Your browser is old and dusty. Try Google Chrome!

Details for ssl1417

ORF ssl1417
Accession NP_442068.1
Symbol ycf33
Category hypothetical protein YCF33
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -349 -363 5.1128 0.142
NP_441061.1_2 Reverse -177 -191 4.91614 0.142
NP_441061.1_2 Reverse -211 -225 -1.67204 0.269
NP_440795.1_7 Reverse -328 -335 9.77388 0.169
NP_441418.1_6 Forward -309 -290 -9.53865 0.0288
NP_441418.1_6 Forward -228 -209 -12.4886 0.066
NP_440815.1_2 Reverse -287 -301 10.422 0.265
NP_441480.1_10 Forward -65 -46 11.6025 0.19
NP_441453.1_4 Reverse -348 -356 14.8674 0.00947
NP_441453.1_4 Forward -357 -349 6.80426 0.121
NP_441623.1_1 Reverse -246 -264 15.0638 0.0749
NP_442151.1_6 Reverse -300 -314 5.70279 0.266
NP_442151.1_6 Reverse -327 -341 5.60446 0.27
NP_441818.1_9 Forward -245 -226 -1.7705 0.2
NP_441818.1_9 Forward -227 -208 -3.54046 0.227
NP_441519.1_7 Forward -69 -50 14.7491 0.294
NP_441976.1_4 Forward -308 -291 19.9017 0.126
NP_442655.1_2 Forward -237 -218 6.88262 0.162
NP_442655.1_10 Forward -312 -293 -2.36049 0.19
NP_442173.1_1 Forward -356 -348 13.8841 0.0225
NP_442173.1_1 Reverse -349 -357 12.0158 0.0316
NP_442752.1_4 Forward -357 -350 13.8055 0.0199
NP_442752.1_4 Forward -73 -66 12.4288 0.0388
NP_441812.1_3 Forward -42 -28 7.76774 0.263
NP_440784.1_7 Forward -356 -349 6.23397 0.241
NP_440784.1_7 Reverse -349 -356 6.13563 0.241
NP_442909.1_7 Forward -136 -122 7.76712 0.203
NP_441054.1_2 Forward -76 -57 9.93088 0.284
NP_439979.1_2 Forward -372 -353 5.80098 0.295
NP_442062.1_8 Forward -357 -347 7.64985 0.0911
NP_442062.1_8 Reverse -348 -358 7.15819 0.107
NP_442062.1_8 Reverse -176 -186 2.92996 0.292
NP_441859.1_3 Reverse -347 -366 1.76863 0.275
NP_441859.1_3 Forward -229 -210 1.08032 0.296
NP_440304.1_4 Forward -311 -301 5.87989 0.188
NP_441581.1_6 Forward -20 -1 11.7164 0.283
NP_439918.1_2 Forward -243 -224 8.94757 0.138
NP_441208.1_9 Reverse -345 -359 8.45605 0.219
NP_441925.1_4 Reverse -236 -255 -16.0292 0.278
NP_441925.1_4 Reverse -220 -239 -16.2258 0.281
NP_441925.1_4 Reverse -211 -230 -16.6192 0.284
NP_440330.1_2 Forward -369 -350 13.1758 0.275
NP_440856.1_7 Forward -186 -167 -7.96535 0.261
NP_440856.1_7 Reverse -156 -175 -9.047 0.282
NP_441083.1_5 Forward -357 -347 7.94484 0.048
NP_441083.1_5 Forward -390 -380 2.83163 0.191
NP_441083.1_5 Reverse -348 -358 0.865012 0.218
NP_441083.1_5 Reverse -300 -310 -1.00328 0.289
NP_442827.1_8 Forward -193 -174 -0.984623 0.238
NP_442827.1_8 Reverse -245 -264 -2.26292 0.272
NP_441434.1_7 Reverse -350 -364 5.21113 0.225
NP_441738.1_2 Reverse -350 -357 15.28 0.0102
NP_441955.1_6 Forward -321 -302 19.8623 0.13
NP_440209.1_1 Forward -357 -349 8.57422 0.0425
NP_440209.1_1 Forward -309 -301 5.13263 0.17
NP_442889.1_8 Forward -360 -346 10.5204 0.0832
NP_440178.1_7 Forward -263 -244 -15.7335 0.163
NP_442570.1_3 Forward -75 -56 -2.65548 0.212
NP_442111.1_4 Forward -393 -379 2.65453 0.268
NP_441624.1_7 Forward -191 -177 8.55439 0.238
NP_441163.1_1 Reverse -212 -229 4.85634 0.284
NP_441533.1_7 Reverse -242 -260 14.0797 0.282
NP_440906.1_5 Forward -356 -349 6.23397 0.234
NP_440906.1_5 Reverse -349 -356 6.13563 0.241
NP_440747.1_10 Reverse -345 -357 5.15219 0.0179
NP_441486.1_1 Forward -360 -346 5.50613 0.0365
NP_441486.1_1 Forward -339 -325 -1.5737 0.173
NP_441486.1_1 Forward -63 -49 -5.70361 0.254
NP_442330.1_4 Forward -74 -55 12.7015 0.286
NP_440403.1_4 Forward -82 -63 -8.94866 0.264
NP_440403.1_10 Forward -336 -317 1.37609 0.291
NP_440403.1_10 Reverse -174 -193 1.0811 0.291
NP_440842.1_10 Reverse -173 -187 0.88457 0.296
NP_441014.1_10 Forward -337 -318 0.0970122 0.246
NP_442848.1_5 Reverse -56 -74 6.01734 0.232
NP_442848.1_9 Forward -398 -379 8.84924 0.182
NP_442848.1_9 Reverse -211 -230 4.71934 0.204
NP_443018.1_3 Reverse -349 -356 11.7405 0.0655
NP_443018.1_3 Forward -356 -349 5.44732 0.193
NP_441634.1_8 Reverse -208 -222 -3.63866 0.295
NP_441634.1_8 Reverse -346 -360 -4.13031 0.295
NP_440376.1_1 Forward -357 -348 5.89959 0.116
NP_440376.1_1 Forward -185 -176 4.62128 0.154
