Your browser is old and dusty. Try Google Chrome!

Details for ssl1263

ORF ssl1263
Accession NP_442690.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Reverse -130 -149 14.4666 0.118
NP_441418.1_6 Reverse -2 -21 -21.4367 0.149
NP_441418.1_6 Reverse -358 -377 -22.42 0.177
NP_441418.1_6 Forward -39 -20 -30.3848 0.274
NP_441453.1_4 Forward -210 -202 4.24765 0.259
NP_441453.1_4 Forward -39 -31 4.14932 0.264
NP_442151.1_6 Forward -184 -170 5.01447 0.298
NP_441630.1_3 Forward -55 -36 -0.885524 0.29
NP_441098.1_3 Forward -254 -235 -5.64052 0.28
NP_442287.1_1 Reverse -161 -171 13.3526 0.277
NP_439997.1_4 Forward -101 -82 8.55425 0.223
NP_439997.1_4 Reverse -121 -140 7.27595 0.266
NP_440784.1_7 Forward -209 -202 10.2655 0.0801
NP_442909.1_7 Reverse -371 -385 5.89884 0.264
NP_440061.1_9 Forward -41 -27 4.91554 0.3
NP_441054.1_2 Reverse -272 -291 12.8808 0.217
NP_442062.1_8 Forward -39 -29 12.6647 0.0292
NP_442062.1_8 Forward -210 -200 4.20827 0.228
NP_442972.1_1 Reverse -130 -148 8.05852 0.287
NP_441802.1_1 Forward -392 -373 5.211 0.286
NP_440304.1_4 Reverse -28 -38 5.97822 0.185
NP_440304.1_4 Reverse -199 -209 5.28991 0.218
NP_441935.1_6 Reverse -21 -40 20.4523 0.176
NP_441208.1_9 Reverse -27 -41 6.58777 0.241
NP_442742.1_9 Reverse -380 -399 -0.39387 0.181
NP_442742.1_9 Reverse -98 -117 -13.9635 0.289
NP_441082.1_10 Reverse -276 -289 11.0324 0.236
NP_441925.1_4 Reverse -31 -50 -1.18128 0.155
NP_441083.1_5 Forward -39 -29 -0.314959 0.265
NP_442827.1_8 Reverse -272 -291 1.37531 0.181
NP_441434.1_1 Reverse -87 -101 10.9932 0.233
NP_441434.1_7 Reverse -32 -46 8.25939 0.225
NP_441738.1_2 Forward -287 -280 10.0685 0.125
NP_441558.1_2 Reverse -275 -294 7.66927 0.257
NP_442889.1_1 Forward -45 -26 -1.47551 0.145
NP_442889.1_8 Forward -42 -28 3.53891 0.275
NP_440447.1_1 Forward -215 -197 2.0841 0.285
NP_441713.1_1 Reverse -195 -214 -14.1602 0.257
NP_442570.1_3 Reverse -204 -223 -8.85033 0.294
NP_440906.1_5 Reverse -12 -19 5.64398 0.292
NP_440438.2_8 Reverse -133 -152 0.491109 0.296
NP_440747.1_10 Reverse -27 -39 -4.18925 0.0817
NP_440747.1_10 Forward -42 -30 -12.4491 0.282
NP_442145.1_4 Reverse -132 -151 12.9387 0.123
NP_442634.1_4 Reverse -199 -213 5.21113 0.0635
NP_442634.1_4 Reverse -372 -386 -4.4253 0.201
NP_440470.1_5 Forward -149 -130 7.87766 0.268
NP_440842.1_10 Forward -378 -364 4.81781 0.254
NP_441012.1_4 Reverse -32 -45 5.72248 0.291
NP_443018.1_3 Forward -38 -31 10.7572 0.0907
NP_443018.1_3 Reverse -31 -38 4.56234 0.241
NP_443018.1_3 Reverse -202 -209 4.26735 0.267
NP_443018.1_3 Forward -209 -202 4.16902 0.278
NP_441634.1_8 Reverse -196 -210 -2.16369 0.295
