Your browser is old and dusty. Try Google Chrome!

Details for ssl1326

ORF ssl1326
Accession NP_440003.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -346 -339 11.3472 0.0978
NP_440694.1_7 Reverse -141 -160 17.2074 0.25
NP_441418.1_6 Reverse -311 -330 -22.0267 0.166
NP_442272.1_2 Forward -127 -108 10.5514 0.248
NP_441453.1_4 Forward -347 -339 7.19758 0.0757
NP_441453.1_4 Reverse -338 -346 4.93597 0.224
NP_442151.1_6 Reverse -338 -352 14.5526 0.0339
NP_441818.1_9 Reverse -318 -337 -0.39387 0.196
NP_441818.1_9 Reverse -306 -325 -3.24547 0.221
NP_441098.1_3 Forward -20 -1 -1.81236 0.277
NP_442173.1_1 Reverse -339 -347 5.62429 0.206
NP_442752.1_4 Forward -347 -340 10.8555 0.0846
NP_442975.1_10 Reverse -334 -348 3.34225 0.259
NP_440784.1_7 Reverse -339 -346 12.4288 0.0475
NP_440784.1_7 Forward -346 -339 6.23397 0.241
NP_442909.1_3 Reverse -338 -357 14.7491 0.177
NP_441476.1_5 Forward -352 -333 2.85105 0.188
NP_441476.1_5 Forward -337 -318 -7.76869 0.29
NP_442972.1_2 Forward -391 -377 12.2903 0.244
NP_440304.1_4 Forward -349 -339 9.22315 0.06
NP_440044.1_8 Forward -346 -327 2.26107 0.155
NP_441208.1_9 Forward -350 -336 4.91614 0.282
NP_440365.1_1 Forward -74 -55 15.8035 0.256
NP_442196.1_10 Forward -356 -337 10.4225 0.259
NP_442110.1_7 Reverse -332 -346 1.57289 0.222
NP_441082.1_10 Reverse -313 -326 9.75405 0.242
NP_441925.1_4 Forward -342 -323 -14.6526 0.263
NP_441925.1_4 Forward -244 -225 -16.6192 0.284
NP_441925.1_4 Forward -336 -317 -17.1108 0.288
NP_440769.1_8 Reverse -150 -169 8.16093 0.246
NP_440856.1_4 Forward -189 -170 -5.21209 0.283
NP_441083.1_5 Reverse -250 -260 3.32329 0.173
NP_441083.1_5 Reverse -338 -348 0.176696 0.241
NP_441434.1_8 Reverse -3 -22 15.7972 0.122
NP_441558.1_5 Reverse -336 -355 10.6192 0.0955
NP_440209.1_1 Forward -347 -339 8.37755 0.0576
NP_440209.1_1 Reverse -338 -346 5.32929 0.139
NP_442136.1_4 Forward -318 -299 5.89851 0.295
NP_441327.1_1 Forward -23 -4 5.84723 0.25
NP_441327.1_1 Forward -132 -113 5.65501 0.25
NP_441327.1_1 Reverse -4 -23 4.88614 0.261
NP_442111.1_3 Forward -384 -371 12.4757 0.287
NP_440906.1_5 Forward -346 -339 6.23397 0.234
NP_440906.1_5 Reverse -339 -346 6.0373 0.262
NP_441486.1_1 Reverse -335 -349 -5.80194 0.26
NP_442145.1_4 Reverse -117 -136 3.29405 0.299
NP_442848.1_1 Reverse -332 -346 1.96621 0.198
NP_442848.1_5 Forward -339 -321 4.73903 0.276
NP_443018.1_3 Forward -346 -339 13.8055 0.024
NP_443018.1_3 Reverse -339 -346 13.6088 0.0352
NP_441634.1_8 Forward -349 -335 6.58777 0.114
NP_440376.1_1 Forward -347 -338 6.48957 0.0963
NP_440376.1_1 Reverse -338 -347 -0.196935 0.285
NP_441588.1_4 Reverse -340 -350 6.37155 0.2
