Your browser is old and dusty. Try Google Chrome!

Details for ssl1426

ORF ssl1426
Accession NP_442052.1
Symbol rpl35
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L35
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -369 -355 10.0294 0.0651
NP_441061.1_2 Reverse -151 -165 6.3911 0.12
NP_441453.1_7 Reverse -329 -336 14.1988 0.175
NP_441453.1_7 Reverse -103 -110 14.1988 0.175
NP_442151.1_6 Reverse -156 -170 8.75105 0.164
NP_442151.1_6 Forward -376 -362 6.19444 0.244
NP_441098.1_3 Reverse -59 -78 -7.84171 0.299
NP_442975.1_10 Reverse -26 -40 1.86729 0.29
NP_440061.1_9 Forward -366 -352 6.98048 0.223
NP_440304.1_4 Reverse -75 -85 6.37155 0.158
NP_440044.1_8 Forward -179 -160 -1.37718 0.244
NP_441935.1_2 Reverse -159 -178 -4.6221 0.27
NP_441594.1_6 Forward -168 -149 2.94938 0.239
NP_442110.1_7 Reverse -150 -164 1.17956 0.236
NP_442726.1_7 Forward -368 -350 1.39578 0.247
NP_440330.1_2 Forward -370 -351 10.4225 0.297
NP_441083.1_3 Reverse -155 -165 19.0557 0.0636
NP_440447.1_5 Reverse -328 -338 17.8763 0.277
NP_440447.1_5 Forward -113 -103 14.1397 0.277
NP_440447.1_5 Reverse -102 -112 12.4681 0.291
NP_442570.1_3 Reverse -243 -262 -9.53865 0.299
NP_441025.1_10 Forward -313 -297 14.7098 0.171
NP_441716.1_1 Forward -19 -5 5.1128 0.24
NP_440403.1_4 Forward -59 -40 -1.86883 0.174
NP_440403.1_10 Forward -260 -241 3.04771 0.278
NP_441012.1_4 Forward -163 -150 9.16406 0.272
NP_441012.1_4 Reverse -363 -376 8.77074 0.272
NP_441012.1_4 Forward -280 -267 7.00078 0.272
NP_440376.1_1 Forward -50 -41 3.44131 0.203
NP_442687.1_7 Reverse -109 -119 6.07655 0.179
NP_442485.1_3 Reverse -240 -259 -5.99873 0.297
NP_441422.1_3 Reverse -371 -390 19.0622 0.103
NP_440360.1_10 Forward -163 -149 2.5562 0.262
NP_442782.1_2 Forward -260 -246 1.47456 0.281
NP_442782.1_2 Forward -123 -109 0.0979218 0.296
NP_441414.1_6 Reverse -280 -299 -4.22878 0.26
NP_441256.1_1 Reverse -280 -299 -8.65367 0.262
NP_442937.1_5 Reverse -145 -164 10.9142 0.151
NP_442937.1_5 Reverse -356 -375 7.96426 0.237
NP_439905.1_1 Forward -164 -151 6.80412 0.275
NP_440984.1_7 Forward -258 -244 7.37441 0.175
NP_441097.1_2 Reverse -263 -280 3.0871 0.293
NP_442376.1_2 Forward -122 -103 -13.3736 0.292
NP_440153.1_5 Reverse -308 -322 3.24451 0.217
NP_440153.1_6 Reverse -366 -385 14.2574 0.222
NP_440153.1_8 Forward -364 -351 -3.12731 0.285
NP_442064.1_4 Reverse -241 -260 9.83173 0.204
NP_442051.1_9 Forward -37 -18 18.1326 0.28
NP_443055.1_3 Reverse -258 -277 10.6451 0.284
NP_442210.1_9 Reverse -146 -164 8.7706 0.27
NP_440411.1_7 Reverse -298 -317 19.5673 0.0751