NP_440376.1_1 Reverse -30 -39 6.48957 0.0963
NP_440376.1_1 Forward -39 -30 6.19458 0.109
NP_440376.1_1 Forward -171 -162 1.86802 0.238
NP_442687.1_7 Reverse -29 -39 9.12481 0.0994
NP_442687.1_7 Forward -40 -30 4.60159 0.243
NP_442191.1_4 Reverse -262 -276 11.8657 0.238
NP_441077.1_6 Reverse -223 -239 11.5749 0.149
NP_441077.1_6 Reverse -137 -153 10.3216 0.164
NP_441077.1_6 Forward -156 -140 10.1288 0.164
NP_442485.1_3 Forward -109 -90 -5.01543 0.287
NP_441763.1_10 Forward -214 -195 6.1935 0.272
NP_442658.1_1 Reverse -199 -209 15.6142 0.0114
NP_442658.1_1 Reverse -28 -38 12.3692 0.0569
NP_442658.1_1 Reverse -160 -170 6.56775 0.224
NP_442658.1_9 Forward -57 -38 12.8808 0.28
NP_442782.1_2 Reverse -201 -215 12.291 0.173
NP_442782.1_2 Reverse -374 -388 2.35953 0.275
NP_440184.1_1 Forward -311 -292 1.34491 0.28
NP_439959.1_6 Reverse -213 -232 7.66927 0.247
NP_442937.1_5 Reverse -362 -381 10.2259 0.168
NP_441958.1_5 Reverse -29 -39 1.06167 0.116
NP_442486.1_4 Forward -248 -229 8.06259 0.273
NP_440203.1_5 Forward -36 -26 11.9759 0.168
NP_439905.1_1 Reverse -31 -44 9.16406 0.221
NP_442876.1_6 Reverse -129 -147 13.3709 0.23
NP_440984.1_7 Reverse -196 -210 8.94771 0.133
NP_440984.1_9 Reverse -200 -213 24.012 0.0575
NP_439990.1_5 Reverse -151 -164 7.09911 0.212
NP_442376.1_2 Reverse -157 -176 -13.1769 0.286
NP_442690.1_1 Forward -149 -130 30.8754 0.000221
NP_442690.1_1 Reverse -128 -147 -6.88371 0.169
NP_442690.1_3 Forward -220 -201 17.404 0.257
NP_442911.1_2 Reverse -191 -210 -4.91709 0.145
NP_442911.1_2 Forward -220 -201 -10.7186 0.286
NP_442536.1_4 Forward -52 -34 7.39397 0.299
NP_443055.1_3 Forward -47 -28 12.0775 0.231
NP_440602.1_8 Forward -341 -327 14.2576 0.155
NP_441129.1_3 Forward -284 -265 -7.86702 0.162
NP_440147.1_4 Reverse -28 -41 7.29578 0.0712
NP_441916.1_7 Reverse -30 -40 5.97822 0.111
NP_441916.1_7 Reverse -201 -211 4.60159 0.169
NP_441916.1_7 Reverse -374 -384 2.53664 0.25
NP_440345.1_5 Forward -142 -128 15.2889 0.269
NP_441041.1_7 Reverse -27 -39 4.79381 0.295
NP_442004.1_6 Reverse -201 -215 1.37622 0.29
NP_441725.1_5 Forward -38 -28 7.64985 0.0904
NP_439966.1_7 Forward -291 -281 9.71433 0.104
NP_439966.1_7 Forward -41 -31 4.50281 0.269
NP_439966.1_7 Reverse -199 -209 4.30615 0.279
NP_439966.1_9 Reverse -278 -287 16.126 0.0863
NP_440983.1_5 Forward -382 -363 -2.0655 0.231
NP_442281.1_1 Reverse -25 -39 15.3386 0.0129
NP_441079.1_7 Reverse -231 -250 -3.73788 0.238
NP_442500.1_8 Reverse -223 -237 8.63588 0.291
NP_441556.1_4 Reverse -21 -40 12.9937 0.201
NP_441556.1_4 Forward -213 -194 10.4871 0.279
NP_441644.1_6 Forward -39 -29 10.0093 0.0649
