 15.358 0.202
NP_441947.1_4 Reverse -251 -270 16.4207 0.127
NP_440161.1_3 Reverse -213 -232 7.57094 0.295
NP_441160.1_5 Forward -135 -116 -3.93378 0.288
NP_441160.1_6 Forward -32 -13 0.786102 0.286
NP_440586.1_8 Forward -117 -110 13.2151 0.026
NP_440586.1_8 Reverse -110 -117 13.2151 0.026
NP_442251.1_6 Forward -117 -110 15.2804 0.0124
NP_442251.1_6 Reverse -110 -117 15.2804 0.0124
NP_440192.1_4 Forward -258 -239 10.0767 0.254
NP_441262.1_3 Reverse -109 -116 14.7888 0.0223
NP_441262.1_3 Forward -118 -111 14.7888 0.0223
NP_443051.1_1 Forward -119 -110 19.5676 0.00335
NP_443051.1_1 Reverse -108 -117 10.4228 0.00754
NP_443051.1_1 Forward -225 -216 0.0980582 0.226
NP_441232.1_2 Reverse -22 -41 23.5989 0.0242
NP_439937.1_9 Reverse -264 -281 -11.8598 0.267
NP_439937.1_9 Reverse -311 -328 -12.6465 0.274
NP_439937.1_9 Reverse -108 -125 -16.383 0.287
NP_439937.1_9 Reverse -173 -190 -16.5797 0.287
NP_440439.1_1 Reverse -106 -119 8.27909 0.0547
NP_440439.1_1 Forward -121 -108 3.16588 0.119
NP_440372.1_2 Forward -117 -110 16.3621 0.0124
NP_440372.1_2 Reverse -110 -117 16.3621 0.0124
NP_440316.1_10 Forward -225 -215 5.38824 0.299
NP_441803.1_2 Reverse -104 -123 13.7658 0.0478
NP_439977.1_5 Reverse -103 -122 12.8808 0.0531
NP_439977.1_5 Forward -124 -105 9.63589 0.0932
NP_442384.1_10 Forward -118 -105 9.45906 0.0536
NP_442384.1_10 Reverse -109 -122 1.9859 0.24
NP_442790.1_4 Reverse -100 -119 -0.0988766 0.0927
NP_442262.1_10 Forward -117 -110 14.1988 0.0123
NP_442262.1_10 Reverse -110 -117 14.1988 0.0123
NP_442262.1_10 Reverse -216 -223 9.87221 0.164
NP_441689.1_5 Forward -120 -110 8.43603 0.132
NP_441689.1_5 Reverse -107 -117 5.87944 0.197
NP_440344.1_10 Forward -125 -108 11.5436 0.006
NP_440531.1_6 Forward -32 -13 -4.32711 0.279
NP_442910.1_1 Forward -190 -171 -7.86702 0.269
NP_440562.1_3 Forward -117 -100 13.8052 0.0648
NP_441965.1_10 Forward -121 -105 13.0382 0.105
NP_440297.1_9 Forward -117 -107 -0.216628 0.282
NP_440297.1_9 Reverse -110 -120 -0.314959 0.282
NP_442280.1_10 Forward -34 -16 8.76604 0.249
NP_441592.1_4 Forward -118 -99 -1.96717 0.26
NP_441896.1_3 Forward -127 -108 -0.688862 0.244
NP_440894.1_10 Reverse -104 -123 4.32602 0.254
NP_442067.1_4 Forward -36 -17 11.3075 0.131
NP_440999.1_9 Forward -122 -108 13.9626 0.028
NP_440999.1_9 Reverse -105 -119 7.27608 0.0893
NP_440888.1_2 Reverse -109 -123 18.1901 0.00261
NP_440888.1_2 Forward -118 -104 13.2736 0.0307
NP_440179.1_6 Reverse -216 -235 5.70265 0.231
NP_440491.1_1 Reverse -106 -125 11.9848 0.158
NP_442948.1_2 Forward -119 -100 10.6192 0.144