NP_440411.1_8 Reverse -189 -208 15.8307 0.275
NP_441646.1_1 Reverse -245 -264 3.34271 0.207
NP_442438.1_10 Forward -164 -150 -0.983719 0.287
NP_442771.1_1 Reverse -148 -166 -10.3056 0.254
NP_441041.1_4 Reverse -355 -374 -6.09707 0.163
NP_441041.1_4 Reverse -361 -380 -13.0786 0.28
NP_442004.1_6 Reverse -267 -281 4.52282 0.211
NP_440703.1_9 Forward -165 -152 8.47516 0.226
NP_439966.1_7 Forward -255 -245 6.86274 0.163
NP_440260.1_8 Reverse -242 -260 7.19731 0.154
NP_440260.1_8 Reverse -141 -159 -6.96235 0.295
NP_442901.1_4 Reverse -324 -343 -2.16383 0.294
NP_442012.1_4 Forward -287 -268 21.7297 0.0719
NP_441556.1_10 Reverse -151 -165 11.3899 0.227
NP_441644.1_6 Forward -44 -34 6.46942 0.157
NP_443049.1_5 Forward -65 -46 11.3075 0.185
NP_442215.1_2 Reverse -148 -164 0.943514 0.144
NP_442215.1_2 Reverse -249 -265 -4.07137 0.227
NP_442215.1_2 Forward -285 -269 -6.43131 0.271
NP_442215.1_2 Forward -318 -302 -7.51295 0.297
NP_442554.1_8 Reverse -157 -167 2.63497 0.265
NP_442142.1_4 Forward -162 -149 3.06699 0.268
NP_442381.1_7 Reverse -157 -170 19.0955 0.244
NP_443009.1_5 Forward -277 -266 4.38475 0.249
NP_441715.1_4 Forward -18 -8 4.99491 0.24
NP_441673.1_1 Forward -159 -150 -8.06341 0.254
NP_441876.1_9 Forward -341 -331 13.6475 0.267
NP_441826.1_2 Reverse -361 -375 4.71948 0.0999
NP_441826.1_2 Forward -282 -268 -3.93365 0.29
NP_442490.1_9 Forward -304 -285 -8.752 0.293
NP_442868.1_6 Forward -387 -377 0.57002 0.217
NP_442820.1_3 Forward -172 -162 14.9258 0.277
NP_442542.1_9 Reverse -164 -178 5.70218 0.259
NP_442342.1_9 Reverse -251 -267 7.2367 0.209
NP_441114.1_3 Forward -139 -130 7.96454 0.231
NP_440558.1_2 Forward -373 -354 7.47261 0.119
NP_440558.1_2 Reverse -32 -51 -1.27885 0.213
NP_440558.1_2 Reverse -351 -370 -4.13045 0.243
NP_440558.1_2 Reverse -357 -376 -4.91709 0.249
NP_440558.1_2 Reverse -194 -213 -7.4737 0.294
NP_442789.1_4 Reverse -365 -384 -3.14714 0.246
NP_441878.1_6 Forward -166 -156 0.963343 0.128
NP_441878.1_6 Forward -261 -251 -6.60814 0.193
NP_441878.1_6 Reverse -250 -260 -7.68978 0.255
NP_442650.1_2 Reverse -355 -369 2.5562 0.261
NP_442066.2_4 Forward -260 -241 -8.26035 0.294
NP_442066.2_9 Forward -257 -244 6.70579 0.271
NP_442795.1_3 Forward -342 -323 10.1275 0.122
NP_440101.1_3 Forward -321 -302 1.37609 0.276
NP_441549.1_9 Forward -286 -268 -3.6191 0.198
NP_440861.1_3 Forward -303 -285 12.1139 0.245
NP_442347.1_2 Reverse -377 -386 5.11294 0.238
NP_442645.1_2 Forward -52 -33 -22.5183 0.291
NP_442888.1_9 Forward -152 -133 15.0441 0.199