NP_442215.1_2 Forward -41 -25 3.99177 0.0889
NP_442215.1_2 Reverse -257 -273 -0.43312 0.167
NP_442029.1_10 Reverse -263 -282 4.71934 0.29
NP_442933.1_10 Reverse -201 -210 12.3894 0.0245
NP_442933.1_10 Reverse -30 -39 4.52295 0.24
NP_441751.2_8 Forward -19 -5 -4.13031 0.163
NP_442554.1_8 Forward -209 -199 5.48657 0.146
NP_442554.1_8 Forward -38 -28 3.91327 0.203
NP_442554.1_8 Reverse -31 -41 3.91327 0.203
NP_442970.1_3 Forward -148 -130 12.8662 0.224
NP_441762.1_7 Forward -211 -199 -4.9759 0.185
NP_442142.1_4 Forward -213 -200 9.16348 0.101
NP_442142.1_4 Reverse -27 -40 4.34528 0.223
NP_440775.1_4 Forward -358 -339 12.2875 0.216
NP_442476.1_6 Forward -209 -195 2.5562 0.179
NP_442197.1_7 Forward -221 -202 13.8641 0.22
NP_443009.1_5 Reverse -29 -40 9.98959 0.0841
NP_443009.1_5 Forward -211 -200 4.18809 0.259
NP_440397.1_5 Reverse -37 -56 19.7187 0.0714
NP_440357.1_3 Forward -41 -22 1.17943 0.275
NP_440357.1_3 Reverse -278 -297 -0.590531 0.296
NP_441198.1_8 Reverse -28 -38 10.6345 0.254
NP_441468.1_1 Reverse -202 -209 10.2655 0.0906
NP_441468.1_1 Reverse -31 -38 4.07068 0.263
NP_441020.2_6 Reverse -199 -216 10.0686 0.154
NP_441673.1_1 Reverse -30 -39 1.37636 0.114
NP_441673.1_1 Forward -39 -30 1.1797 0.163
NP_442253.1_5 Forward -272 -255 -2.61609 0.282
NP_441764.1_1 Forward -150 -131 10.9142 0.176
NP_441764.1_8 Reverse -229 -239 14.0861 0.284
NP_441764.1_8 Forward -390 -380 11.7892 0.284
NP_442868.1_6 Reverse -160 -170 2.04498 0.205
NP_442719.1_3 Reverse -348 -361 14.8666 0.297
NP_441612.1_2 Forward -107 -97 8.06522 0.236
NP_442019.1_2 Reverse -198 -217 18.4857 0.212
NP_442808.1_1 Forward -40 -30 6.56775 0.107
NP_442050.1_5 Forward -291 -281 11.5826 0.0915
NP_441114.1_3 Forward -37 -28 17.1093 0.113
NP_440558.1_2 Reverse -203 -222 2.16274 0.17
NP_440558.1_2 Forward -273 -254 -5.40875 0.258
NP_440558.1_2 Forward -219 -200 -7.4737 0.294
NP_441878.1_6 Reverse -29 -39 12.0747 0.013
NP_441878.1_6 Forward -40 -30 1.16001 0.11
NP_441878.1_6 Reverse -200 -210 0.865012 0.132
NP_441878.1_6 Reverse -159 -169 -7.78811 0.266
NP_441557.1_5 Reverse -30 -39 0.491382 0.144
NP_441557.1_5 Forward -39 -30 0.29472 0.174
NP_441557.1_5 Reverse -201 -210 -0.590259 0.219
NP_442066.2_9 Forward -43 -30 8.08242 0.193
NP_442830.1_3 Reverse -359 -377 23.3236 0.00838
NP_442830.1_5 Forward -40 -26 4.03056 0.239
NP_442183.1_1 Forward -210 -196 7.86607 0.131
NP_441407.1_6 Forward -334 -315 1.67108 0.291
NP_442397.1_9 Reverse -253 -272 4.12936 0.26
NP_442645.1_2 Forward -47 -28 -6.78538 0.0946
NP_442645.1_2 Forward -218 -199 -15.2418 0.194
NP_442645.1_2 Reverse -204 -223 -18.2901 0.27
NP_441037.1_4 Reverse -28 -38 6.44058 0.263
