Your browser is old and dusty. Try Google Chrome!

Details for ssl1255

ORF ssl1255
Accession NP_442696.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -114 -128 12.586 0.209
NP_441061.1_2 Reverse -29 -43 9.73436 0.0698
NP_441061.1_2 Reverse -23 -37 0.491246 0.207
NP_441061.1_2 Forward -276 -262 -0.590395 0.234
NP_441061.1_2 Reverse -148 -162 -2.26202 0.287
NP_440557.1_1 Reverse -38 -57 4.12936 0.188
NP_440795.1_7 Reverse -194 -201 10.8555 0.132
NP_440795.1_7 Forward -36 -29 8.8889 0.188
NP_440694.1_6 Reverse -360 -379 7.37428 0.238
NP_441418.1_6 Forward -46 -27 -19.4701 0.0888
NP_441418.1_6 Reverse -193 -212 -29.5982 0.23
NP_441418.1_6 Forward -372 -353 -29.8932 0.245
NP_440815.1_5 Forward -93 -74 3.93269 0.286
NP_441453.1_4 Forward -46 -38 6.70593 0.121
NP_441453.1_4 Reverse -370 -378 4.24765 0.259
NP_441623.1_1 Reverse -271 -289 -4.70074 0.275
NP_441623.1_1 Forward -296 -278 -4.79907 0.279
NP_441960.1_3 Forward -46 -27 12.555 0.291
NP_442151.1_6 Reverse -37 -51 7.47274 0.197
NP_442151.1_6 Forward -202 -188 5.21113 0.288
NP_442169.1_1 Reverse -327 -346 7.17762 0.26
NP_443002.1_5 Reverse -29 -47 8.86816 0.297
NP_442173.1_1 Reverse -250 -258 6.01761 0.2
NP_442173.1_1 Reverse -38 -46 5.82095 0.2
NP_442752.1_4 Forward -46 -39 13.8055 0.0199
NP_441745.1_3 Forward -168 -149 13.6666 0.282
NP_442975.1_10 Reverse -33 -47 10.9137 0.0516
NP_442975.1_10 Reverse -235 -249 7.96378 0.112
NP_440784.1_7 Forward -201 -194 9.67555 0.104
NP_440784.1_7 Reverse -38 -45 6.23397 0.241
NP_440784.1_7 Forward -45 -38 6.13563 0.241
NP_442861.1_4 Forward -390 -371 0.293673 0.297
NP_441934.1_8 Reverse -367 -386 12.5858 0.292
NP_440061.1_9 Reverse -276 -290 5.80051 0.272
NP_440110.1_8 Forward -306 -287 -0.000545616 0.216
NP_439979.1_9 Forward -383 -365 7.39397 0.288
NP_442062.1_8 Forward -248 -238 4.60159 0.206
NP_442062.1_8 Reverse -370 -380 4.40493 0.217
NP_441859.1_3 Forward -47 -28 3.04693 0.25
NP_442242.1_4 Forward -45 -38 12.4288 0.0393
NP_442097.1_7 Reverse -213 -232 13.6675 0.121
NP_441620.1_4 Forward -112 -93 19.6656 0.0746
NP_441208.1_9 Forward -289 -275 4.52282 0.299
NP_441925.1_4 Reverse -271 -290 -16.0292 0.278
NP_440856.1_1 Reverse -143 -162 5.99764 0.146
NP_441083.1_5 Reverse -37 -47 9.81313 0.0224
NP_441738.1_2 Reverse -39 -46 15.28 0.0102
NP_440209.1_1 Forward -46 -38 14.8674 0.012
NP_440209.1_1 Reverse -37 -45 5.62429 0.0821
NP_442889.1_8 Reverse -367 -381 5.01387 0.243
NP_442889.1_8 Reverse -34 -48 3.53891 0.275
NP_440178.1_7 Forward -288 -269 -22.715 0.272
NP_442570.1_3 Forward -387 -368 -0.0988766 0.208
NP_441025.1_5 Reverse -226 -240 14.4542 0.258
NP_441163.1_1 Reverse -254 -271 5.44632 0.274