NP_442687.1_1 Reverse -92 -105 15.1616 0.243
NP_442687.1_7 Reverse -337 -347 11.4848 0.0994
NP_441077.1_2 Forward -137 -118 1.76618 0.282
NP_441846.1_10 Reverse -210 -229 -12.6852 0.193
NP_441846.1_10 Reverse -318 -337 -21.3384 0.256
NP_442530.1_2 Reverse -298 -308 15.3197 0.203
NP_441080.1_7 Forward -53 -35 5.91824 0.296
NP_441080.1_7 Reverse -84 -102 5.62325 0.296
NP_440571.1_6 Reverse -58 -77 11.1244 0.296
NP_441763.1_10 Forward -358 -339 5.11187 0.294
NP_442658.1_1 Forward -349 -339 12.1726 0.0615
NP_442658.1_1 Reverse -336 -346 7.25606 0.214
NP_442205.1_9 Reverse -332 -348 -3.67804 0.291
NP_441958.1_5 Forward -348 -338 2.33998 0.0455
NP_441127.1_1 Forward -347 -333 8.35772 0.3
NP_439905.1_1 Forward -346 -333 7.59077 0.255
NP_440443.2_6 Reverse -196 -215 19.935 0.111
NP_439990.1_5 Forward -352 -339 7.29578 0.203
NP_442376.1_2 Reverse -333 -352 -3.24547 0.202
NP_442690.1_1 Reverse -3 -22 -10.7186 0.218
NP_442690.1_1 Reverse -149 -168 -13.9635 0.268
NP_442690.1_1 Reverse -289 -308 -15.7335 0.28
NP_442911.1_2 Reverse -328 -347 -11.1119 0.299
NP_440153.1_8 Reverse -332 -345 -3.71729 0.299
NP_440827.1_5 Reverse -376 -395 21.9273 0.0734
NP_441294.1_7 Reverse -334 -348 11.6503 0.133
NP_441646.1_1 Reverse -331 -350 0.786102 0.243
NP_442438.1_10 Reverse -333 -347 5.50613 0.132
NP_440147.1_4 Forward -349 -336 1.9859 0.213
NP_441550.1_8 Forward -349 -339 5.58445 0.242
NP_441916.1_7 Forward -347 -337 6.37155 0.0988
NP_440465.1_10 Reverse -326 -345 -0.885524 0.29
NP_441041.1_4 Reverse -338 -357 -5.21209 0.15
NP_441041.1_7 Forward -350 -338 7.4176 0.167
NP_441547.1_2 Forward -193 -175 14.6705 0.0948
NP_442004.1_6 Reverse -332 -346 5.30946 0.191
NP_440703.1_9 Reverse -293 -306 5.32859 0.293
NP_441725.1_5 Reverse -339 -349 -0.609952 0.265
NP_439966.1_7 Reverse -336 -346 14.5325 0.0203
NP_439966.1_9 Reverse -336 -345 9.83282 0.215
NP_442941.1_3 Reverse -339 -349 1.25834 0.15
NP_442941.1_3 Reverse -333 -343 -1.29827 0.297
NP_440289.1_2 Forward -262 -249 -2.83231 0.262
NP_440260.1_8 Forward -254 -236 -1.94747 0.242
NP_441079.1_7 Reverse -90 -109 4.71854 0.152
NP_441079.1_7 Forward -134 -115 -2.45958 0.219
NP_441079.1_7 Reverse -82 -101 -4.42619 0.25
NP_442172.1_1 Reverse -58 -77 14.6903 0.189
NP_440647.1_9 Reverse -209 -227 3.85406 0.257
NP_441457.1_7 Forward -349 -330 3.53937 0.234
NP_441644.1_6 Reverse -338 -348 14.6309 0.0117
NP_441644.1_6 Forward -347 -337 4.69947 0.228
NP_443049.1_6 Forward -348 -338 12.1289 0.24
NP_440867.1_7 Reverse -317 -335 15.7521 0.226
NP_442215.1_2 Reverse -336 -352 -2.79306 0.204
NP_442247.1_8 Forward -349 -335 8.35772 0.273