NP_440376.1_1 Reverse -51 -60 2.06468 0.236
NP_440376.1_1 Reverse -210 -219 0.393051 0.279
NP_440376.1_1 Reverse -348 -357 -0.0986038 0.285
NP_441588.1_4 Reverse -350 -360 6.96153 0.178
NP_440266.1_6 Reverse -110 -129 16.7149 0.0684
NP_442687.1_7 Forward -358 -348 12.5664 0.0712
NP_442687.1_7 Forward -310 -300 8.04317 0.116
NP_442687.1_7 Reverse -175 -185 4.79825 0.234
NP_442687.1_7 Reverse -218 -228 3.81494 0.286
NP_442485.1_3 Reverse -316 -335 0.0977854 0.247
NP_441846.1_10 Forward -255 -236 -13.1769 0.199
NP_441846.1_10 Forward -309 -290 -22.42 0.259
NP_440042.1_2 Reverse -310 -329 -0.4922 0.229
NP_441422.1_7 Reverse -211 -228 -2.51776 0.215
NP_440533.1_6 Reverse -310 -329 7.27595 0.297
NP_440360.1_10 Reverse -350 -364 13.5693 0.1
NP_440360.1_10 Reverse -236 -250 13.4709 0.101
NP_440360.1_10 Reverse -290 -304 1.76955 0.289
NP_442658.1_1 Forward -359 -349 9.02601 0.169
NP_442658.1_1 Forward -311 -301 6.27276 0.234
NP_441855.2_4 Reverse -340 -359 11.2584 0.221
NP_440662.1_2 Forward -398 -379 -4.42544 0.276
NP_442782.1_2 Forward -309 -295 6.09611 0.231
NP_442782.1_2 Forward -130 -116 0.196253 0.293
NP_440607.1_8 Forward -230 -211 -0.295539 0.287
NP_441478.1_6 Reverse -153 -172 11.6017 0.229
NP_442937.1_5 Forward -164 -145 5.80098 0.3
NP_441958.1_5 Forward -358 -348 8.73149 0.0255
NP_440651.1_1 Forward -261 -242 9.43923 0.28
NP_442486.1_6 Reverse -156 -175 -6.39206 0.293
NP_440203.1_5 Reverse -179 -189 11.3859 0.195
NP_440203.1_5 Reverse -293 -303 10.1076 0.239
NP_439905.1_1 Reverse -349 -362 9.65572 0.216
NP_439905.1_1 Reverse -177 -190 8.47575 0.234
NP_441162.1_3 Reverse -179 -198 7.47261 0.293
NP_441097.1_2 Forward -307 -290 3.0871 0.293
NP_442911.1_2 Reverse -373 -392 1.37609 0.0593
NP_442911.1_2 Forward -400 -381 -6.98204 0.197
NP_441580.1_6 Reverse -242 -261 -1.08219 0.183
NP_440153.1_5 Forward -136 -122 1.86788 0.245
NP_440153.1_6 Forward -42 -23 12.0942 0.222
NP_440153.1_8 Reverse -176 -189 -2.144 0.235
NP_443055.1_6 Forward -185 -167 6.99988 0.164
NP_443055.1_6 Reverse -363 -381 1.49337 0.23
NP_443055.1_6 Reverse -229 -247 -0.571569 0.263
NP_443055.1_6 Reverse -348 -366 -1.16155 0.273
NP_440993.1_2 Forward -267 -251 1.73016 0.279
NP_442002.1_9 Forward -310 -303 12.4288 0.185
NP_442002.1_9 Forward -358 -351 10.7572 0.185
NP_441294.1_7 Reverse -233 -247 9.92255 0.219
NP_441646.1_1 Reverse -50 -69 -0.787193 0.272
NP_442438.1_10 Reverse -343 -357 2.2612 0.182
NP_442438.1_10 Forward -71 -57 -0.983719 0.287
NP_442431.1_10 Forward -242 -224 0.117479 0.281
NP_440147.1_4 Reverse -346 -359 7.59077 0.0657
NP_440147.1_4 Forward -359 -346 -0.37404 0.282
NP_441550.1_8 Forward -359 -349 9.22267 0.103
NP_441550.1_8 Reverse -346 -356 8.82935 0.112
NP_441916.1_7 Reverse -348 -358 9.51814 0.0338
NP_441916.1_10 Forward -270 -251 0.58944 0.279
NP_441041.1_4 Reverse -348 -367 -1.67217 0.102
NP_441041.1_4 Forward -309 -290 -3.14714 0.119
NP_441041.1_4 Forward -249 -230 -13.9635 0.299
NP_441041.1_7 Forward -360 -348 12.6652 0.0611
NP_441041.1_7 Forward -312 -300 7.32042 0.169
NP_441041.1_7 Forward -265 -253 5.6684 0.245
NP_442004.1_6 Forward -357 -343 3.73617 0.232
NP_440703.1_9 Reverse -176 -189 7.19687 0.266
NP_441725.1_5 Reverse -301 -311 7.45319 0.0965
NP_441725.1_5 Reverse -349 -359 -0.806614 0.271
NP_439966.1_7 Forward -359 -349 7.74772 0.15
NP_439966.1_9 Forward -359 -350 10.7178 0.0863
NP_442941.1_3 Forward -356 -346 -1.19994 0.288
NP_440289.1_2 Forward -360 -347 0.60927 0.156
NP_440289.1_2 Reverse -214 -227 0.412608 0.163
NP_440289.1_2 Forward -265 -252 -1.35735 0.233
NP_440289.1_2 Reverse -297 -310 -5.09393 0.297
NP_440983.1_5 Reverse -222 -241 -8.752 0.295
NP_440260.1_8 Reverse -339 -357 6.70565 0.154
NP_440260.1_8 Forward -345 -327 -3.42244 0.252
NP_442281.1_1 Reverse -343 -357 7.27547 0.104
NP_442281.1_1 Forward -362 -348 2.35894 0.269
NP_440437.1_1 Reverse -294 -313 -3.93378 0.248
NP_442049.1_6 Forward -81 -62 3.83436 0.259
NP_441087.1_6 Forward -192 -174 -4.01314 0.296
NP_441457.1_2 Reverse -248 -267 13.7658 0.176
NP_442068.1_10 Forward -239 -220 27.1388 0.00218