NP_440235.1_6 Reverse -343 -353 17.0188 0.247
NP_442317.1_6 Reverse -155 -174 4.62101 0.246
NP_441633.1_3 Forward -41 -28 -3.81562 0.177
NP_442998.1_5 Forward -108 -98 11.9764 0.176
NP_442998.1_5 Reverse -185 -195 9.22315 0.248
NP_440299.1_1 Reverse -370 -383 7.68852 0.107
NP_441799.1_1 Reverse -26 -40 10.2254 0.0778
NP_441799.1_1 Forward -214 -200 6.78381 0.162
NP_441799.1_1 Forward -293 -279 3.73557 0.284
NP_441007.1_5 Forward -38 -19 12.7825 0.203
NP_441007.1_10 Reverse -196 -209 1.19926 0.207
NP_440256.1_1 Forward -213 -194 -8.65367 0.264
NP_441118.1_2 Reverse -178 -197 11.6025 0.228
NP_441559.1_8 Reverse -35 -49 5.70279 0.0864
NP_441559.1_8 Forward -43 -29 -4.4253 0.223
NP_440717.1_1 Forward -382 -363 6.39097 0.265
NP_440243.1_1 Forward -240 -221 17.9043 0.2
NP_442866.1_1 Reverse -275 -294 3.24438 0.151
NP_442866.1_1 Forward -44 -25 -3.44213 0.221
NP_440748.1_5 Forward -219 -200 3.24438 0.21
NP_441464.1_1 Forward -283 -264 9.3409 0.24
NP_440695.1_6 Forward -355 -341 11.4779 0.265
NP_442993.1_1 Reverse -30 -46 -12.5278 0.274
NP_440677.1_1 Reverse -21 -40 13.1758 0.134
NP_442386.1_9 Forward -40 -31 4.7192 0.289
NP_441291.1_4 Forward -31 -12 18.3873 0.14
NP_441340.1_5 Forward -209 -202 4.07068 0.239
NP_441340.1_5 Reverse -281 -288 3.97235 0.274
NP_441340.1_5 Forward -38 -31 3.97235 0.274
NP_441340.1_9 Reverse -136 -146 8.54444 0.256
NP_441340.1_9 Forward -98 -88 7.29115 0.289
NP_440161.1_3 Forward -41 -22 16.8141 0.0774
NP_440586.1_1 Reverse -197 -216 -6.39206 0.299
NP_442959.1_5 Forward -149 -130 8.06259 0.229
NP_441262.1_3 Reverse -280 -287 11.6422 0.0477
NP_440027.1_3 Reverse -30 -48 1.88669 0.295
NP_440027.1_8 Reverse -257 -276 15.3382 0.144
NP_439937.1_9 Reverse -37 -54 -10.7782 0.233
NP_439937.1_9 Forward -50 -33 -12.1548 0.27
NP_441740.2_10 Reverse -206 -225 17.7974 0.111
NP_440316.1_10 Reverse -29 -39 6.8632 0.251
NP_442384.1_10 Reverse -30 -43 7.09911 0.0875
NP_440699.1_1 Reverse -233 -252 1.76618 0.288
NP_441018.1_7 Reverse -197 -216 10.8159 0.194
NP_442790.1_4 Reverse -271 -290 2.45773 0.0729
NP_442262.1_10 Forward -38 -31 9.87221 0.164
NP_442262.1_10 Forward -340 -333 7.90559 0.266
NP_441689.1_5 Forward -343 -333 5.48612 0.251
NP_442165.1_3 Reverse -228 -242 18.4416 0.143
NP_440282.1_10 Reverse -20 -39 -9.34199 0.277
NP_440282.1_10 Forward -220 -201 -10.3253 0.297
NP_440531.1_6 Reverse -22 -41 -1.86883 0.241
NP_442917.1_1 Forward -315 -296 8.65176 0.25
NP_442910.1_1 Reverse -23 -42 2.85105 0.118
NP_442832.1_2 Forward -221 -202 15.6341 0.239
NP_441965.1_10 Reverse -198 -214 6.25339 0.183
NP_441965.1_10 Forward -42 -26 2.91013 0.28