NP_440253.1_2 Forward -259 -241 0.412472 0.188
NP_442933.1_6 Reverse -116 -135 12.3658 0.288
NP_442933.1_10 Forward -347 -338 5.70292 0.165
NP_442554.1_8 Reverse -339 -349 15.3197 0.00882
NP_442554.1_8 Forward -346 -336 5.38824 0.15
NP_442554.1_8 Reverse -251 -261 2.14332 0.281
NP_441762.1_7 Forward -348 -336 4.8572 0.0448
NP_442142.1_4 Reverse -335 -348 9.06515 0.103
NP_442142.1_4 Forward -350 -337 8.37683 0.116
NP_442292.1_1 Reverse -339 -348 14.5527 0.017
NP_442476.1_6 Forward -346 -332 1.37622 0.219
NP_441865.1_3 Reverse -152 -170 14.2771 0.242
NP_442301.1_2 Forward -336 -317 9.24175 0.205
NP_442301.1_2 Forward -339 -320 4.42355 0.279
NP_441198.1_8 Forward -349 -339 10.4392 0.271
NP_441468.1_1 Forward -346 -339 13.8055 0.0242
NP_441468.1_1 Reverse -339 -346 6.0373 0.223
NP_441020.2_6 Reverse -248 -265 5.54538 0.298
NP_441015.1_10 Reverse -309 -328 -10.817 0.288
NP_441015.1_10 Reverse -321 -340 -11.0136 0.29
NP_441673.1_1 Forward -347 -338 1.37636 0.114
NP_441673.1_1 Reverse -338 -347 1.1797 0.163
NP_441731.1_1 Forward -41 -23 13.4663 0.281
NP_441876.1_9 Forward -224 -214 12.8609 0.267
NP_441826.1_2 Reverse -332 -346 7.17775 0.0899
NP_442811.1_2 Reverse -306 -325 -3.04881 0.281
NP_441637.1_9 Reverse -7 -25 -2.63579 0.292
NP_442719.1_2 Reverse -293 -311 -3.91481 0.204
NP_442719.1_2 Reverse -7 -25 -11.6829 0.294
NP_441251.1_7 Reverse -9 -22 15.1623 0.266
NP_442227.1_2 Forward -336 -317 2.85105 0.223
NP_442227.1_2 Forward -330 -311 0.392778 0.252
NP_442808.1_1 Reverse -337 -347 16.3025 0.0139
NP_442808.1_1 Forward -334 -324 1.65123 0.282
NP_442820.1_7 Reverse -343 -356 19.3905 0.196
NP_442342.1_9 Reverse -336 -352 21.593 0.0235
NP_440385.1_6 Reverse -49 -68 17.4269 0.107
NP_440558.1_2 Forward -341 -322 -6.09707 0.271
NP_440558.1_2 Reverse -335 -354 -6.58872 0.277
NP_442789.1_4 Reverse -318 -337 -6.39206 0.285
NP_441878.1_6 Forward -348 -338 1.74999 0.0642
NP_441878.1_6 Reverse -337 -347 -0.41329 0.177
NP_441036.1_8 Reverse -337 -347 5.5849 0.271
NP_441557.1_5 Forward -347 -338 1.08137 0.0794
NP_441557.1_5 Reverse -338 -347 0.589713 0.134
NP_441590.1_4 Forward -333 -314 4.32522 0.288
NP_441590.1_4 Forward -336 -317 2.35861 0.296
NP_442066.2_9 Forward -263 -250 6.31247 0.297
NP_441433.1_8 Forward -186 -167 -0.197208 0.244
NP_440101.1_3 Reverse -333 -352 2.55606 0.253
NP_441458.1_8 Reverse -13 -32 3.34933 0.273
NP_441564.1_2 Reverse -323 -342 4.52268 0.119
NP_440248.1_1 Forward -114 -95 18.289 0.23
NP_442166.1_7 Reverse -339 -353 15.7325 0.157
NP_441574.1_1 Reverse -326 -345 -2.45882 0.226
NP_441574.1_1 Reverse -320 -339 -7.76869 0.293