NP_441644.1_6 Forward -219 -209 10.9926 0.058
NP_441644.1_6 Forward -191 -181 9.321 0.0799
NP_441644.1_6 Reverse -348 -358 7.45273 0.124
NP_441644.1_6 Reverse -327 -337 7.35439 0.129
NP_441071.1_3 Reverse -231 -250 21.4347 0.0567
NP_442215.1_2 Forward -338 -322 -0.728113 0.171
NP_442215.1_2 Reverse -174 -190 -6.52964 0.273
NP_442029.1_1 Forward -311 -292 -18.1918 0.272
NP_440929.1_8 Reverse -348 -357 7.17789 0.0713
NP_440929.1_8 Reverse -64 -73 3.53964 0.225
NP_442933.1_10 Reverse -348 -357 8.06287 0.0885
NP_442933.1_10 Forward -357 -348 7.96454 0.0937
NP_441751.2_8 Reverse -254 -268 0.786239 0.112
NP_441751.2_8 Reverse -24 -38 -6.39192 0.265
NP_442926.1_3 Forward -230 -211 2.55606 0.295
NP_442554.1_8 Reverse -349 -359 6.17489 0.125
NP_442554.1_8 Forward -356 -346 3.32329 0.23
NP_442554.1_8 Reverse -211 -221 1.94665 0.288
NP_442863.1_5 Forward -368 -349 16.6174 0.169
NP_441762.1_7 Reverse -347 -359 4.36554 0.0504
NP_441762.1_7 Forward -310 -298 -6.05754 0.268
NP_441762.1_7 Reverse -380 -392 -6.35254 0.284
NP_441762.1_7 Forward -358 -346 -7.63084 0.296
NP_442142.1_4 Reverse -297 -310 9.85179 0.0854
NP_442142.1_4 Reverse -243 -256 6.0169 0.175
NP_442142.1_4 Forward -360 -347 2.67367 0.281
NP_442292.1_1 Forward -356 -347 -0.196935 0.239
NP_442292.1_1 Reverse -349 -358 -0.196935 0.239
NP_442381.1_8 Forward -360 -341 -13.6686 0.279
NP_441523.1_6 Reverse -214 -233 3.53937 0.272
NP_443009.1_5 Forward -25 -14 5.17139 0.214
NP_443009.1_5 Reverse -347 -358 4.67974 0.234
NP_442301.1_2 Reverse -212 -231 12.4867 0.159
NP_440357.1_3 Forward -188 -169 21.9273 0.0342
NP_440357.1_3 Forward -230 -211 3.14605 0.245
NP_442076.1_5 Forward -143 -124 7.66927 0.256
NP_440464.1_10 Forward -136 -126 13.4856 0.169
NP_441468.1_1 Forward -356 -349 6.13563 0.209
NP_441468.1_1 Reverse -349 -356 6.0373 0.223
NP_441020.2_6 Forward -359 -342 8.49531 0.197
NP_441020.2_6 Forward -230 -213 8.49531 0.197
NP_441015.1_10 Forward -362 -343 -6.78538 0.256
NP_441015.1_10 Forward -242 -223 -8.85033 0.277
NP_441673.1_1 Forward -357 -348 1.27803 0.155
NP_441673.1_1 Reverse -348 -357 1.27803 0.155
NP_442253.1_5 Forward -69 -52 7.217 0.145
NP_441876.1_9 Forward -181 -171 12.5659 0.267
NP_441826.1_2 Forward -315 -301 3.93283 0.105
NP_441826.1_2 Reverse -247 -261 0.786239 0.172
NP_441826.1_2 Reverse -294 -308 -2.85201 0.277
NP_441826.1_5 Forward -197 -178 2.55606 0.276
NP_441826.1_5 Forward -261 -242 0.491109 0.3
NP_442868.1_6 Reverse -217 -227 10.8948 0.038
NP_442868.1_6 Forward -311 -301 3.71661 0.194
NP_441944.1_8 Forward -394 -375 17.8957 0.171
NP_442808.1_1 Reverse -299 -309 8.23937 0.0547
NP_442542.1_2 Forward -359 -346 8.86907 0.145
NP_442542.1_2 Forward -221 -208 5.62415 0.257
NP_442050.1_1 Forward -310 -291 12.4875 0.212
NP_440601.1_3 Reverse -202 -221 13.2741 0.258
NP_440558.1_2 Reverse -173 -192 -3.04881 0.232
NP_440558.1_2 Forward -69 -50 -3.04881 0.232
NP_441878.1_6 Reverse -175 -185 1.55333 0.0937
NP_441878.1_6 Forward -186 -176 -6.70647 0.194
NP_441878.1_6 Reverse -216 -226 -7.88644 0.278
NP_441036.1_3 Forward -311 -292 -5.70374 0.296
NP_441036.1_8 Forward -358 -348 12.5664 0.0744
NP_442650.1_2 Forward -357 -343 6.09611 0.134
NP_441557.1_5 Forward -357 -348 8.94785 0.0289
NP_441557.1_5 Reverse -348 -357 0.688044 0.128
NP_441445.1_1 Forward -366 -347 4.32602 0.195
NP_441445.1_1 Forward -345 -326 1.57275 0.252
NP_441445.1_1 Forward -146 -127 -0.295539 0.289
NP_441445.1_8 Forward -198 -179 -11.0136 0.277
NP_442066.2_4 Reverse -300 -319 -7.57203 0.28
NP_440101.1_3 Forward -362 -343 2.26107 0.259
NP_440101.1_10 Reverse -324 -343 2.26107 0.261
NP_441458.1_10 Reverse -339 -358 12.2908 0.091
NP_441458.1_10 Reverse -135 -154 2.45773 0.269
NP_442183.1_1 Reverse -348 -362 8.45605 0.115
NP_442347.1_2 Reverse -349 -358 8.94785 0.0718
NP_442347.1_2 Reverse -65 -74 4.0313 0.284
NP_442645.1_2 Forward -68 -49 -18.3884 0.272
NP_442645.1_2 Reverse -340 -359 -22.3217 0.29
NP_442888.1_9 Reverse -156 -175 13.5691 0.257
NP_441037.1_4 Forward -311 -301 8.19481 0.237
NP_441037.1_4 Forward -359 -349 7.22024 0.237
NP_441633.1_3 Reverse -346 -359 1.10092 0.109