NP_442277.1_4 Forward -127 -108 0.883656 0.297
NP_442033.1_10 Forward -120 -101 -8.16202 0.191
NP_441543.1_2 Forward -117 -108 16.9127 0.00359
NP_441543.1_2 Reverse -110 -119 15.9293 0.00518
NP_441543.1_2 Reverse -216 -225 4.0313 0.293
NP_442845.1_2 Reverse -103 -117 12.9793 0.1
NP_442845.1_2 Forward -124 -110 5.60446 0.228
NP_442845.1_4 Forward -120 -101 9.63589 0.178
NP_441551.1_5 Reverse -105 -121 13.2342 0.13
NP_441319.1_5 Reverse -33 -52 8.55425 0.282
NP_441918.1_4 Reverse -260 -279 14.3558 0.281
NP_441469.1_8 Forward -119 -110 6.5879 0.227
NP_441469.1_8 Reverse -108 -117 6.48957 0.227
NP_442315.1_2 Forward -229 -217 13.9036 0.291
NP_443064.1_6 Forward -118 -108 12.5669 0.0796
NP_443064.1_6 Reverse -109 -119 10.8217 0.13
NP_443064.1_6 Reverse -178 -188 9.75513 0.199
NP_442578.1_7 Forward -117 -110 14.5921 0.026
NP_442578.1_7 Reverse -110 -117 14.5921 0.026
NP_441462.1_2 Reverse -109 -119 20.2362 0.000805
NP_441462.1_2 Forward -118 -108 11.5831 0.00406
NP_441621.1_7 Forward -120 -106 6.98109 0.068
NP_441621.1_7 Reverse -107 -121 4.52282 0.0934
NP_443062.1_1 Reverse -109 -127 4.45062 0.26
NP_440519.1_8 Forward -327 -311 5.17175 0.21
NP_442204.1_1 Forward -122 -111 2.61528 0.266
NP_442204.1_5 Forward -128 -109 2.55606 0.212
NP_442204.1_5 Reverse -99 -118 0.294447 0.267
NP_442487.1_5 Forward -41 -22 5.30853 0.232
NP_440516.1_8 Forward -118 -109 16.9127 0.00442
NP_440516.1_8 Reverse -109 -118 16.9127 0.00442
NP_440128.1_4 Reverse -374 -393 14.3558 0.132
NP_442428.1_5 Forward -117 -110 15.8704 0.0124
NP_442428.1_5 Reverse -110 -117 15.8704 0.0124
NP_442428.1_5 Forward -223 -216 4.46401 0.267
NP_442120.1_10 Forward -224 -205 -8.35868 0.234
NP_442120.1_10 Forward -124 -105 -16.1268 0.296
NP_440673.1_3 Forward -116 -109 12.4288 0.0426
NP_440673.1_3 Reverse -111 -118 12.4288 0.0426
NP_440673.1_3 Reverse -217 -224 8.98723 0.203
NP_440865.1_9 Forward -124 -105 -6.68705 0.231
NP_441052.1_2 Forward -118 -108 19.9412 0.00106
NP_441052.1_2 Reverse -109 -119 10.4031 0.0285
NP_442219.1_9 Forward -117 -108 17.7976 0.00718
NP_442219.1_9 Reverse -110 -119 8.25953 0.0681
NP_440436.1_4 Forward -117 -108 17.2072 0.00233
NP_440436.1_4 Reverse -110 -119 9.24241 0.0871
NP_441884.1_9 Forward -121 -102 -5.80207 0.0594
NP_440314.1_9 Forward -117 -98 2.45773 0.0855
NP_440648.1_1 Reverse -247 -266 7.96426 0.189
NP_441719.1_4 Forward -117 -110 16.3621 0.0124
NP_441719.1_4 Reverse -110 -117 16.3621 0.0124
NP_441733.1_10 Forward -121 -108 8.77074 0.135
NP_441733.1_10 Reverse -106 -119 7.78743 0.15