NP_442347.1_2 Reverse -388 -397 8.06287 0.116
NP_442645.1_2 Reverse -330 -349 -3.73712 0.0505
NP_440547.1_5 Forward -353 -334 9.43923 0.225
NP_441037.1_4 Forward -349 -339 13.7499 0.0541
NP_442594.1_8 Reverse -318 -337 6.09597 0.236
NP_441633.1_3 Forward -334 -321 -5.09393 0.223
NP_440136.1_2 Forward -346 -339 6.52896 0.116
NP_440136.1_2 Reverse -339 -346 6.13563 0.193
NP_442590.1_10 Reverse -332 -351 4.12936 0.281
NP_442998.1_5 Forward -262 -252 12.2714 0.175
NP_442998.1_10 Reverse -340 -347 6.13563 0.181
NP_442998.1_10 Forward -192 -185 3.97235 0.297
NP_440299.1_1 Reverse -334 -347 3.06699 0.261
NP_441799.1_1 Reverse -334 -348 12.0937 0.0476
NP_441007.1_10 Reverse -315 -328 4.73917 0.182
NP_440256.1_1 Forward -350 -331 -3.54046 0.135
NP_440915.1_6 Forward -351 -337 2.16287 0.124
NP_442866.1_1 Reverse -333 -352 2.65439 0.156
NP_442866.1_1 Reverse -306 -325 -5.11376 0.24
NP_441464.1_10 Reverse -316 -330 9.14437 0.263
NP_441939.1_3 Forward -193 -174 10.2259 0.128
NP_442386.1_9 Reverse -337 -346 16.2239 0.0144
NP_440570.1_5 Forward -357 -338 -4.03212 0.299
NP_441340.1_5 Reverse -339 -346 13.5105 0.0314
NP_441340.1_5 Forward -346 -339 6.23397 0.132
NP_441340.1_9 Forward -174 -164 16.0642 0.194
NP_442327.1_3 Reverse -101 -120 5.20389 0.28
NP_440161.1_3 Reverse -300 -319 16.9124 0.0774
NP_440586.1_1 Reverse -316 -335 1.17943 0.231
NP_440586.1_8 Reverse -339 -346 11.3468 0.0736
NP_440586.1_8 Forward -346 -339 9.47853 0.146
NP_441262.1_3 Forward -347 -340 5.25066 0.215
NP_443051.1_1 Forward -348 -339 9.83282 0.0203
NP_439937.1_9 Forward -348 -331 -16.0881 0.287
NP_440439.1_1 Reverse -335 -348 -0.865694 0.241
NP_440439.1_6 Forward -28 -9 2.0644 0.277
NP_440372.1_2 Forward -346 -339 6.62729 0.151
NP_440372.1_2 Reverse -339 -346 6.52896 0.188
NP_440316.1_10 Forward -348 -338 15.5163 0.168
NP_439977.1_5 Reverse -332 -351 5.01433 0.15
NP_440699.1_1 Forward -139 -120 3.867 0.288
NP_441877.1_9 Forward -27 -10 3.97208 0.284
NP_442572.1_6 Reverse -268 -287 6.98095 0.295
NP_441018.1_7 Reverse -328 -347 6.09597 0.299
NP_442262.1_10 Forward -346 -339 13.0188 0.0314
NP_442262.1_10 Reverse -339 -346 11.6422 0.092
NP_440344.1_10 Forward -354 -337 -11.9575 0.235
NP_440531.1_6 Forward -336 -317 -0.983855 0.226
NP_441640.1_8 Reverse -339 -358 -1.96717 0.225
NP_440297.1_9 Reverse -339 -349 0.0783647 0.282
NP_440999.1_9 Reverse -334 -348 7.37441 0.0878
NP_440888.1_2 Reverse -338 -352 6.98048 0.212
NP_442277.1_4 Reverse -329 -348 4.42355 0.197
NP_442277.1_7 Forward -75 -59 -0.375166 0.224
NP_442033.1_10 Reverse -336 -355 -3.83545 0.171
NP_441759.1_2 Reverse -330 -349 -0.983855 0.287