NP_441633.1_3 Forward -187 -174 -6.96221 0.283
NP_440136.1_2 Forward -356 -349 6.23397 0.171
NP_440136.1_2 Reverse -349 -356 6.13563 0.193
NP_442590.1_10 Forward -137 -118 6.78429 0.237
NP_442590.1_10 Forward -198 -179 3.24438 0.294
NP_442998.1_10 Reverse -350 -357 15.5754 0.0102
NP_442998.1_10 Reverse -302 -309 12.5271 0.0457
NP_440899.1_1 Forward -142 -123 12.4087 0.148
NP_440299.1_1 Reverse -344 -357 5.52525 0.172
NP_441799.1_1 Reverse -344 -358 14.5519 0.0228
NP_441007.1_10 Forward -362 -349 5.52582 0.18
NP_442334.1_2 Forward -272 -255 -13.5308 0.297
NP_442333.2_5 Forward -202 -183 -15.2418 0.29
NP_440256.1_1 Reverse -345 -364 -7.17871 0.231
NP_442007.1_1 Reverse -171 -190 14.0608 0.197
NP_441559.1_8 Forward -232 -218 -5.60527 0.267
NP_441559.1_8 Forward -394 -380 -6.49025 0.279
NP_441559.1_8 Forward -190 -176 -6.68692 0.279
NP_440915.1_6 Forward -77 -63 -2.45868 0.272
NP_440915.1_6 Forward -361 -347 -3.147 0.29
NP_440717.1_1 Reverse -177 -196 19.8623 0.0786
NP_440717.1_1 Reverse -349 -368 13.6675 0.159
NP_440717.1_3 Forward -204 -190 11.307 0.23
NP_440134.1_6 Forward -83 -65 24.5036 0.00699
NP_441464.1_10 Forward -301 -287 8.65272 0.275
NP_440702.1_2 Forward -305 -286 -5.9004 0.257
NP_440702.1_5 Reverse -1 -20 7.47261 0.249
NP_441939.1_3 Forward -225 -206 6.19431 0.248
NP_442993.1_1 Reverse -210 -226 -5.74299 0.146
NP_442993.1_1 Forward -297 -281 -11.4462 0.247
NP_440677.1_1 Forward -271 -252 9.3409 0.187
NP_442386.1_9 Reverse -347 -356 11.0124 0.107
NP_442386.1_9 Forward -61 -52 7.57079 0.219
NP_442386.1_9 Forward -358 -349 5.9975 0.23
NP_441340.1_5 Forward -356 -349 13.5105 0.0314
NP_441340.1_5 Reverse -349 -356 5.84064 0.208
NP_442186.1_9 Reverse -174 -193 11.7992 0.199
NP_442791.1_5 Reverse -340 -359 -9.83364 0.279
NP_440327.1_6 Forward -281 -262 2.65439 0.292
NP_442240.1_1 Forward -194 -175 5.30853 0.264
NP_440586.1_1 Forward -247 -228 3.6377 0.202
NP_440586.1_1 Forward -232 -213 1.57275 0.231
NP_440586.1_8 Reverse -349 -356 9.47853 0.146
NP_440586.1_8 Forward -356 -349 5.74197 0.283
NP_442251.1_6 Reverse -301 -308 8.69224 0.199
NP_440192.1_4 Forward -230 -211 8.71846 0.29
NP_441262.1_3 Forward -357 -350 14.7888 0.0223
NP_440027.1_3 Reverse -176 -194 17.9146 0.0812
NP_443051.1_1 Forward -358 -349 7.47288 0.0571
NP_439984.1_10 Reverse -241 -255 11.012 0.253
NP_439937.1_9 Reverse -217 -234 -9.10659 0.181
NP_439937.1_9 Forward -393 -376 -9.49991 0.192
NP_439937.1_9 Reverse -299 -316 -13.2365 0.283
NP_439937.1_9 Reverse -216 -233 -14.5148 0.287
NP_440439.1_1 Forward -360 -347 0.904263 0.168
NP_439943.1_4 Reverse -300 -319 3.73603 0.29
NP_440372.1_2 Forward -356 -349 13.8055 0.0214
NP_440372.1_2 Reverse -349 -356 6.52896 0.188
NP_440171.1_3 Forward -313 -294 2.85105 0.285
NP_441789.1_7 Reverse -292 -311 4.91521 0.193
NP_440316.1_10 Reverse -189 -199 8.1415 0.24
NP_441803.1_2 Reverse -211 -230 16.6174 0.0334
NP_441803.1_2 Reverse -295 -314 -1.27885 0.297
NP_440139.1_1 Forward -363 -344 0.293673 0.293
NP_442114.1_4 Reverse -348 -359 10.3834 0.17
NP_441018.1_7 Forward -157 -138 10.2259 0.214
NP_441018.1_7 Forward -77 -58 8.84924 0.239
NP_442262.1_10 Reverse -349 -356 13.2155 0.0213
NP_441689.1_5 Reverse -346 -356 5.78111 0.197
NP_440344.1_10 Forward -364 -347 -1.0428 0.0491
NP_440344.1_10 Reverse -212 -229 -8.71262 0.132
NP_441060.1_1 Forward -299 -280 11.5967 0.294
NP_440562.1_10 Forward -19 -1 6.01734 0.284
NP_440562.1_10 Reverse -339 -357 5.52568 0.289
NP_441965.1_3 Forward -232 -213 0.687771 0.231
NP_441965.1_10 Forward -360 -344 2.8118 0.282
NP_442529.1_7 Reverse -211 -230 16.8141 0.23
NP_442102.1_3 Reverse -208 -227 13.2741 0.229
NP_442280.1_10 Reverse -308 -326 11.1037 0.213
NP_441592.1_4 Reverse -211 -230 -2.36049 0.262
NP_440894.1_10 Reverse -295 -314 7.86593 0.192
NP_443036.1_8 Forward -230 -211 11.9958 0.28
NP_440999.1_2 Reverse -177 -196 11.7008 0.211
NP_440999.1_9 Forward -361 -347 1.08123 0.171
NP_440999.1_9 Reverse -224 -238 -2.85201 0.279
NP_440888.1_2 Reverse -348 -362 11.7003 0.0611
NP_440888.1_2 Reverse -176 -190 9.53707 0.123