NP_442764.1_5 Reverse -300 -319 7.86593 0.284
NP_440299.1_1 Forward -368 -355 6.41022 0.143
NP_440299.1_1 Forward -280 -267 5.23026 0.184
NP_442802.1_6 Forward -254 -235 1.0811 0.204
NP_442201.1_10 Reverse -99 -118 -10.0303 0.25
NP_442158.1_4 Reverse -326 -336 12.3697 0.253
NP_440717.1_1 Forward -306 -287 9.93088 0.24
NP_442866.1_1 Reverse -278 -297 -5.60541 0.243
NP_441494.1_6 Forward -124 -111 9.06573 0.227
NP_442386.1_3 Reverse -362 -381 12.0942 0.279
NP_440168.1_9 Reverse -365 -384 -0.983855 0.273
NP_441776.1_5 Reverse -263 -282 12.4875 0.229
NP_441160.1_1 Reverse -102 -121 -4.52377 0.239
NP_440586.1_1 Reverse -351 -370 -3.44213 0.27
NP_440586.1_8 Forward -43 -36 5.8403 0.283
NP_442251.1_6 Forward -18 -11 7.11894 0.274
NP_439996.1_2 Reverse -259 -278 3.93269 0.244
NP_441232.1_10 Forward -271 -252 2.94938 0.239
NP_439937.1_9 Forward -293 -276 -9.99156 0.22
NP_440408.1_3 Reverse -361 -380 -3.54046 0.258
NP_440408.1_7 Forward -165 -146 17.699 0.111
NP_440171.1_3 Reverse -333 -352 5.01433 0.284
NP_441803.1_2 Forward -369 -350 0.982764 0.242
NP_440267.1_2 Forward -381 -367 7.86545 0.187
NP_442121.1_4 Reverse -102 -121 -3.63879 0.27
NP_441018.1_7 Reverse -146 -165 8.45592 0.246
NP_440399.1_1 Forward -128 -109 10.3242 0.3
NP_440344.1_10 Forward -57 -40 -11.8592 0.231
NP_440282.1_10 Forward -270 -251 -10.227 0.295
NP_441060.1_1 Reverse -337 -356 11.4993 0.294
NP_440189.1_10 Forward -176 -157 5.11266 0.279
NP_440189.1_10 Forward -191 -172 4.916 0.279
NP_440297.1_8 Reverse -353 -371 13.7855 0.221
NP_440297.1_9 Reverse -157 -167 0.176696 0.282
NP_440894.1_10 Reverse -91 -110 4.32602 0.254
NP_442129.1_6 Reverse -59 -78 14.2373 0.246
NP_440999.1_9 Forward -54 -40 -3.04867 0.283
NP_440888.1_2 Forward -395 -381 5.50552 0.276
NP_440888.1_2 Forward -364 -350 5.50552 0.276
NP_440888.1_2 Forward -119 -105 5.21053 0.288
NP_440888.1_2 Forward -376 -362 5.1122 0.293
NP_442948.1_2 Reverse -354 -373 5.01433 0.256
NP_441917.1_2 Forward -47 -29 15.6538 0.152
NP_441543.1_2 Forward -259 -250 4.42462 0.246
NP_442845.1_2 Forward -282 -268 3.63784 0.282
NP_442845.1_2 Reverse -108 -122 3.34284 0.294
NP_441178.1_6 Reverse -248 -267 7.17681 0.266
NP_443064.1_6 Reverse -283 -293 8.78555 0.271
NP_442337.1_8 Forward -271 -252 -0.000545616 0.26
NP_440220.1_4 Reverse -316 -335 0.293673 0.255
NP_443062.1_1 Forward -44 -26 5.91323 0.215
NP_440277.1_1 Reverse -246 -265 13.7649 0.27
NP_441351.1_8 Forward -142 -123 0.884433 0.28
NP_440516.1_2 Reverse -370 -388 1.98577 0.183
NP_442080.1_7 Reverse -37 -56 -4.72043 0.296