NP_441543.1_2 Reverse -339 -348 13.6677 0.0218
NP_441551.1_5 Reverse -334 -350 11.2676 0.174
NP_441178.1_6 Forward -336 -317 8.06178 0.26
NP_441469.1_4 Reverse -319 -338 6.4893 0.286
NP_441469.1_8 Reverse -337 -346 14.1594 0.0551
NP_441469.1_8 Forward -348 -339 5.40793 0.272
NP_442315.1_2 Forward -306 -294 11.052 0.291
NP_440148.1_6 Reverse -121 -135 16.6434 0.255
NP_441462.1_2 Reverse -338 -348 0.57002 0.144
NP_441462.1_2 Forward -347 -337 -0.41329 0.225
NP_441621.1_7 Reverse -336 -350 2.65453 0.123
NP_443062.1_1 Reverse -338 -356 6.8883 0.19
NP_442204.1_1 Forward -351 -340 9.89177 0.0736
NP_442204.1_1 Forward -186 -175 1.4353 0.271
NP_441351.1_8 Reverse -336 -355 5.60432 0.202
NP_441351.1_8 Reverse -321 -340 4.52268 0.225
NP_442780.1_3 Reverse -120 -139 8.54611 0.258
NP_442872.1_1 Forward -328 -309 -13.7669 0.267
NP_440516.1_8 Forward -347 -338 9.24284 0.0264
NP_441785.1_1 Reverse -368 -382 11.7688 0.285
NP_442428.1_5 Forward -346 -339 14.1988 0.0242
NP_442428.1_5 Reverse -339 -346 6.0373 0.212
NP_441353.1_8 Reverse -328 -347 16.8083 0.245
NP_441867.1_2 Reverse -268 -287 -11.7019 0.231
NP_440673.1_3 Reverse -340 -347 11.6422 0.0724
NP_441052.1_2 Reverse -338 -348 7.94484 0.0576
NP_442219.1_8 Reverse -328 -347 7.39404 0.267
NP_442219.1_8 Reverse -240 -259 7.10414 0.277
NP_440436.1_4 Reverse -339 -348 6.29249 0.164
NP_441884.1_9 Forward -262 -243 -23.6983 0.284
NP_440648.1_1 Reverse -338 -357 3.93269 0.232
NP_441719.1_4 Forward -346 -339 6.62729 0.151
NP_441719.1_4 Reverse -339 -346 6.52896 0.188
NP_442366.1_3 Reverse -337 -355 1.69077 0.144
NP_439949.1_7 Forward -27 -13 12.8809 0.258
NP_440296.1_10 Reverse -208 -227 -6.88371 0.229
NP_441115.1_4 Reverse -337 -355 9.26148 0.221
NP_443054.1_2 Forward -262 -248 5.70279 0.225
NP_442430.1_10 Forward -357 -338 11.7983 0.245
NP_441668.1_4 Forward -45 -26 1.37609 0.215
NP_442515.1_1 Forward -162 -148 -4.52363 0.298
NP_441046.1_2 Forward -172 -153 -0.983855 0.287
NP_442689.1_8 Reverse -153 -170 -1.92778 0.225
NP_439960.1_4 Forward -189 -170 15.7316 0.153
NP_441124.1_5 Reverse -158 -168 15.5864 0.188
NP_441031.1_1 Forward -131 -112 7.01554 0.259
NP_442006.1_2 Forward -188 -171 -16.0874 0.238
NP_442006.1_2 Reverse -179 -196 -17.5624 0.279
NP_440078.1_10 Reverse -323 -342 2.85105 0.269
NP_441078.1_4 Forward -347 -338 7.66954 0.052
NP_441078.1_4 Reverse -338 -347 0.491382 0.188
NP_442729.1_8 Reverse -328 -341 6.50913 0.193
NP_442443.1_1 Reverse -318 -337 -1.08219 0.23
NP_440526.1_3 Reverse -339 -350 1.92649 0.267
NP_441432.1_8 Forward -348 -339 14.0611 0.0258
NP_442344.1_7 Reverse -339 -358 -7.37537 0.182