NP_440491.1_1 Forward -265 -246 7.20938 0.274
NP_442033.1_10 Reverse -174 -193 -9.44032 0.215
NP_442033.1_10 Forward -392 -373 -10.9153 0.245
NP_442077.1_8 Reverse -244 -263 9.34008 0.26
NP_441543.1_2 Reverse -349 -358 8.65285 0.0968
NP_441543.1_2 Forward -356 -347 4.52295 0.234
NP_441834.1_7 Forward -369 -350 15.1424 0.248
NP_441304.1_10 Forward -312 -303 13.1761 0.255
NP_440982.1_1 Forward -205 -186 5.99684 0.294
NP_440982.1_1 Forward -390 -371 5.11187 0.294
NP_441469.1_8 Reverse -326 -335 9.93116 0.227
NP_441469.1_8 Forward -358 -349 6.39124 0.227
NP_442337.1_7 Forward -345 -327 24.9952 0.0103
NP_442578.1_7 Forward -356 -349 6.0373 0.18
NP_441462.1_2 Forward -357 -347 8.82982 0.03
NP_441621.1_7 Forward -311 -297 -3.34366 0.188
NP_441621.1_7 Reverse -217 -231 -6.09693 0.275
NP_443062.1_1 Reverse -348 -366 12.3487 0.0811
NP_443062.1_6 Reverse -292 -311 6.98095 0.178
NP_441601.1_4 Forward -202 -183 0.491109 0.262
NP_442204.1_5 Forward -367 -348 0.196116 0.27
NP_440504.1_7 Reverse -51 -70 -4.32711 0.29
NP_441351.1_8 Reverse -325 -344 4.22769 0.225
NP_441351.1_8 Forward -221 -202 4.12936 0.225
NP_440516.1_8 Forward -357 -348 9.4395 0.0183
NP_440516.1_8 Forward -309 -300 7.96454 0.0463
NP_440516.1_8 Reverse -348 -357 5.11294 0.118
NP_442428.1_5 Forward -356 -349 6.13563 0.209
NP_442428.1_5 Reverse -349 -356 6.0373 0.212
NP_441443.1_7 Forward -312 -293 8.45592 0.117
NP_441867.1_2 Reverse -194 -213 4.916 0.1
NP_440673.1_3 Reverse -350 -357 12.4288 0.0426
NP_440673.1_3 Reverse -302 -309 9.77388 0.167
NP_440673.1_3 Reverse -123 -130 6.23397 0.283
NP_440673.1_7 Reverse -242 -261 6.58763 0.155
NP_441052.1_2 Forward -357 -347 0.57002 0.256
NP_442219.1_9 Forward -356 -347 8.75118 0.0681
NP_442219.1_9 Reverse -145 -154 2.55633 0.252
NP_440436.1_4 Reverse -301 -310 9.43907 0.0871
NP_440436.1_4 Reverse -349 -358 8.55409 0.0997
NP_440436.1_4 Forward -356 -347 6.39082 0.162
NP_441884.1_8 Forward -358 -339 -8.85033 0.263
NP_441884.1_9 Forward -231 -212 -11.6036 0.12
NP_441884.1_9 Reverse -173 -192 -14.2585 0.138
NP_441884.1_9 Forward -265 -246 -14.6519 0.138
NP_441884.1_9 Forward -360 -341 -20.7484 0.205
NP_441884.1_9 Forward -267 -248 -21.4367 0.245
NP_440314.1_9 Reverse -220 -239 -7.96535 0.243
NP_442577.1_1 Forward -239 -220 16.0274 0.0181
NP_441719.1_4 Forward -356 -349 6.82395 0.0855
NP_441719.1_4 Reverse -349 -356 6.52896 0.188
NP_441733.1_10 Forward -360 -347 10.344 0.106
NP_440746.1_1 Forward -308 -289 14.7491 0.157
NP_441004.1_1 Forward -315 -296 3.34271 0.106
NP_441004.1_1 Forward -309 -290 -15.5368 0.275
NP_441004.1_1 Forward -231 -212 -15.6352 0.276
NP_441004.1_2 Forward -320 -301 0.786102 0.23
NP_441004.1_2 Reverse -166 -185 -4.6221 0.293
NP_442366.1_3 Forward -358 -340 0.904127 0.161
NP_442206.1_1 Forward -186 -167 6.78429 0.0457
NP_442206.1_10 Forward -357 -342 2.5365 0.201
NP_443054.1_2 Reverse -346 -360 1.76955 0.245
NP_443054.1_2 Reverse -298 -312 -0.492064 0.295
NP_440864.1_9 Forward -89 -70 -7.27704 0.286
NP_441851.1_3 Forward -196 -177 12.0942 0.231
NP_441851.1_10 Forward -358 -348 7.55152 0.137
NP_442208.1_5 Forward -74 -55 -8.06369 0.275
NP_442515.1_1 Forward -186 -172 2.85119 0.129
NP_441396.1_5 Forward -251 -242 8.55452 0.21
NP_441396.1_5 Forward -233 -224 7.27622 0.29
NP_441683.1_4 Forward -346 -327 24.0896 0.0182
NP_441683.1_7 Reverse -92 -111 -9.047 0.284
NP_440593.1_3 Forward -190 -171 3.53937 0.154
NP_440463.1_8 Forward -229 -210 20.8601 0.052
NP_440463.1_8 Forward -195 -176 7.01583 0.267
NP_441046.1_2 Reverse -139 -158 -0.590531 0.282
NP_440432.1_9 Reverse -301 -316 2.24151 0.123
NP_442843.1_1 Reverse -211 -230 -11.8986 0.295
NP_439960.1_6 Reverse -64 -83 7.57094 0.28
NP_439960.1_10 Forward -256 -238 4.6407 0.161
NP_440474.1_8 Reverse -349 -363 9.24208 0.165
NP_442168.1_5 Reverse -52 -71 -3.3438 0.281
NP_440588.1_2 Reverse -23 -42 0.0977854 0.149
NP_440195.1_5 Forward -363 -344 9.3409 0.17
NP_441570.1_1 Forward -262 -244 -9.42063 0.137
NP_441570.1_1 Forward -309 -291 -15.4188 0.23
NP_441570.1_1 Forward -357 -339 -17.1888 0.267