NP_441004.1_1 Forward -169 -150 -15.1435 0.273
NP_442873.1_9 Forward -128 -109 4.12856 0.287
NP_441115.1_4 Reverse -108 -126 7.3932 0.286
NP_442206.1_10 Forward -118 -103 14.3362 0.0799
NP_440288.1_2 Forward -49 -30 4.22769 0.286
NP_443054.1_2 Reverse -107 -121 3.04785 0.24
NP_441851.1_10 Reverse -108 -118 15.8113 0.00552
NP_441851.1_10 Forward -119 -109 8.53483 0.114
NP_442515.1_1 Forward -119 -105 4.71948 0.107
NP_442515.1_1 Reverse -108 -122 -2.45868 0.275
NP_442515.1_1 Forward -367 -353 -4.7203 0.298
NP_440593.1_3 Forward -123 -104 -4.6221 0.251
NP_441982.1_6 Forward -368 -359 11.4349 0.288
NP_442689.1_8 Reverse -33 -50 -7.53264 0.292
NP_441349.1_10 Reverse -99 -118 10.5209 0.0232
NP_441409.1_6 Reverse -103 -122 0.687771 0.0648
NP_440432.1_9 Reverse -110 -125 -2.77337 0.175
NP_440474.1_8 Reverse -248 -262 4.42388 0.279
NP_441477.1_5 Reverse -167 -186 5.80098 0.292
NP_440431.1_3 Reverse -191 -210 -0.590531 0.144
NP_440588.1_2 Reverse -100 -119 6.68596 0.0535
NP_441570.1_1 Reverse -109 -127 -9.61729 0.142
NP_441078.1_4 Forward -118 -109 19.6659 0.0007
NP_441078.1_4 Reverse -109 -118 19.6659 0.0007
NP_441078.1_4 Forward -224 -215 -1.6719 0.266
NP_442729.1_8 Reverse -105 -118 9.95071 0.125
NP_440526.1_3 Forward -117 -106 17.7577 0.0398
NP_440526.1_3 Reverse -110 -121 11.6612 0.0646
NP_441432.1_8 Reverse -108 -117 16.8143 0.00595
NP_441432.1_8 Forward -119 -110 16.8143 0.00595
NP_441432.1_8 Forward -225 -216 15.0444 0.0182
NP_441432.1_8 Reverse -246 -255 5.3096 0.17
NP_442320.1_8 Forward -124 -110 7.66941 0.0189
NP_442320.1_8 Reverse -103 -117 5.30946 0.0394
NP_442344.1_7 Reverse -110 -129 -9.047 0.235
NP_441732.1_2 Forward -122 -106 4.0901 0.0141
NP_441732.1_2 Reverse -105 -121 -16.1661 0.165
NP_440760.1_1 Reverse -109 -128 -21.4367 0.237
NP_440913.1_1 Reverse -107 -125 11.6222 0.168
NP_439935.1_2 Forward -58 -39 14.1591 0.224
NP_442407.1_7 Forward -36 -17 21.7297 0.0539
NP_442489.1_7 Forward -118 -109 20.1576 0.000695
NP_442489.1_7 Reverse -109 -118 20.1576 0.000695
NP_442489.1_7 Forward -224 -215 -1.6719 0.235
NP_442489.1_7 Reverse -215 -224 -1.96689 0.28
NP_442079.1_7 Forward -117 -98 0.196116 0.286
NP_440559.1_1 Forward -117 -108 17.4043 0.00658
NP_440559.1_1 Reverse -110 -119 8.65285 0.0586
NP_440559.1_1 Forward -223 -214 4.52295 0.26
NP_441659.2_8 Reverse -109 -119 20.9245 0.000805
NP_441659.2_8 Forward -118 -108 18.1713 0.00133
NP_441659.2_8 Reverse -215 -225 6.76487 0.0678
NP_442913.1_10 Forward -127 -108 0.491109 0.153
NP_442913.1_10 Forward -265 -246 -5.11376 0.257