NP_442120.1_10 Reverse -361 -380 -16.0285 0.296
NP_440673.1_2 Reverse -161 -180 8.82876 0.263
NP_440673.1_3 Reverse -378 -385 7.41394 0.263
NP_440077.1_4 Reverse -295 -314 12.4875 0.268
NP_441052.1_2 Forward -117 -107 3.61828 0.177
NP_441052.1_2 Forward -140 -130 2.14332 0.216
NP_440436.1_4 Forward -275 -266 5.50585 0.195
NP_442864.1_2 Forward -375 -356 14.7491 0.224
NP_441004.1_1 Reverse -144 -163 -15.6352 0.276
NP_442366.1_3 Reverse -266 -284 -1.25915 0.208
NP_442366.1_3 Reverse -149 -167 -4.8974 0.278
NP_442206.1_10 Reverse -355 -370 8.63302 0.167
NP_442854.1_6 Forward -159 -140 4.42435 0.252
NP_440328.1_4 Reverse -301 -320 0.58944 0.246
NP_443054.1_2 Reverse -39 -53 -0.590395 0.299
NP_442622.1_3 Reverse -356 -375 2.0644 0.215
NP_442515.1_1 Forward -166 -152 -2.26202 0.271
NP_441683.1_1 Reverse -154 -173 13.3758 0.3
NP_442843.1_1 Forward -139 -120 -11.7019 0.291
NP_440588.1_2 Forward -168 -149 -3.63879 0.191
NP_440588.1_2 Reverse -147 -166 -4.91709 0.233
NP_440588.1_2 Forward -325 -306 -6.98204 0.297
NP_440023.1_4 Reverse -205 -224 17.8957 0.0668
NP_442006.1_2 Reverse -162 -179 -16.3824 0.25
NP_442243.1_1 Forward -395 -377 -0.374908 0.248
NP_442243.1_1 Forward -267 -249 -2.73484 0.295
NP_441570.1_1 Forward -180 -162 -13.7472 0.224
NP_440078.1_10 Reverse -355 -374 2.16274 0.279
NP_441078.1_4 Forward -260 -251 6.09625 0.0863
NP_441078.1_4 Reverse -251 -260 5.99792 0.0932
NP_442348.1_2 Reverse -187 -196 9.14451 0.28
NP_440526.1_3 Forward -275 -264 5.85971 0.229
NP_441432.1_8 Reverse -76 -85 5.11294 0.187
NP_441432.1_8 Reverse -366 -375 4.91628 0.196
NP_441030.1_6 Forward -284 -265 11.0224 0.297
NP_442815.1_2 Reverse -356 -374 7.98396 0.204
NP_440760.1_1 Reverse -156 -175 -17.7985 0.204
NP_442797.1_2 Reverse -151 -169 13.7263 0.239
NP_440199.1_10 Reverse -270 -280 12.1731 0.134
NP_442489.1_7 Reverse -150 -159 -1.77023 0.247
NP_441659.2_8 Forward -44 -34 0.176696 0.271
NP_441659.2_8 Forward -165 -155 0.0783647 0.277
NP_441040.1_2 Reverse -148 -167 -5.31042 0.177
NP_441040.1_3 Reverse -344 -363 16.3224 0.134
NP_442776.1_2 Forward -398 -379 7.96426 0.267
NP_442346.1_5 Forward -166 -156 10.8948 0.0813
NP_442346.1_5 Forward -45 -35 9.91146 0.114
NP_442346.1_5 Reverse -366 -376 5.68323 0.234
NP_440025.1_3 Forward -81 -67 13.7088 0.235
NP_440025.1_3 Forward -144 -130 11.5789 0.289
NP_440847.1_3 Forward -274 -260 14.3553 0.202
NP_440847.1_8 Forward -64 -45 12.4875 0.277
NP_441585.1_5 Forward -299 -280 4.71854 0.227
NP_441047.1_2 Forward -259 -240 -3.04881 0.285
NP_440283.1_1 Reverse -266 -285 5.70265 0.196