NP_442750.1_3 Reverse -183 -202 -12.7836 0.288
NP_440297.1_9 Forward -38 -28 7.35486 0.126
NP_442187.1_5 Reverse -229 -248 17.2074 0.261
NP_442280.1_10 Reverse -202 -220 6.23363 0.28
NP_441896.1_3 Forward -48 -29 -3.04881 0.294
NP_440888.1_2 Forward -210 -196 8.94708 0.142
NP_442277.1_4 Forward -83 -64 3.44025 0.224
NP_442033.1_10 Reverse -268 -287 -10.227 0.23
NP_441543.1_2 Forward -209 -200 6.78456 0.138
NP_441551.1_5 Reverse -197 -213 10.5792 0.193
NP_441469.1_8 Reverse -29 -38 9.63616 0.227
NP_441469.1_8 Reverse -200 -209 5.70292 0.257
NP_441469.1_8 Forward -40 -31 5.50626 0.265
NP_440710.1_1 Forward -47 -29 -1.75081 0.185
NP_441462.1_2 Forward -39 -29 0.471689 0.148
NP_441462.1_2 Reverse -201 -211 -0.0199663 0.177
NP_441621.1_7 Reverse -278 -292 -2.95034 0.188
NP_443062.1_6 Reverse -22 -41 17.404 0.0578
NP_442204.1_1 Forward -400 -389 -0.432984 0.299
NP_442204.1_5 Reverse -364 -383 -0.197208 0.28
NP_442537.1_3 Forward -187 -168 17.699 0.231
NP_440516.1_8 Reverse -280 -289 -0.68859 0.297
NP_442428.1_5 Reverse -202 -209 4.66067 0.244
NP_442428.1_5 Reverse -31 -38 4.46401 0.267
NP_440673.1_3 Forward -37 -30 8.98723 0.203
NP_440077.1_2 Reverse -375 -393 18.7995 0.175
NP_440436.1_4 Forward -38 -29 9.73406 0.0871
NP_440436.1_4 Forward -209 -200 5.80084 0.182
NP_441884.1_9 Forward -388 -369 -22.125 0.275
NP_441884.1_9 Reverse -157 -176 -23.2067 0.284
NP_441884.1_9 Forward -172 -153 -24.6816 0.288
NP_441004.1_4 Reverse -62 -72 10.0098 0.258
NP_441004.1_5 Reverse -26 -40 7.76774 0.284
NP_442813.1_4 Reverse -265 -284 -8.35868 0.299
NP_441034.1_4 Forward -79 -60 16.3877 0.148
NP_442206.1_1 Forward -39 -20 -2.85214 0.156
NP_441851.1_10 Reverse -29 -39 6.27322 0.178
NP_441851.1_10 Reverse -200 -210 6.17489 0.182
NP_441851.1_10 Forward -40 -30 4.50326 0.266
NP_442515.1_1 Reverse -29 -43 1.76955 0.149
NP_442515.1_1 Reverse -159 -173 -3.54032 0.292
NP_441396.1_5 Reverse -152 -161 16.2243 0.203
NP_440593.1_3 Forward -79 -60 -6.1954 0.271
NP_441982.1_6 Reverse -342 -351 11.9124 0.288
NP_442689.1_8 Forward -145 -128 16.0668 0.0659
NP_441349.1_10 Forward -393 -374 0.294447 0.089
NP_440874.1_2 Forward -245 -226 11.2293 0.255
NP_442843.1_1 Reverse -31 -50 -2.0655 0.202
NP_439960.1_6 Forward -216 -197 19.6656 0.0955
NP_440474.1_8 Forward -288 -274 9.6354 0.158
NP_441124.1_5 Reverse -136 -146 10.5254 0.286
NP_440431.1_3 Forward -211 -192 -9.24366 0.242
NP_440431.1_3 Forward -40 -21 -11.2103 0.284
NP_442168.1_5 Forward -220 -201 -0.590531 0.264
NP_440195.1_4 Reverse -163 -182 8.55425 0.207
NP_440943.1_4 Reverse -22 -34 14.887 0.227
NP_441078.1_4 Reverse -30 -39 8.1612 0.039