NP_442346.1_5 Reverse -108 -118 16.6963 0.00248
NP_442346.1_5 Forward -119 -109 16.303 0.00248
NP_442346.1_5 Forward -225 -215 12.2714 0.0456
NP_442346.1_5 Forward -202 -192 4.99491 0.267
NP_442346.1_5 Reverse -214 -224 4.20827 0.296
NP_440545.1_3 Forward -122 -105 9.47861 0.0393
NP_440545.1_3 Reverse -105 -122 9.28195 0.0402
NP_440025.1_3 Reverse -37 -51 12.8375 0.263
NP_440486.1_6 Forward -170 -151 6.19431 0.283
NP_440459.1_2 Reverse -238 -255 7.61033 0.285
NP_442551.1_2 Forward -215 -197 15.1613 0.272
NP_442551.1_4 Reverse -213 -228 -1.49507 0.246
NP_442603.1_7 Forward -118 -104 14.1586 0.0731
NP_441888.1_7 Forward -35 -21 5.1128 0.225
NP_440449.1_6 Forward -126 -108 11.1737 0.138
NP_441833.1_4 Forward -117 -110 15.9687 0.0124
NP_441833.1_4 Reverse -110 -117 15.9687 0.0124
NP_441895.1_10 Forward -170 -151 -18.9784 0.282
NP_442162.1_9 Forward -117 -110 16.2637 0.0124
NP_442162.1_9 Reverse -110 -117 16.2637 0.0124
NP_440671.1_4 Forward -124 -110 7.57108 0.214
NP_442199.1_5 Forward -126 -107 5.211 0.0977
NP_442140.1_3 Forward -117 -107 13.5497 0.0542
NP_442140.1_3 Reverse -110 -120 7.94484 0.124
NP_441671.1_10 Reverse -236 -255 4.22769 0.219
NP_440875.1_9 Reverse -111 -121 16.8403 0.0145
NP_440875.1_9 Forward -116 -106 9.3454 0.233
NP_441813.1_5 Reverse -107 -117 8.73149 0.0367
NP_441813.1_5 Forward -120 -110 8.73149 0.0367
NP_442028.1_1 Forward -201 -188 11.9028 0.251
NP_441259.1_7 Forward -123 -105 19.292 0.149
NP_440590.1_4 Reverse -110 -123 12.704 0.013
NP_440590.1_4 Forward -117 -104 -4.01229 0.257
NP_440567.1_1 Forward -117 -103 15.8309 0.0166
NP_440567.1_1 Reverse -110 -124 9.63603 0.0422
NP_440567.1_6 Forward -117 -98 5.89931 0.244
NP_442497.1_10 Reverse -110 -119 17.601 0.00813
NP_442497.1_10 Forward -117 -108 10.4228 0.0087
NP_440821.1_4 Reverse -107 -117 17.9746 0.00497
NP_440821.1_4 Forward -120 -110 10.7964 0.0146
NP_441239.1_9 Forward -120 -108 14.887 0.0247
NP_441239.1_9 Reverse -107 -119 7.11881 0.169
NP_441239.1_9 Forward -226 -214 4.66053 0.248
NP_441727.1_3 Forward -125 -106 15.7324 0.116
NP_441727.1_3 Reverse -102 -121 3.83436 0.275
NP_441892.1_1 Forward -127 -110 11.8386 0.0537
NP_440604.1_6 Forward -118 -99 -3.93378 0.236
NP_442044.1_1 Forward -123 -104 13.7658 0.0969
NP_442044.1_9 Reverse -109 -128 4.22769 0.23
NP_442193.1_8 Reverse -106 -125 12.7816 0.234
NP_441874.1_1 Forward -353 -339 10.226 0.261
NP_442083.1_9 Reverse -251 -270 12.1925 0.163
NP_440546.1_4 Reverse -109 -119 13.5365 0.0459
NP_440546.1_4 Forward -118 -108 10.046 0.109
NP_440546.1_6 Forward -128 -109 10.2259 0.247