NP_441078.1_4 Reverse -348 -357 0.0980582 0.205
NP_441078.1_4 Forward -357 -348 0.0980582 0.205
NP_441078.1_4 Forward -185 -176 -1.37691 0.254
NP_442388.1_4 Reverse -290 -309 18.4848 0.197
NP_442348.1_2 Forward -343 -334 11.6028 0.232
NP_442443.1_1 Reverse -375 -394 -5.11376 0.281
NP_440526.1_3 Reverse -301 -312 8.02298 0.126
NP_440526.1_3 Reverse -349 -360 2.12315 0.267
NP_441432.1_8 Forward -186 -177 12.2911 0.0444
NP_441432.1_8 Forward -358 -349 5.50626 0.151
NP_442320.1_8 Forward -363 -349 -1.8687 0.0845
NP_442344.1_7 Reverse -349 -368 -8.45701 0.215
NP_441945.1_10 Forward -316 -297 11.6025 0.235
NP_442353.1_4 Reverse -122 -141 0.588665 0.268
NP_441072.1_2 Forward -361 -342 7.17762 0.259
NP_440713.1_4 Reverse -41 -60 1.96607 0.273
NP_440713.1_4 Reverse -338 -357 1.27776 0.289
NP_442489.1_7 Reverse -253 -262 4.91628 0.0892
NP_442489.1_7 Reverse -348 -357 0.786375 0.152
NP_442489.1_7 Forward -357 -348 0.589713 0.17
NP_442489.1_7 Forward -185 -176 -1.37691 0.195
NP_442489.1_7 Reverse -176 -185 -1.6719 0.235
NP_442489.1_7 Reverse -300 -309 -1.77023 0.247
NP_442079.1_7 Forward -308 -289 0.0977854 0.287
NP_440559.1_1 Forward -356 -347 14.7494 0.0118
NP_440559.1_1 Reverse -301 -310 4.22796 0.292
NP_441659.2_8 Reverse -348 -358 6.56821 0.0714
NP_440426.1_7 Forward -20 -1 0.491109 0.262
NP_442913.1_10 Forward -194 -175 -2.0655 0.182
NP_441040.1_2 Forward -193 -174 -5.11376 0.174
NP_440779.1_5 Reverse -348 -365 -14.7108 0.269
NP_442346.1_5 Forward -310 -300 5.38824 0.248
NP_442346.1_5 Reverse -161 -171 4.99491 0.267
NP_442346.1_5 Reverse -347 -357 4.69992 0.276
NP_442346.1_10 Forward -230 -211 2.55606 0.195
NP_442346.1_10 Forward -293 -274 1.17943 0.22
NP_440545.1_3 Forward -396 -379 -5.86102 0.262
NP_440545.1_3 Reverse -344 -361 -6.451 0.28
NP_440545.1_3 Forward -190 -173 -6.94266 0.293
NP_440459.1_2 Reverse -298 -315 9.28195 0.23
NP_440010.1_1 Forward -305 -286 13.6675 0.196
NP_440010.1_2 Forward -176 -157 15.8299 0.298
NP_440010.1_3 Forward -197 -178 21.4356 0.0137
NP_440010.1_5 Forward -330 -311 17.404 0.172
NP_440010.1_6 Forward -374 -355 3.83436 0.242
NP_440010.1_7 Forward -245 -226 15.6341 0.24
NP_441943.1_8 Reverse -207 -226 -4.81876 0.226
NP_441943.1_8 Reverse -180 -199 -13.2752 0.265
NP_442137.1_1 Forward -75 -56 17.2074 0.0601
NP_442551.1_4 Forward -215 -200 5.78142 0.217
NP_442551.1_4 Forward -188 -173 -0.610089 0.245
NP_442551.1_4 Reverse -174 -189 -2.67504 0.275
NP_440847.1_8 Reverse -301 -320 17.6007 0.175
NP_441888.1_8 Reverse -378 -397 8.45592 0.296
NP_441833.1_4 Reverse -349 -356 6.52896 0.0924
NP_441833.1_4 Forward -356 -349 6.23397 0.163
NP_442162.1_9 Forward -356 -349 12.9205 0.0282
NP_442162.1_9 Reverse -349 -356 12.9205 0.0282
NP_440671.1_4 Reverse -294 -308 8.45605 0.198
NP_440671.1_4 Forward -309 -295 7.66941 0.21
NP_440671.1_4 Reverse -176 -190 5.1128 0.292
NP_440772.1_6 Forward -335 -316 15.1424 0.152
NP_442199.1_5 Forward -365 -346 -6.68705 0.28
NP_442140.1_3 Reverse -349 -359 15.418 0.0393
NP_440875.1_9 Reverse -350 -360 17.619 0.0104
NP_441813.1_5 Reverse -346 -356 4.69992 0.148
NP_441813.1_5 Forward -359 -349 0.275027 0.206
NP_440594.1_6 Reverse -231 -250 4.52188 0.3
NP_440590.1_4 Reverse -349 -362 2.37923 0.0913
NP_440590.1_4 Reverse -301 -314 0.0192843 0.173
NP_440590.1_4 Forward -136 -123 -0.0790467 0.176
NP_440590.1_4 Reverse -321 -334 -5.38892 0.277
NP_440567.1_1 Reverse -349 -363 8.55439 0.0567
NP_440567.1_1 Forward -356 -342 7.66941 0.067
NP_442497.1_10 Reverse -349 -358 0.589713 0.153
NP_442497.1_10 Reverse -301 -310 0.29472 0.199
NP_442497.1_10 Forward -356 -347 -1.18024 0.256
NP_440821.1_4 Forward -359 -349 9.02648 0.0364
NP_440821.1_4 Forward -311 -301 -0.0199663 0.217
NP_441239.1_9 Forward -221 -209 5.93884 0.202
NP_441239.1_9 Reverse -346 -358 3.08724 0.296
NP_441239.1_9 Forward -68 -56 2.98891 0.3
NP_441951.1_9 Forward -193 -174 0.58944 0.258
NP_440400.1_1 Reverse -221 -240 -2.55791 0.285
NP_440665.1_1 Reverse -35 -54 -2.36049 0.177
NP_442044.1_1 Forward -191 -172 -7.57203 0.224
NP_442193.1_1 Forward -243 -225 9.85225 0.233