NP_441078.1_4 Forward -39 -30 0.983037 0.151
NP_441078.1_4 Reverse -201 -210 -1.96689 0.282
NP_441539.1_1 Forward -150 -136 21.8284 0.0585
NP_440707.1_6 Reverse -32 -51 11.2084 0.274
NP_442443.1_1 Forward -55 -36 -3.14714 0.264
NP_440793.1_1 Forward -236 -222 11.602 0.279
NP_441094.1_7 Reverse -269 -288 16.2791 0.244
NP_441432.1_8 Reverse -29 -38 6.5879 0.112
NP_441432.1_9 Forward -153 -140 8.69532 0.287
NP_441333.1_1 Forward -151 -141 11.4946 0.247
NP_442320.1_8 Reverse -195 -209 -4.13031 0.148
NP_440685.1_3 Forward -344 -325 19.3707 0.0678
NP_440760.1_1 Reverse -30 -49 -20.5517 0.223
NP_442489.1_7 Reverse -30 -39 8.1612 0.0294
NP_442489.1_7 Forward -39 -30 7.76787 0.0518
NP_442489.1_7 Reverse -201 -210 -1.47524 0.203
NP_441659.2_8 Forward -39 -29 7.45319 0.0601
NP_439956.1_7 Reverse -195 -214 2.65439 0.273
NP_441800.1_10 Reverse -367 -386 2.65439 0.252
NP_442346.1_5 Reverse -29 -39 14.4347 0.0134
NP_440545.1_3 Reverse -370 -387 -2.81276 0.193
NP_440025.1_3 Forward -42 -28 13.5152 0.24
NP_441629.1_1 Reverse -64 -83 6.58763 0.255
NP_440010.1_10 Reverse -355 -374 1.96607 0.292
NP_442551.1_4 Forward -41 -26 -0.905081 0.245
NP_441888.1_7 Reverse -266 -280 5.80112 0.225
NP_441888.1_7 Forward -44 -30 1.67122 0.241
NP_441329.1_3 Forward -351 -341 15.3887 0.25
NP_442162.1_9 Reverse -281 -288 9.28223 0.0694
NP_440671.1_1 Forward -152 -133 10.2463 0.191
NP_440224.1_4 Forward -194 -175 1.76941 0.244
NP_442943.1_1 Reverse -130 -145 7.12518 0.202
NP_442140.1_3 Forward -288 -278 6.76487 0.159
NP_442140.1_3 Forward -209 -199 4.20827 0.254
NP_442140.1_3 Reverse -31 -41 3.61828 0.288
NP_441813.1_5 Forward -41 -31 -0.216628 0.237
NP_442028.1_1 Forward -239 -226 7.51014 0.292
NP_442254.1_1 Reverse -18 -37 -5.99873 0.297
NP_440567.1_1 Forward -170 -156 2.16287 0.182
NP_442497.1_10 Forward -38 -29 0.196389 0.208
NP_440821.1_4 Reverse -199 -209 -0.511621 0.269
NP_440227.1_2 Reverse -129 -145 8.80999 0.29
NP_441239.1_9 Reverse -28 -40 10.9537 0.0695
NP_441239.1_9 Reverse -199 -211 10.4621 0.0783
NP_441239.1_9 Forward -291 -279 9.87208 0.0941
NP_441239.1_9 Forward -41 -29 9.28209 0.11
NP_441239.1_9 Forward -212 -200 4.26721 0.256
NP_442568.1_8 Forward -221 -207 8.06273 0.296
NP_442193.1_1 Forward -39 -21 7.19731 0.295
NP_442629.1_5 Forward -398 -384 17.1092 0.174
NP_440573.1_3 Forward -255 -242 16.2954 0.19
NP_441541.1_1 Forward -151 -133 1.33887 0.225
NP_440354.1_5 Reverse -62 -81 1.76941 0.272
NP_442052.1_8 Reverse -28 -38 15.3197 0.253
NP_440546.1_4 Reverse -201 -211 10.5308 0.109
NP_442349.1_6 Reverse -157 -176 1.86774 0.214
NP_441230.1_5 Forward -44 -25 2.16274 0.223