NP_441732.1_2 Forward -351 -335 -5.64466 0.0478
NP_440290.1_1 Reverse -158 -167 17.3727 0.21
NP_440199.1_4 Forward -131 -113 16.1401 0.203
NP_442489.1_7 Forward -347 -338 8.1612 0.0294
NP_442489.1_7 Reverse -338 -347 0.491382 0.178
NP_442079.1_7 Forward -346 -327 0.884433 0.27
NP_441659.2_8 Reverse -338 -348 9.32148 0.0321
NP_441022.1_1 Forward -14 -5 14.7117 0.183
NP_441022.1_1 Forward -171 -162 13.2728 0.216
NP_442346.1_5 Forward -348 -338 7.05986 0.183
NP_440545.1_3 Forward -351 -334 2.10379 0.106
NP_440459.1_2 Forward -356 -339 12.2319 0.156
NP_442603.1_7 Reverse -177 -191 5.40719 0.296
NP_441233.1_2 Reverse -321 -340 12.5858 0.261
NP_441050.1_5 Reverse -316 -334 -0.865831 0.256
NP_441833.1_4 Forward -346 -339 6.23397 0.163
NP_441833.1_4 Reverse -339 -346 6.13563 0.198
NP_441895.1_10 Reverse -206 -225 -27.7299 0.29
NP_442162.1_9 Forward -346 -339 6.62729 0.142
NP_442162.1_9 Reverse -339 -346 6.43063 0.208
NP_442943.1_1 Forward -22 -7 6.45526 0.203
NP_442199.1_5 Reverse -177 -196 -4.91709 0.233
NP_442140.1_3 Forward -346 -336 18.2696 0.0159
NP_441813.1_5 Reverse -336 -346 0.176696 0.215
NP_440590.1_4 Reverse -339 -352 2.96921 0.0783
NP_440567.1_1 Forward -346 -332 7.17775 0.0764
NP_442497.1_10 Reverse -339 -348 7.76787 0.0731
NP_440821.1_4 Reverse -336 -346 6.56821 0.0853
NP_441239.1_9 Reverse -336 -348 16.3619 0.0175
NP_441239.1_9 Forward -349 -337 3.67722 0.279
NP_441892.1_1 Forward -356 -339 -2.02611 0.217
NP_442044.1_1 Forward -347 -328 -14.0619 0.283
NP_442270.1_9 Forward -358 -339 -12.3902 0.294
NP_440219.1_1 Forward -106 -87 14.1783 0.216
NP_442629.1_3 Reverse -307 -326 17.699 0.0751
NP_441769.1_3 Forward -131 -112 -3.83621 0.245
NP_441541.1_1 Reverse -118 -136 -1.43039 0.238
NP_441541.1_1 Forward -27 -9 -3.91318 0.27
NP_441541.1_1 Reverse -1 -19 -3.91318 0.27
NP_441936.1_6 Reverse -239 -258 16.5182 0.287
NP_441617.1_6 Reverse -152 -171 -7.17871 0.292
NP_442138.1_10 Forward -259 -240 -8.06369 0.296
NP_440546.1_4 Forward -347 -337 12.4699 0.0679
NP_440546.1_4 Reverse -338 -348 9.17338 0.151
NP_440462.1_6 Reverse -336 -346 7.15819 0.089
NP_441184.1_3 Reverse -330 -349 3.24438 0.293
NP_442611.1_1 Forward -352 -333 3.93269 0.202
NP_440868.1_4 Reverse -334 -346 11.052 0.0358
NP_442499.1_1 Forward -228 -209 3.34271 0.257
NP_441474.1_1 Forward -337 -318 1.17865 0.247
NP_441848.1_4 Forward -22 -6 8.12362 0.288
NP_441848.1_4 Reverse -6 -22 8.02812 0.288
NP_442460.1_3 Forward -295 -276 16.1257 0.208
NP_440696.1_3 Reverse -334 -352 -1.45582 0.259
NP_440696.1_6 Forward -359 -340 5.80098 0.266
NP_442039.1_4 Forward -346 -339 6.3323 0.289
NP_442039.1_7 Forward -345 -335 14.0414 0.211