NP_441533.1_9 Forward -162 -143 15.7324 0.3
NP_440906.1_5 Forward -45 -38 12.0355 0.0724
NP_440906.1_5 Reverse -38 -45 12.0355 0.0724
NP_440747.1_10 Forward -49 -37 5.15219 0.0179
NP_440747.1_10 Forward -40 -28 -12.0557 0.199
NP_441486.1_1 Reverse -34 -48 -4.52363 0.201
NP_441486.1_1 Reverse -367 -381 -5.80194 0.26
NP_442634.1_2 Forward -332 -313 3.44104 0.278
NP_440403.1_10 Forward -46 -27 10.4225 0.186
NP_440057.1_4 Reverse -226 -245 14.5758 0.204
NP_442848.1_5 Reverse -368 -386 3.55906 0.276
NP_442848.1_5 Forward -38 -20 -3.32411 0.291
NP_441012.1_4 Reverse -235 -248 11.1307 0.256
NP_441012.1_4 Reverse -30 -43 10.5407 0.262
NP_443018.1_3 Forward -378 -371 12.5271 0.0523
NP_443018.1_3 Reverse -371 -378 12.5271 0.0523
NP_443018.1_3 Forward -45 -38 5.34899 0.212
NP_443018.1_3 Reverse -38 -45 5.34899 0.212
NP_443018.1_3 Reverse -29 -36 4.56234 0.241
NP_443018.1_3 Forward -36 -29 4.46401 0.244
NP_443018.1_3 Reverse -194 -201 4.07068 0.299
NP_441316.1_7 Reverse -35 -50 2.43817 0.154
NP_441634.1_8 Forward -48 -34 5.30946 0.114
NP_440376.1_1 Forward -156 -147 2.35967 0.224
NP_440376.1_1 Forward -248 -239 1.37636 0.252
NP_440376.1_1 Forward -287 -278 0.884706 0.259
NP_440376.1_1 Forward -46 -37 -0.000272808 0.285
NP_440376.1_1 Reverse -37 -46 -0.0986038 0.285
NP_441588.1_4 Reverse -39 -49 9.02648 0.14
NP_440266.1_3 Reverse -218 -234 13.3469 0.29
NP_442687.1_7 Forward -203 -193 10.5014 0.0994
NP_442687.1_7 Forward -151 -141 7.05986 0.142
NP_442191.1_7 Forward -307 -288 12.5858 0.206
NP_442485.1_3 Reverse -26 -45 0.982764 0.234
NP_442485.1_3 Forward -48 -29 0.0977854 0.247
NP_441846.1_10 Reverse -192 -211 -13.0786 0.197
NP_441846.1_10 Forward -288 -269 -13.5702 0.206
NP_440042.1_1 Forward -75 -56 8.16093 0.238
NP_440667.1_2 Forward -369 -350 -1.57384 0.231
NP_442658.1_1 Reverse -35 -45 13.2542 0.04
NP_442658.1_1 Reverse -368 -378 6.86274 0.214
NP_442782.1_2 Forward -258 -244 0.392915 0.29
NP_442544.1_2 Reverse -185 -199 0.589577 0.217
NP_441256.1_1 Forward -348 -329 -7.37537 0.239
NP_442937.1_5 Reverse -23 -42 9.63589 0.185
NP_442937.1_5 Forward -279 -260 7.96426 0.237
NP_441958.1_5 Forward -47 -37 -6.41148 0.28
NP_441127.1_1 Forward -280 -266 14.9459 0.134
NP_440203.1_5 Reverse -40 -50 11.8776 0.171
NP_440984.1_7 Forward -51 -37 8.65272 0.139
NP_440984.1_7 Reverse -143 -157 5.60446 0.248
NP_441097.1_2 Forward -296 -279 9.87194 0.223
NP_439990.1_5 Forward -51 -38 5.82081 0.272
NP_442911.1_2 Reverse -18 -37 -2.55715 0.0995
NP_440153.1_5 Forward -286 -272 0.786239 0.289
NP_440325.1_1 Reverse -133 -152 14.1591 0.188
NP_442536.1_8 Forward -369 -350 13.6675 0.226