NP_440462.1_6 Forward -291 -281 5.78156 0.138
NP_442402.1_4 Forward -190 -171 -3.34455 0.214
NP_442402.1_4 Reverse -91 -110 -8.75273 0.284
NP_442402.1_10 Forward -352 -342 11.2876 0.264
NP_441848.1_4 Reverse -130 -146 16.1449 0.151
NP_441084.1_6 Forward -212 -198 15.7433 0.0775
NP_439942.1_1 Reverse -138 -157 15.8971 0.24
NP_440696.1_3 Forward -49 -31 4.24738 0.2
NP_442039.1_4 Reverse -281 -288 10.8555 0.109
NP_442273.1_10 Forward -222 -204 12.3105 0.115
NP_442380.1_10 Reverse -357 -375 10.1472 0.259
NP_442829.1_2 Reverse -118 -134 8.72089 0.287
NP_441959.1_7 Forward -384 -370 17.4042 0.205
NP_442844.1_3 Reverse -216 -235 13.0775 0.148
NP_442532.1_1 Reverse -225 -239 8.75312 0.294
NP_440914.1_1 Reverse -162 -172 8.12715 0.207
NP_442533.1_6 Forward -39 -30 8.25953 0.0776
NP_442533.1_6 Reverse -30 -39 7.66954 0.0897
NP_442533.1_6 Forward -210 -201 5.11294 0.155
NP_442533.1_6 Reverse -201 -210 4.81794 0.172
NP_442541.1_1 Reverse -18 -37 8.55425 0.288
NP_441482.1_7 Forward -216 -202 -11.6035 0.275
NP_441697.1_5 Forward -366 -347 -10.5523 0.28
NP_441028.1_6 Forward -192 -182 4.50281 0.278
NP_442351.1_9 Reverse -272 -286 19.5605 0.276
NP_442202.1_10 Reverse -29 -43 5.01447 0.255
NP_441527.1_4 Reverse -118 -137 -13.1306 0.298
NP_441680.1_4 Forward -375 -356 3.14605 0.221
NP_442492.1_2 Reverse -280 -299 0.392778 0.241
NP_440608.1_1 Forward -315 -296 13.5014 0.182
NP_440572.1_5 Reverse -335 -354 15.2408 0.233
NP_441602.1_3 Forward -44 -25 -2.0655 0.232
NP_441106.1_1 Reverse -200 -209 5.50626 0.145
NP_441106.1_1 Forward -211 -202 5.01461 0.191
NP_441825.1_4 Forward -172 -162 17.8763 0.158
NP_440670.1_8 Forward -39 -30 5.3096 0.167
NP_441930.1_2 Reverse -29 -39 15.9097 0.19
NP_440886.1_7 Forward -40 -30 7.64939 0.0865
NP_440513.1_4 Forward -289 -270 7.96426 0.295
NP_442295.1_7 Forward -289 -271 12.5064 0.289
NP_440907.2_8 Forward -288 -278 4.30615 0.269
NP_442842.1_4 Reverse -300 -319 4.62101 0.249
NP_442893.1_4 Forward -242 -223 -0.0996487 0.251
NP_442794.1_1 Forward -191 -179 3.18557 0.286
NP_441401.1_4 Reverse -223 -236 13.3923 0.277
NP_441401.1_4 Reverse -129 -142 12.999 0.297
NP_441962.1_4 Forward -215 -196 -0.197208 0.117
NP_440387.1_1 Reverse -374 -390 -5.54633 0.238
NP_440387.1_1 Reverse -30 -46 -5.54633 0.238
NP_441431.1_2 Forward -42 -28 8.94708 0.2
NP_441174.1_1 Forward -278 -263 15.1229 0.231
NP_441174.1_2 Forward -213 -199 16.1259 0.0864
NP_440114.1_10 Reverse -30 -44 10.6193 0.142
NP_441510.2_7 Forward -382 -368 10.8154 0.28
NP_440293.1_3 Reverse -22 -41 1.47442 0.207
NP_440766.1_5 Reverse -134 -146 10.9025 0.268
NP_440766.1_5 Forward -109 -97 9.56563 0.275