NP_441112.1_6 Reverse -161 -180 1.0811 0.263
NP_440671.1_4 Forward -382 -368 5.60446 0.279
NP_440224.1_4 Reverse -354 -373 3.24438 0.225
NP_441915.1_4 Reverse -279 -298 6.98015 0.293
NP_442254.1_1 Forward -177 -158 2.75272 0.221
NP_440590.1_4 Forward -363 -350 0.805932 0.143
NP_440590.1_4 Forward -369 -356 -1.55401 0.223
NP_440567.1_1 Reverse -308 -322 -0.688726 0.298
NP_440567.1_6 Forward -85 -66 12.8808 0.163
NP_441892.1_1 Reverse -258 -275 -0.649475 0.188
NP_440665.1_2 Reverse -101 -120 2.94938 0.18
NP_442105.1_9 Forward -216 -202 14.1576 0.294
NP_442643.1_1 Forward -39 -20 -6.88371 0.231
NP_442052.1_1 Forward -37 -18 18.3618 0.224
NP_442052.1_4 Forward -140 -121 19.9864 0.152
NP_442052.1_6 Forward -372 -354 20.0778 0.0923
NP_442052.1_7 Forward -264 -250 14.2576 0.22
NP_442052.1_8 Forward -167 -157 15.5163 0.253
NP_440546.1_4 Reverse -267 -277 6.55553 0.291
NP_440675.1_1 Reverse -147 -166 6.39097 0.195
NP_442479.1_9 Reverse -186 -205 -8.94866 0.266
NP_442402.1_1 Forward -125 -106 7.47261 0.293
NP_442402.1_2 Forward -120 -106 15.7319 0.263
NP_442402.1_4 Forward -125 -106 -3.83621 0.22
NP_442402.1_6 Reverse -105 -114 15.7327 0.241
NP_442402.1_10 Forward -116 -106 15.2208 0.18
NP_442039.1_7 Reverse -104 -114 10.4031 0.257
NP_440160.1_5 Reverse -380 -390 16.4008 0.228
NP_442053.1_1 Forward -253 -244 5.01461 0.213
NP_440505.1_7 Reverse -195 -214 4.22769 0.203
NP_440505.1_7 Forward -293 -274 2.3594 0.235
NP_441701.1_3 Reverse -351 -368 11.8386 0.213
NP_442009.1_9 Forward -151 -132 14.4541 0.226
NP_441408.2_7 Forward -318 -299 -1.18052 0.249
NP_441011.1_8 Reverse -42 -51 8.35786 0.144
NP_442101.1_10 Reverse -163 -182 -6.1954 0.183
NP_442533.1_1 Forward -319 -300 -9.93197 0.23
NP_442533.1_6 Reverse -156 -165 4.0313 0.194
NP_442533.1_6 Reverse -355 -364 3.53964 0.21
NP_442533.1_6 Forward -159 -150 3.44131 0.212
NP_442533.1_6 Forward -282 -273 2.85133 0.236
NP_442533.1_6 Forward -253 -244 1.57302 0.294
NP_440661.1_4 Reverse -308 -327 11.2092 0.113
NP_441089.1_10 Forward -278 -259 0.58944 0.3
NP_442541.1_10 Reverse -35 -49 1.76896 0.279
NP_442541.1_10 Forward -370 -356 0.982316 0.292
NP_441482.1_7 Forward -249 -235 -10.9151 0.222
NP_441028.1_6 Forward -115 -105 5.78111 0.243
NP_441028.1_6 Forward -116 -106 5.48612 0.255
NP_440115.1_6 Forward -388 -378 9.51814 0.115
NP_440007.1_9 Reverse -47 -61 3.93283 0.267
NP_441680.1_4 Forward -347 -328 0.196116 0.246
NP_441059.1_2 Forward -332 -313 -5.70374 0.258
NP_441602.1_3 Forward -375 -356 -3.44213 0.246
NP_441972.1_5 Forward -344 -325 -8.45701 0.265