NP_442270.1_9 Forward -196 -177 -11.5053 0.272
NP_440876.1_5 Reverse -302 -321 10.6192 0.245
NP_441526.1_6 Forward -230 -211 9.63589 0.258
NP_441526.1_6 Forward -248 -229 4.71934 0.271
NP_440949.1_7 Reverse -220 -239 8.65176 0.278
NP_442138.1_9 Forward -322 -303 20.9431 0.13
NP_442809.1_6 Forward -321 -302 2.85105 0.256
NP_440546.1_4 Forward -357 -347 12.6639 0.0641
NP_440546.1_4 Reverse -348 -358 10.046 0.109
NP_440546.1_4 Forward -329 -319 6.65249 0.288
NP_441230.1_5 Forward -362 -343 0.0977854 0.275
NP_440462.1_6 Forward -359 -349 8.4365 0.062
NP_440868.1_4 Forward -361 -349 9.47875 0.0482
NP_442479.1_9 Forward -239 -220 1.96607 0.191
NP_441084.1_6 Forward -318 -304 15.9372 0.0707
NP_440696.1_3 Forward -195 -177 5.62401 0.194
NP_440696.1_6 Forward -321 -302 3.83436 0.288
NP_442039.1_4 Forward -356 -349 11.6422 0.0747
NP_441811.1_4 Forward -214 -195 1.47442 0.29
NP_440825.1_7 Forward -356 -346 11.153 0.271
NP_442837.1_3 Forward -356 -349 6.0373 0.25
NP_442837.1_3 Reverse -349 -356 6.0373 0.25
NP_440160.1_2 Reverse -57 -76 -1.27885 0.235
NP_439994.1_3 Forward -42 -23 11.6578 0.178
NP_442053.1_1 Reverse -348 -357 7.17789 0.104
NP_440505.1_3 Forward -359 -349 12.5664 0.0482
NP_440505.1_3 Forward -230 -220 7.25653 0.16
NP_440505.1_3 Forward -75 -65 6.56821 0.176
NP_440505.1_3 Forward -311 -301 4.89658 0.257
NP_442456.1_5 Reverse -320 -338 9.65558 0.26
NP_441203.1_1 Forward -72 -53 -19.4701 0.297
NP_441011.1_8 Reverse -349 -358 7.07956 0.179
NP_441011.1_8 Forward -356 -347 5.99792 0.208
NP_442533.1_1 Forward -306 -287 -13.3736 0.237
NP_442533.1_1 Forward -252 -233 -14.8485 0.247
NP_442533.1_1 Forward -44 -25 -16.8151 0.277
NP_442533.1_6 Forward -219 -210 10.9145 0.0503
NP_442533.1_6 Forward -60 -51 5.50626 0.14
NP_442533.1_6 Forward -357 -348 5.40793 0.14
NP_442533.1_6 Reverse -348 -357 4.52295 0.179
NP_442533.1_6 Reverse -327 -336 1.67135 0.293
NP_442541.1_10 Reverse -176 -190 11.897 0.182
NP_442541.1_10 Reverse -57 -71 0.883986 0.295
NP_442232.1_3 Reverse -49 -68 -10.522 0.27
NP_442232.1_3 Reverse -340 -359 -15.7335 0.296
NP_443016.1_1 Reverse -342 -361 -6.09707 0.254
NP_441482.1_7 Forward -398 -384 -5.01529 0.168
NP_441028.1_4 Forward -306 -292 15.2409 0.174
NP_440115.1_6 Forward -312 -302 8.04317 0.144
NP_441059.1_2 Forward -310 -291 3.93269 0.14
NP_441961.1_4 Forward -227 -208 12.0942 0.223
NP_443045.1_4 Reverse -370 -389 17.109 0.264
NP_441972.1_5 Forward -261 -242 -2.65548 0.187
NP_441106.1_1 Forward -358 -349 8.45619 0.0548
NP_440429.1_2 Reverse -295 -314 10.0292 0.272
NP_441869.1_1 Reverse -167 -186 15.5357 0.287
NP_441869.1_4 Forward -353 -334 10.0292 0.208
NP_441286.1_1 Reverse -347 -359 -4.18925 0.152
NP_441286.1_1 Forward -186 -174 -4.77924 0.175
NP_441286.1_1 Reverse -252 -264 -5.27089 0.194
NP_440670.1_8 Forward -357 -348 8.65285 0.0627
NP_440670.1_8 Reverse -348 -357 6.29291 0.124
NP_440670.1_8 Reverse -300 -309 3.63797 0.239
NP_440886.1_7 Forward -391 -381 6.86274 0.113
NP_442614.1_2 Forward -357 -343 13.5693 0.124
NP_439995.1_5 Forward -367 -348 8.16093 0.24
NP_442072.1_9 Reverse -299 -317 -13.8455 0.123
NP_442072.1_9 Forward -263 -245 -22.597 0.246
NP_441753.1_10 Forward -318 -299 2.16274 0.244
NP_440028.1_6 Forward -308 -290 10.8356 0.277
NP_440028.1_6 Forward -236 -218 9.85225 0.294
NP_440907.2_8 Reverse -349 -359 15.7125 0.0168
NP_441021.1_1 Reverse -301 -320 -8.45701 0.195
NP_441463.1_3 Forward -367 -348 3.93269 0.0965
NP_441626.1_2 Forward -356 -349 12.2322 0.0511
NP_441626.1_2 Reverse -349 -356 5.93897 0.231
NP_442221.1_4 Reverse -159 -178 8.35759 0.296
NP_442794.1_1 Reverse -344 -356 2.30059 0.296
NP_442615.1_1 Reverse -339 -357 6.01734 0.0368
NP_442615.1_1 Forward -366 -348 -5.68405 0.22
NP_441962.1_4 Reverse -214 -233 -1.7705 0.125
NP_441962.1_4 Reverse -343 -362 -2.85214 0.138
NP_441431.1_2 Forward -360 -346 15.3386 0.0501
NP_441431.1_3 Forward -309 -290 10.2259 0.234
NP_441431.1_3 Forward -255 -236 7.96426 0.236
NP_441836.1_2 Reverse -345 -364 4.62101 0.136
NP_441836.1_2 Forward -363 -344 -1.47551 0.219
NP_441836.1_2 Forward -225 -206 -3.24547 0.236