NP_441237.1_9 Forward -38 -28 14.0414 0.0535
NP_441979.1_5 Reverse -358 -377 -17.8968 0.262
NP_441801.1_4 Reverse -42 -52 3.12662 0.231
NP_442680.1_5 Forward -111 -92 2.80756 0.237
NP_442297.1_3 Forward -80 -61 7.96345 0.289
NP_441984.1_3 Reverse -19 -37 7.4923 0.246
NP_440473.1_9 Reverse -269 -288 -12.2919 0.296
NP_441253.1_8 Reverse -25 -39 11.9241 0.227
NP_442936.1_10 Reverse -187 -201 8.49823 0.269
NP_440554.1_4 Forward -288 -278 2.7333 0.254
NP_440554.1_4 Forward -209 -199 1.55333 0.296
NP_442862.1_3 Reverse -196 -213 7.90532 0.252
NP_440628.1_1 Reverse -225 -235 16.5762 0.248
NP_442703.1_9 Forward -399 -381 5.03403 0.244
NP_442703.1_9 Reverse -126 -144 4.54237 0.249
NP_442341.1_7 Forward -40 -26 1.08123 0.299
NP_442341.1_9 Forward -41 -27 10.5204 0.133
NP_442369.1_6 Forward -300 -290 16.0639 0.186
NP_441842.1_10 Reverse -367 -381 10.1277 0.171
NP_440275.1_3 Reverse -278 -288 5.68323 0.136
NP_442275.1_1 Forward -48 -29 0.982764 0.284
NP_442275.1_1 Forward -49 -30 -0.295539 0.295
NP_441397.1_8 Reverse -134 -147 14.5765 0.189
NP_441635.1_1 Reverse -224 -243 9.31004 0.236
NP_440175.1_7 Reverse -197 -215 10.0463 0.268
NP_442495.1_4 Reverse -150 -160 12.6647 0.218
NP_440149.1_8 Reverse -30 -49 -5.31042 0.223
NP_441105.1_3 Reverse -190 -209 -5.70374 0.223
NP_442127.1_1 Forward -236 -218 12.0147 0.213
NP_441730.1_2 Reverse -349 -367 5.52568 0.299
NP_440216.1_1 Reverse -30 -44 -12.1934 0.247
NP_440172.1_1 Reverse -201 -211 7.55152 0.0761
NP_440172.1_1 Forward -39 -29 3.61828 0.222
NP_440172.1_1 Reverse -30 -40 2.7333 0.268
NP_441111.1_7 Forward -209 -201 -0.570565 0.233
NP_442379.1_10 Forward -217 -200 -3.40274 0.259
NP_442116.1_6 Forward -352 -335 5.78166 0.291
NP_442564.1_2 Reverse -32 -51 7.17762 0.253
NP_440261.1_5 Forward -38 -25 -10.5021 0.201
NP_440988.1_10 Reverse -365 -379 6.93189 0.228
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGAGTTGGTGGAGCAAAGATGTCGCCCACGGGCACAGTAGTCAAGATATTTTTCAGAAACAGATTGCGGTTTTCTATTCTGAAGAACCCAAAGAAATTCTTAATGAAAGACCCAATCGCAGCAAGCCGCGGGGTATGCGCAACCCATTTTTAGATCAATCAAATTTTCTCTTTTTCTCAGAAAAGGCAAAGCCAGCGCCGCAATAATTCTTTCCCTATGGTCTCCATAGGGGTTTGCGCCCCCATGAAATGTTAATTTTTGCTACAATTTATGCCAGTTTCTTAGCTAGTTGGGCCAAAACTAGAATAACTTCTGGTTTGCCGGGACCCATCAGCCAAGATTAATTACTGGGGGAGTTCCGGCCATTGCCCAGATAGTGAACTATCACCTTGATCACCC

CDS

ATGGGAGGATTGACCGTGAATCTAGAAACTCTGGAATTCGTCATTTACCCCGACGGCCGGGTGAAGGAAACGGTAACCGGCATTGTGGGTCGCTCTTGTCAGGAAGTGACCGCGGCGATCGAGGCCGAACTAGGGGTAGTGCTTACCCAGCAGACTACTTCGGAGTTTTTTGCCCAAACCAGTCCGTTGAACCAATCAGTTCAGCAATCCCAGACTCTTTCTAGCTGGCCTGGGGGAAGTTAA

Protein

MGGLTVNLETLEFVIYPDGRVKETVTGIVGRSCQEVTAAIEAELGVVLTQQTTSEFFAQTSPLNQSVQQSQTLSSWPGGS