NP_440546.1_6 Reverse -257 -276 7.37428 0.273
NP_442041.1_2 Reverse -357 -375 13.1955 0.283
NP_441230.1_5 Forward -123 -104 4.12936 0.188
NP_440462.1_6 Forward -120 -110 19.4496 0.00371
NP_440462.1_6 Reverse -107 -117 10.3048 0.0396
NP_442611.1_1 Forward -123 -104 -0.885524 0.273
NP_440868.1_4 Reverse -105 -117 16.4603 0.0149
NP_440868.1_4 Forward -122 -110 0.432302 0.212
NP_442499.1_3 Forward -119 -101 4.34571 0.289
NP_442479.1_9 Reverse -265 -284 -9.83364 0.266
NP_442039.1_4 Forward -117 -110 15.1821 0.0124
NP_442039.1_4 Reverse -110 -117 15.1821 0.0124
NP_442837.1_3 Forward -117 -110 15.7721 0.0124
NP_442837.1_3 Reverse -110 -117 15.7721 0.0124
NP_440805.1_6 Forward -91 -77 16.7152 0.265
NP_439994.1_3 Forward -119 -100 9.21897 0.253
NP_442053.1_1 Forward -118 -109 18.3876 0.0007
NP_442053.1_1 Reverse -109 -118 18.3876 0.0007
NP_440505.1_3 Reverse -107 -117 16.598 0.00683
NP_440505.1_3 Forward -120 -110 15.418 0.0114
NP_441203.1_1 Forward -117 -98 -9.34199 0.137
NP_442532.1_7 Reverse -109 -123 6.88276 0.171
NP_440914.1_1 Forward -118 -108 17.5935 0.000537
NP_440914.1_1 Reverse -109 -119 16.3248 0.00196
NP_441011.1_8 Reverse -110 -119 16.6177 0.00602
NP_441011.1_8 Forward -117 -108 8.25953 0.144
NP_441011.1_10 Forward -304 -285 11.9958 0.294
NP_442533.1_1 Reverse -249 -268 -12.8819 0.236
NP_442533.1_6 Forward -118 -109 17.2076 0.00137
NP_442533.1_6 Reverse -109 -118 17.2076 0.00137
NP_442533.1_6 Forward -224 -215 5.60459 0.137
NP_442541.1_10 Forward -256 -242 3.14559 0.254
NP_442232.1_3 Forward -126 -107 -15.1435 0.289
NP_441482.1_7 Forward -124 -110 8.75105 0.0162
NP_441482.1_7 Reverse -103 -117 -10.7185 0.213
NP_439944.1_9 Forward -117 -107 19.1546 0.00329
NP_439944.1_9 Reverse -110 -120 17.7779 0.00341
NP_439944.1_9 Forward -223 -213 5.48657 0.247
NP_441028.1_6 Reverse -337 -347 7.74772 0.218
NP_440115.1_6 Reverse -106 -116 18.9579 0.0139
NP_440115.1_6 Forward -121 -111 7.84651 0.146
NP_440007.1_9 Forward -122 -108 3.14618 0.275
NP_441347.1_5 Reverse -103 -117 14.0603 0.238
NP_442492.1_2 Reverse -109 -128 1.27776 0.231
NP_440608.1_6 Forward -117 -98 3.14526 0.29
NP_441602.1_3 Reverse -104 -123 7.47261 0.12
NP_441106.1_1 Forward -119 -110 18.486 0.0028
NP_441106.1_1 Reverse -108 -117 9.63616 0.0311
NP_441106.1_1 Forward -225 -216 5.60459 0.141
NP_439903.1_6 Reverse -106 -125 5.99684 0.173
NP_441286.1_1 Reverse -108 -120 14.6903 0.00418
NP_441286.1_1 Forward -119 -107 12.232 0.00999
NP_440670.1_8 Forward -118 -109 18.3876 0.000699
NP_440670.1_8 Reverse -109 -118 18.3876 0.000699