NP_440429.1_9 Reverse -280 -299 8.35759 0.211
NP_439903.1_6 Forward -379 -360 3.53858 0.209
NP_440886.1_7 Forward -160 -150 5.68278 0.168
NP_442614.1_2 Forward -165 -151 10.1277 0.234
NP_442614.1_2 Reverse -108 -122 8.45605 0.255
NP_441399.1_5 Reverse -101 -120 18.584 0.221
NP_441463.1_3 Forward -374 -355 -2.65548 0.158
NP_441463.1_6 Reverse -129 -143 5.93276 0.287
NP_440387.1_1 Reverse -150 -166 -4.95634 0.208
NP_440387.1_1 Forward -260 -244 -6.23465 0.273
NP_441836.1_2 Reverse -150 -169 -4.52377 0.259
NP_440287.1_6 Reverse -235 -254 0.491109 0.29
NP_440293.1_9 Reverse -151 -165 11.3443 0.257
NP_441237.1_9 Forward -140 -130 9.61647 0.281
NP_440798.1_6 Reverse -252 -265 1.69091 0.205
NP_440942.1_3 Reverse -329 -348 1.76941 0.298
NP_442341.1_7 Reverse -130 -144 7.66941 0.0994
NP_442341.1_7 Forward -160 -146 5.50613 0.154
NP_441173.1_9 Forward -115 -107 13.1954 0.184
NP_441173.1_9 Forward -341 -333 10.8354 0.243
NP_440191.1_5 Reverse -98 -117 19.174 0.118
NP_443000.1_7 Reverse -365 -375 1.65166 0.235
NP_443000.1_7 Forward -378 -368 1.25834 0.26
NP_441842.1_1 Forward -17 -4 12.9 0.18
NP_441122.1_1 Forward -48 -33 3.42148 0.281
NP_440149.1_8 Forward -140 -121 -6.29373 0.246
NP_440216.1_1 Reverse -251 -265 -11.3085 0.178
NP_440216.1_9 Forward -336 -327 11.6028 0.254
NP_440216.1_9 Reverse -37 -46 7.37455 0.286
NP_440216.1_9 Forward -163 -154 6.68623 0.289
NP_440172.1_1 Reverse -367 -377 3.91327 0.213
NP_440172.1_1 Reverse -77 -87 1.84832 0.294
NP_442015.1_10 Reverse -303 -316 7.98409 0.074
NP_442015.1_10 Forward -368 -355 -0.275709 0.259
NP_442417.1_5 Forward -253 -239 4.71948 0.291
NP_440416.1_9 Forward -283 -264 -21.3384 0.294
NP_443052.1_9 Forward -368 -349 -7.17871 0.294
NP_442564.1_10 Reverse -101 -115 15.6342 0.221
NP_440988.1_10 Reverse -353 -367 5.57651 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAAAACCGTTTGCTGGCGACCAAAGTGATTACCATTGGCACCGCCACAGAGACCCTAATTCACCCCAGGGAAATCTTTCGGGAGGTGATCAAACAGGGTGCCACCAGGCTGATTGTGGCCCATAACCATCCCTCCGGTGGGCTAGAGCCGAGCCCGGAAGATATCAGGCTGACAGAATTCCTACTCCAGGGGGCCCAATACTTGCAAATTCCGGTATTGGACCATCTCATTTTGGGCCACGGCAAGCACCAAAGTTTGCGGCAATGCACAGATCTGTGGGAGCGTTTTCCCCAGGGAGATTAGGAGAAATGCATGTAATTGCCTTAATTCATCTGAAAATTCCAACAGCAGGGTTAGCCATGGTATAGTGGAAGACTGTGTTCGATTACCAGCCACATT

CDS

ATGCCCAAACTTAAAACTCGTAAAGCCGCCGCCAAACGATTTCGCCCAACCGGCAGTGGCAAGAAGATTATCCGTCGCAAAGCGTTTAAAAATCACCTATTGGAACATAAGAGTTCTGAACAGAAACATCGTCGTCTGTCTAACCTAGCTTTGGTGCATGAAGCCGATGAGAAAAATGTCCGGCTCATGCTTCCCTATATGTAA

Protein

MPKLKTRKAAAKRFRPTGSGKKIIRRKAFKNHLLEHKSSEQKHRRLSNLALVHEADEKNVRLMLPYM