NP_443055.1_6 Reverse -29 -47 10.9331 0.114
NP_443055.1_8 Reverse -221 -239 17.6196 0.246
NP_440993.1_4 Reverse -370 -387 1.8088 0.3
NP_440062.1_6 Forward -32 -13 3.34271 0.235
NP_441646.1_1 Reverse -140 -159 -1.96717 0.298
NP_442431.1_10 Forward -165 -147 3.95239 0.213
NP_442431.1_10 Forward -168 -150 -0.374176 0.287
NP_440879.1_6 Reverse -32 -51 -3.44213 0.279
NP_441292.1_2 Forward -298 -279 -5.99873 0.241
NP_441000.1_6 Forward -380 -366 -3.24533 0.221
NP_440147.1_4 Forward -48 -35 0.707601 0.247
NP_441175.1_7 Reverse -37 -56 14.5524 0.0965
NP_441550.1_8 Forward -48 -38 5.28945 0.255
NP_441041.1_7 Reverse -34 -46 13.0539 0.0526
NP_441041.1_7 Reverse -246 -258 6.83453 0.19
NP_441547.1_1 Forward -50 -31 4.22769 0.226
NP_441725.1_5 Forward -201 -191 -0.609952 0.265
NP_441725.1_5 Reverse -371 -381 -1.29827 0.299
NP_441406.1_2 Forward -292 -273 12.6841 0.191
NP_439966.1_7 Reverse -35 -45 9.22267 0.119
NP_439966.1_7 Reverse -368 -378 4.60114 0.265
NP_439966.1_9 Reverse -35 -44 9.93116 0.186
NP_442941.1_3 Reverse -38 -48 1.35667 0.15
NP_440289.1_2 Reverse -34 -47 9.55739 0.0339
NP_440289.1_2 Reverse -367 -380 -5.09393 0.297
NP_440983.1_5 Reverse -256 -275 -7.96535 0.294
NP_442281.1_1 Reverse -365 -379 11.897 0.0428
NP_442281.1_1 Forward -377 -363 3.14559 0.243
NP_442847.1_3 Forward -384 -365 6.68515 0.235
NP_442256.1_2 Reverse -35 -53 -6.96235 0.214
NP_442012.1_2 Reverse -368 -387 10.4225 0.142
NP_441556.1_10 Reverse -142 -156 9.44312 0.298
NP_441644.1_6 Reverse -370 -380 9.81266 0.0678
NP_441644.1_6 Reverse -37 -47 5.87944 0.174
NP_441644.1_6 Reverse -256 -266 4.40448 0.239
NP_441644.1_6 Forward -37 -27 3.8145 0.261
NP_443049.1_6 Reverse -192 -202 13.4952 0.162
NP_442215.1_1 Forward -383 -364 1.76941 0.296
NP_442215.1_2 Reverse -35 -51 0.255197 0.154
NP_442215.1_2 Forward -204 -188 -0.43312 0.167
NP_442215.1_2 Reverse -361 -377 -2.10475 0.192
NP_442215.1_2 Reverse -145 -161 -2.20308 0.193
NP_442029.1_6 Forward -286 -267 8.65258 0.204
NP_440253.1_2 Forward -46 -28 11.0322 0.0345
NP_440253.1_2 Forward -372 -354 5.52568 0.093
NP_442933.1_10 Forward -46 -37 5.40793 0.19
NP_441751.2_8 Reverse -29 -43 3.93283 0.0596
NP_442554.1_8 Forward -378 -368 11.9764 0.0312
NP_442554.1_8 Reverse -371 -381 8.73149 0.0682
NP_442554.1_8 Reverse -29 -39 7.84651 0.0825
NP_442554.1_8 Reverse -38 -48 5.5849 0.145
NP_442554.1_8 Forward -36 -26 4.40493 0.188
NP_442554.1_8 Forward -201 -191 3.61828 0.218
NP_442554.1_8 Forward -276 -266 3.02829 0.245
NP_441762.1_7 Forward -47 -35 4.66053 0.0458
NP_441762.1_7 Reverse -192 -204 1.31728 0.0747
NP_441762.1_7 Reverse -36 -48 -7.63084 0.296
NP_442142.1_4 Reverse -34 -47 16.8333 0.0264