NP_441647.1_8 Forward -380 -361 11.3067 0.28
NP_440886.1_7 Forward -119 -109 8.04271 0.0805
NP_440886.1_7 Reverse -108 -118 7.94438 0.0805
NP_442614.1_2 Forward -118 -104 9.2427 0.242
NP_439995.1_5 Reverse -99 -118 5.50599 0.276
NP_442072.1_9 Reverse -108 -126 4.6407 0.0208
NP_442072.1_9 Forward -97 -79 -23.187 0.284
NP_440907.2_8 Reverse -110 -120 19.1541 0.00362
NP_440907.2_8 Forward -117 -107 10.8943 0.0969
NP_442264.1_2 Forward -128 -111 7.70866 0.231
NP_441021.1_1 Forward -117 -98 -9.047 0.206
NP_441021.1_1 Reverse -110 -129 -12.7836 0.295
NP_441463.1_3 Forward -128 -109 -2.65548 0.158
NP_441463.1_3 Forward -167 -148 -5.11376 0.22
NP_441463.1_6 Forward -120 -106 10.1846 0.242
NP_441626.1_2 Forward -117 -110 15.7721 0.0124
NP_441626.1_2 Reverse -110 -117 15.7721 0.0124
NP_442365.1_7 Reverse -105 -124 -5.60541 0.274
NP_442794.1_1 Reverse -105 -117 3.18557 0.286
NP_442615.1_1 Reverse -100 -118 10.4422 0.0211
NP_442615.1_1 Forward -127 -109 7.39397 0.0317
NP_442615.1_1 Forward -233 -215 -1.45582 0.128
NP_442615.1_1 Forward -192 -174 -7.55234 0.296
NP_441962.1_4 Forward -123 -104 18.3873 0.0137
NP_441962.1_4 Reverse -104 -123 -10.3253 0.226
NP_440387.1_1 Forward -118 -102 13.3332 0.00865
NP_440387.1_1 Reverse -109 -125 6.84337 0.0282
NP_441431.1_2 Forward -121 -107 10.8154 0.153
NP_441431.1_2 Reverse -106 -120 7.86545 0.231
NP_441431.1_2 Reverse -212 -226 7.07881 0.251
NP_441836.1_2 Forward -124 -105 -1.47551 0.219
NP_441993.1_1 Forward -124 -105 0.484826 0.298
NP_441174.1_2 Reverse -106 -120 15.3392 0.119
NP_440114.1_10 Reverse -109 -123 12.0943 0.0924
NP_440114.1_10 Reverse -215 -229 6.09611 0.285
NP_440293.1_3 Forward -58 -39 -5.70374 0.281
NP_440766.1_4 Forward -122 -108 7.17775 0.0967
NP_440766.1_6 Forward -163 -144 15.7324 0.212
NP_441237.1_9 Forward -117 -107 14.9263 0.0242
NP_439910.1_2 Reverse -207 -224 -12.8425 0.103
NP_442867.1_8 Forward -254 -235 3.83436 0.297
NP_440457.1_1 Forward -122 -110 5.44718 0.141
NP_440457.1_1 Reverse -105 -117 -0.452677 0.263
NP_442509.1_9 Forward -118 -108 8.14104 0.192
NP_442509.1_9 Reverse -109 -119 8.04271 0.192
NP_442509.1_9 Forward -40 -30 7.64939 0.21
NP_442514.1_5 Forward -379 -360 -9.63771 0.297
NP_440554.1_4 Reverse -110 -120 15.418 0.0199
NP_440554.1_4 Forward -117 -107 6.37155 0.123
NP_441885.1_5 Forward -118 -108 20.9245 0.000538
NP_441885.1_5 Reverse -109 -119 11.3864 0.00668
NP_441885.1_5 Forward -224 -214 0.766681 0.123
NP_442341.1_7 Reverse -108 -122 12.7826 0.0415
NP_442341.1_7 Forward -119 -105 6.19444 0.134