NP_442837.1_3 Forward -346 -339 6.0373 0.25
NP_442837.1_3 Reverse -339 -346 5.93897 0.265
NP_442053.1_1 Forward -347 -338 7.86621 0.0863
NP_442053.1_1 Reverse -338 -347 6.39124 0.136
NP_440505.1_3 Reverse -321 -331 5.97822 0.202
NP_441959.1_8 Forward -21 -8 8.61288 0.286
NP_442532.1_7 Forward -347 -333 14.8476 0.0644
NP_440914.1_1 Forward -347 -337 6.17532 0.293
NP_441011.1_8 Forward -346 -337 11.7994 0.0629
NP_441011.1_8 Reverse -339 -348 6.98123 0.18
NP_442533.1_1 Reverse -314 -333 -16.8151 0.277
NP_442533.1_6 Reverse -338 -347 7.66954 0.0897
NP_442533.1_6 Forward -347 -338 6.8829 0.101
NP_442533.1_6 Forward -341 -332 2.458 0.255
NP_442232.1_3 Reverse -330 -349 -12.8819 0.282
NP_442232.1_3 Reverse -316 -335 -15.7335 0.296
NP_442322.1_4 Forward -335 -318 8.78956 0.143
NP_442322.1_4 Forward -336 -319 2.20142 0.21
NP_441219.1_6 Reverse -328 -346 9.55725 0.274
NP_441482.1_7 Forward -188 -174 -10.8168 0.216
NP_441697.1_5 Reverse -114 -133 -9.1199 0.268
NP_441028.1_6 Forward -192 -182 3.51951 0.292
NP_440116.1_8 Reverse -339 -358 4.42435 0.0722
NP_441527.1_4 Forward -71 -52 -4.34531 0.184
NP_440007.1_9 Forward -351 -337 3.63784 0.268
NP_441106.1_1 Forward -348 -339 15.3394 0.012
NP_440429.1_2 Forward -346 -327 9.73422 0.272
NP_442306.1_10 Forward -352 -333 -20.4534 0.21
NP_441286.1_1 Forward -348 -336 -5.36923 0.197
NP_441479.1_9 Reverse -338 -356 15.6538 0.271
NP_440886.1_7 Reverse -337 -347 17.4824 0.0022
NP_440886.1_7 Forward -336 -326 4.60114 0.227
NP_440828.1_4 Reverse -328 -347 -4.32786 0.246
NP_442401.1_2 Forward -336 -317 12.585 0.159
NP_442213.1_5 Reverse -313 -332 -1.37718 0.293
NP_442022.1_4 Reverse -320 -339 7.47261 0.268
NP_442022.1_4 Reverse -308 -327 5.99764 0.273
NP_440907.2_8 Reverse -339 -349 6.27276 0.175
NP_442264.1_2 Reverse -328 -345 8.59364 0.211
NP_441463.1_3 Reverse -328 -347 -2.36049 0.153
NP_441463.1_7 Forward -149 -130 12.7825 0.285
NP_441626.1_2 Forward -346 -339 6.52896 0.137
NP_441626.1_2 Reverse -339 -346 5.93897 0.231
NP_442615.1_1 Forward -356 -338 -4.50408 0.188
NP_442615.1_1 Reverse -176 -194 -7.55234 0.296
NP_441962.1_4 Reverse -333 -352 -13.3736 0.272
NP_440387.1_1 Forward -347 -331 -4.75968 0.198
NP_441431.1_2 Reverse -335 -349 18.2885 0.0199
NP_441431.1_3 Reverse -311 -330 4.71934 0.263
NP_441488.1_7 Forward -353 -334 7.07928 0.134
NP_441488.1_8 Forward -352 -338 8.84875 0.172
NP_442647.1_7 Forward -325 -312 16.7355 0.122
NP_441836.1_1 Forward -193 -174 14.6161 0.182
NP_440114.1_10 Forward -347 -333 10.6193 0.142
NP_440492.1_9 Reverse -110 -124 10.8495 0.294
NP_440293.1_10 Reverse -317 -336 0.884433 0.219