NP_441993.1_1 Forward -262 -243 5.55261 0.2
NP_441993.1_1 Forward -243 -224 1.75177 0.27
NP_441993.1_1 Forward -185 -166 1.4594 0.276
NP_440114.1_10 Reverse -348 -362 12.4876 0.0814
NP_440293.1_1 Forward -193 -174 13.1758 0.163
NP_440293.1_3 Forward -245 -226 -6.49039 0.29
NP_440766.1_4 Reverse -379 -393 8.25939 0.0871
NP_440766.1_4 Forward -313 -299 2.75286 0.172
NP_440766.1_4 Forward -361 -347 2.45787 0.184
NP_440766.1_4 Reverse -178 -192 0.687908 0.271
NP_439988.1_3 Forward -190 -176 5.89945 0.278
NP_441237.1_9 Forward -185 -175 10.6981 0.22
NP_441237.1_9 Reverse -301 -311 10.1081 0.248
NP_440457.1_1 Forward -361 -349 0.530633 0.25
NP_440942.1_9 Reverse -352 -371 9.14342 0.211
NP_440473.1_1 Reverse -29 -48 11.5466 0.273
NP_440473.1_9 Forward -368 -349 -10.227 0.271
NP_441496.1_1 Forward -346 -332 13.1895 0.294
NP_442514.1_5 Forward -200 -181 -9.14605 0.294
NP_440554.1_4 Reverse -349 -359 10.9931 0.0429
NP_441885.1_5 Forward -357 -347 17.3846 0.00578
NP_441885.1_5 Forward -60 -50 -1.29827 0.259
NP_442341.1_7 Reverse -347 -361 8.55439 0.0864
NP_442341.1_7 Forward -393 -379 1.08123 0.299
NP_442341.1_9 Reverse -180 -194 5.60385 0.263
NP_441756.1_5 Forward -230 -211 -0.0988766 0.242
NP_440423.1_6 Forward -365 -346 -14.4552 0.227
NP_440507.2_3 Forward -180 -161 9.04509 0.236
NP_443059.1_1 Reverse -59 -78 10.9142 0.273
NP_441842.1_10 Forward -364 -350 19.4691 0.0142
NP_440275.1_3 Forward -359 -349 15.418 0.0178
NP_440091.1_1 Forward -361 -349 2.89058 0.181
NP_443060.1_5 Reverse -340 -359 6.98015 0.235
NP_442275.1_1 Reverse -47 -66 2.45773 0.284
NP_440679.1_10 Reverse -161 -180 -6.98204 0.175
NP_442451.1_2 Forward -193 -174 -10.4236 0.269
NP_442451.1_2 Reverse -245 -264 -11.6036 0.297
NP_439962.1_4 Reverse -340 -359 0.196116 0.197
NP_439962.1_4 Reverse -211 -230 -1.96717 0.224
NP_439962.1_6 Forward -259 -241 7.29564 0.287
NP_440149.1_8 Forward -262 -243 -1.67217 0.162
NP_440149.1_8 Forward -309 -290 -5.11376 0.219
NP_440149.1_10 Forward -185 -166 -9.93197 0.27
NP_441105.1_3 Forward -368 -349 -8.16202 0.267
NP_440701.1_8 Reverse -51 -70 19.2723 0.155
NP_440172.1_1 Forward -357 -347 7.55152 0.0761
NP_440172.1_1 Reverse -128 -138 2.14332 0.283
NP_440172.1_1 Reverse -253 -263 1.74999 0.299
NP_442015.1_10 Reverse -344 -357 0.60927 0.221
NP_441226.1_7 Forward -356 -349 12.7234 0.0312
NP_441226.1_7 Reverse -349 -356 11.5435 0.0757
NP_441226.1_7 Forward -59 -52 8.29857 0.205
NP_441111.1_7 Reverse -349 -357 8.86921 0.0589
NP_439971.2_8 Forward -269 -255 12.4876 0.285
NP_441766.1_2 Forward -357 -348 8.1612 0.0645
NP_441766.1_2 Reverse -348 -357 5.89959 0.103
NP_440416.1_9 Forward -202 -183 -7.4737 0.102
NP_440416.1_9 Forward -364 -345 -16.5201 0.216
NP_440416.1_9 Reverse -341 -360 -17.2085 0.234
NP_443052.1_9 Reverse -236 -255 5.70265 0.14
NP_443052.1_9 Forward -202 -183 -6.29373 0.281
NP_440072.1_5 Forward -237 -219 -3.6191 0.281
NP_442154.1_1 Forward -230 -212 3.16574 0.0663
NP_442154.1_1 Forward -245 -227 -15.0255 0.218
NP_442154.1_1 Forward -254 -236 -15.5171 0.22
NP_442154.1_1 Forward -308 -290 -15.9105 0.228
NP_442154.1_1 Forward -239 -221 -17.8771 0.272
NP_442154.1_1 Forward -263 -245 -19.2537 0.294
NP_440261.1_5 Reverse -301 -314 -10.5021 0.201
NP_440261.1_5 Reverse -349 -362 -10.8955 0.221
NP_440261.1_5 Forward -184 -171 -12.1738 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAACTTGGCCGATATCACCCGGCAAGCAGACATCCTCGTAGCGGCGATCGGTAAGCCGGAATTTGTCACCGCCGATATGGTCAAACCAGGGGCAATCGTGGTGGATGTGGGTATTAACCGTCTTGATTTAGGAGAGGGGAAATCGACACTGGTGGGGGACGTGGATTTTGCGGGGGTTGCGCCCGTGGCCAGTTACCTCACCCCTGTGCCCGGTGGCATTGGCCCCATGACGGTGACTCTGTTGTTAGCTAACACTGTGGCTAGTTATCGGCAACGGTTAGGTATTTAACTTTAACCACTAATAATCCTAGGTCTCTTGCTACACTGGGGAGCGGACTTGGCCAACCCTAACCTTGTGGGTGATCAAGTTGAACGAACCATTCCAGCCAACCAATAACC

CDS

ATGGGTGATTTTTTAGCCAACGTTTCCCGTTATCCCCGGTATCTGATCAGTTTTACCCTGGGCATCTTTTTCTCCGTTTTCACTTGGCTCCAGCCCCTATTAAAAAATCGTGTCGGGGCGATCGCCCTGATGGGACTGCTGGTCAGTGGATTCATTTTTCTCTATTTCACTCTGCGGGCCATGTTAGGATTGACCGTGTAG

Protein

MGDFLANVSRYPRYLISFTLGIFFSVFTWLQPLLKNRVGAIALMGLLVSGFIFLYFTLRAMLGLTV