NP_441173.1_9 Reverse -392 -400 11.0321 0.228
NP_443000.1_7 Forward -120 -110 10.7964 0.0345
NP_443000.1_7 Reverse -107 -117 10.4031 0.0345
NP_441842.1_10 Forward -125 -111 11.996 0.113
NP_440275.1_3 Forward -120 -110 18.6629 0.0082
NP_440275.1_3 Reverse -107 -117 17.6796 0.0102
NP_440275.1_3 Forward -106 -96 2.63497 0.258
NP_440091.1_1 Forward -122 -110 3.2839 0.163
NP_440091.1_1 Reverse -105 -117 1.41561 0.197
NP_440091.1_1 Reverse -211 -223 0.923956 0.225
NP_440679.1_5 Forward -169 -150 5.50599 0.292
NP_443010.1_10 Forward -121 -104 11.951 0.0965
NP_443010.1_10 Reverse -262 -279 1.99772 0.287
NP_442451.1_2 Forward -126 -107 -9.73531 0.259
NP_441105.1_3 Forward -129 -110 8.84924 0.0472
NP_440216.1_1 Reverse -109 -123 -1.8687 0.0412
NP_440216.1_1 Forward -118 -104 -10.4235 0.145
NP_440678.1_9 Forward -123 -104 24.0905 0.0326
NP_440172.1_1 Reverse -109 -119 17.5813 0.00421
NP_440172.1_1 Forward -118 -108 15.0247 0.00945
NP_440172.1_1 Forward -224 -214 11.2881 0.0407
NP_442015.1_10 Reverse -105 -118 2.37923 0.193
NP_441226.1_7 Forward -117 -110 14.4934 0.0123
NP_441226.1_7 Reverse -110 -117 14.4934 0.0123
NP_441111.1_7 Forward -117 -109 18.7023 0.00294
NP_441111.1_7 Reverse -110 -118 18.7023 0.00294
NP_442379.1_10 Reverse -102 -119 -1.63279 0.223
NP_441766.1_2 Forward -118 -109 17.5026 0.00297
NP_441766.1_2 Reverse -109 -118 17.5026 0.00297
NP_440416.1_1 Reverse -109 -128 -14.7502 0.299
NP_443052.1_9 Forward -32 -13 -0.0988766 0.204
NP_442403.1_7 Reverse -132 -151 22.2543 0.0189
NP_440261.1_5 Forward -117 -104 8.37742 0.0263
NP_440261.1_5 Reverse -110 -123 -10.6005 0.201
NP_440261.1_5 Forward -182 -169 -12.2721 0.277
NP_440988.1_10 Forward -120 -106 8.57771 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGCAAAAACACTGGGATCTTTTACCCTACCTGGCCGAAAACAAGCTATGTGATGCGGGGAAAGATGTCAGTATGGGCGGCATTATTGGTACAGCATTAATGCTTTTAGAAACATCAAAATGTGGCGCAATCCTCGACCTTGATGCCATTTCCTGTCCGGCGGGTCTAGATTTTAGGCAATGGCTACTTAGTTTTCCGAGTTATGGTTTTTTGCTGAGCGTGCGTCCTCAGTTCGTCAAAACGGTCAAGGCTTGTTTTCAGGCTGAAGGTTTAATAGCAGAGGCGATCGCCACGATACAACCGGGTCATAATCTCACCCTTAAACTAGGTTCAGAGTCCCAACTATTTTGGGATTTGCAGCAAAACCCCCTCACTGGCTTTACCGGAGATTCATAAACA

CDS

ATGCCCGAAGTTACATTTGACATCGTTTGGCCCGATGGTTCAGAGGATCAGTTTTATTCACCCTCCACAGTGGTCAATCAATATTTTCAGTCTGGTCAAACCTACGAATTGGCAGATTTTGTGCAGCGATCACAGAAATCTTTAACCCTTGCCAGTGAACGGGTACGGCAAGTCTATGGCAGACCCTGCTCGATGGCGATCGCCCAACTCAAAAAAATTGAAACAAAAGCAGAGTGTTTTAGTCACAATCCCGATCCCAAAGTCACTATCCAAAATATTGACCATGACTGA

Protein

MPEVTFDIVWPDGSEDQFYSPSTVVNQYFQSGQTYELADFVQRSQKSLTLASERVRQVYGRPCSMAIAQLKKIETKAECFSHNPDPKVTIQNIDHD