NP_440766.1_5 Reverse -156 -168 7.65579 0.288
NP_440643.1_6 Reverse -174 -193 4.71934 0.214
NP_442930.1_1 Reverse -162 -172 12.5659 0.239
NP_441981.1_3 Forward -396 -382 14.1146 0.287
NP_442680.1_5 Reverse -236 -255 2.31911 0.237
NP_440942.1_3 Reverse -260 -279 1.0811 0.298
NP_441332.1_6 Forward -327 -317 13.3894 0.189
NP_441332.1_6 Reverse -337 -347 13.1957 0.19
NP_442936.1_10 Forward -172 -158 14.0491 0.216
NP_440554.1_4 Reverse -339 -349 5.87989 0.129
NP_441885.1_5 Forward -341 -331 -1.59326 0.273
NP_443000.1_7 Forward -349 -339 0.963343 0.278
NP_441842.1_10 Forward -354 -340 7.37441 0.258
NP_440091.1_1 Reverse -334 -346 2.89058 0.181
NP_442275.1_1 Forward -311 -292 4.22769 0.274
NP_441397.1_8 Forward -179 -166 12.6667 0.256
NP_442451.1_2 Forward -340 -321 -9.44032 0.259
NP_439962.1_4 Forward -340 -321 -2.85214 0.241
NP_439962.1_4 Forward -328 -309 -3.04881 0.245
NP_439962.1_4 Forward -337 -318 -3.73712 0.257
NP_441105.1_3 Forward -358 -339 -4.72043 0.204
NP_442373.1_2 Reverse -317 -336 4.71934 0.148
NP_440216.1_1 Forward -347 -333 -11.6035 0.203
NP_440172.1_1 Forward -347 -337 6.96153 0.0959
NP_440167.1_3 Reverse -319 -338 8.45592 0.28
NP_441226.1_7 Reverse -339 -346 14.1984 0.024
NP_441111.1_7 Reverse -339 -347 8.86921 0.0589
NP_441766.1_2 Reverse -338 -347 8.45619 0.0593
NP_441766.1_2 Forward -186 -177 2.16301 0.262
NP_440416.1_9 Forward -340 -321 -16.5201 0.216
NP_440072.1_1 Forward -341 -327 18.5835 0.189
NP_442116.1_6 Forward -22 -5 10.3653 0.221
NP_442116.1_6 Reverse -5 -22 7.88248 0.254
NP_442403.1_9 Reverse -308 -327 4.03102 0.246
NP_442154.1_1 Reverse -309 -327 -7.35568 0.141
NP_442154.1_1 Reverse -321 -339 -13.6489 0.217
NP_442154.1_1 Reverse -318 -336 -15.2222 0.218
NP_442154.1_6 Reverse -322 -341 1.86774 0.244
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCTTGGGCATCAAACAGGTCAATAGTTAAGCCTGACATGAGACTCAGCTCATAGGCGATGGCGGCCCCTACAACCCCCGCCCCAATAACGGCAATGTTTGGCATAGGTTAGTTTCTCTGTTGCTCGAATCTTGATCATAGGGCAGATCTCGATTTTGCTCTCACCTCAAAACGTCCTTGACCCCGTCTCCCAGTAAATAACCTTTCATCTTTCGCCCGGTCGATAGTAGAAAAAATTTTGTCAAAAGCAACCTTAGTTGCTAGAATTATAAATATCTTAAATACTTTAACTTAAGAGTTTAGAATTTTAGTTATCTAGGTATCTAGACTATAAAAATTAAAAGCTAGTAGATTACTGTAAACTTAGGCAAGCAATTGTAAATTATTCAAAAACTTTAAGT

CDS

ATGTCGAAGTCTAGTAACTTAAATTCTGTGAGCAAAGTCAGCAAAAATTTTTCCACCAAGCAGACCACCATTCGCCTGGAGAGCAAGATGATGGAGCGGCTCACCAAGCTCTGTGCGAAGGAAGGTTTGAGCAGGGAAGTTTTATTTGAGGCTTTATTCGAACACTATATAGAGGACAAAGAGGCCTGGACTGCAATTCTGGAACAGGCTAAGCAGAAGGCTGAATTTCGTCAGGCGATCGCCAACCATAAACGGGCTAAAACGATGATGGAAAAGTTTGGCTAG

Protein

MSKSSNLNSVSKVSKNFSTKQTTIRLESKMMERLTKLCAKEGLSREVLFEALFEHYIEDKEAWTAILEQAKQKAEFRQAIANHKRAKTMMEKFG