NP_442142.1_4 Reverse -153 -166 6.21356 0.17
NP_442142.1_4 Forward -382 -369 6.0169 0.175
NP_442292.1_1 Reverse -38 -47 8.75118 0.0306
NP_442292.1_1 Reverse -29 -38 5.80125 0.129
NP_442301.1_2 Reverse -270 -289 3.73524 0.288
NP_441715.1_4 Reverse -250 -260 5.5849 0.197
NP_440357.1_3 Reverse -35 -54 2.85105 0.245
NP_440357.1_3 Reverse -26 -45 -0.787193 0.296
NP_441448.1_1 Forward -297 -278 10.5209 0.191
NP_441448.1_1 Forward -54 -35 5.89931 0.26
NP_441448.1_1 Forward -279 -260 3.24438 0.299
NP_440183.1_9 Forward -377 -358 -15.6352 0.273
NP_440379.1_5 Reverse -360 -379 -4.03212 0.208
NP_441468.1_1 Reverse -38 -45 6.13563 0.209
NP_441468.1_1 Forward -45 -38 6.0373 0.223
NP_441468.1_1 Reverse -194 -201 4.07068 0.263
NP_441468.1_1 Reverse -371 -378 3.97235 0.277
NP_441468.1_1 Forward -378 -371 3.97235 0.277
NP_441468.1_1 Forward -36 -29 3.97235 0.277
NP_441020.2_6 Forward -279 -262 7.217 0.237
NP_441015.1_10 Forward -276 -257 -9.34199 0.282
NP_441673.1_1 Forward -46 -37 1.27803 0.155
NP_441673.1_1 Reverse -37 -46 1.27803 0.155
NP_441826.1_2 Reverse -364 -378 5.01447 0.0978
NP_441393.1_2 Reverse -232 -251 10.7314 0.293
NP_442868.1_6 Forward -250 -240 0.275027 0.243
NP_442868.1_6 Forward -48 -38 -0.0199663 0.255
NP_441251.1_7 Forward -81 -68 12.6056 0.266
NP_442559.1_3 Reverse -360 -379 7.17762 0.296
NP_442227.1_2 Reverse -273 -292 -2.26216 0.272
NP_442227.1_2 Reverse -30 -49 -2.95047 0.285
NP_443058.1_7 Reverse -267 -286 2.0644 0.294
NP_442361.1_3 Forward -52 -39 7.88576 0.285
NP_442808.1_1 Reverse -36 -46 17.5808 0.00507
NP_442808.1_1 Forward -203 -193 6.66608 0.102
NP_442808.1_1 Reverse -305 -315 4.69947 0.192
NP_442808.1_1 Forward -173 -163 2.43787 0.266
NP_441315.1_2 Forward -47 -29 18.1768 0.156
NP_442542.1_2 Forward -279 -266 9.45906 0.134
NP_442542.1_2 Reverse -35 -48 4.93583 0.29
NP_440038.1_2 Forward -387 -368 14.1591 0.267
NP_442342.1_9 Forward -164 -148 4.77842 0.243
NP_440558.1_2 Reverse -274 -293 -3.63879 0.237
NP_440558.1_2 Forward -274 -255 -3.93378 0.239
NP_440558.1_2 Reverse -153 -172 -7.27704 0.291
NP_442789.1_4 Forward -276 -257 -5.01543 0.265
NP_441518.1_3 Reverse -27 -46 -12.9802 0.264
NP_441878.1_6 Forward -380 -370 10.4031 0.0176
NP_441878.1_6 Reverse -192 -202 1.74999 0.0642
NP_441878.1_6 Reverse -369 -379 0.668351 0.139
NP_441878.1_6 Forward -373 -363 -7.29646 0.217
NP_441878.1_6 Forward -38 -28 -7.59145 0.245
NP_441036.1_4 Reverse -256 -275 15.2408 0.0775
NP_441036.1_8 Reverse -36 -46 13.8447 0.0353
NP_441557.1_5 Forward -46 -37 0.983037 0.0911
NP_441557.1_5 Reverse -37 -46 0.688044 0.128
NP_441445.1_1 Reverse -259 -278 -0.197208 0.286
NP_441445.1_8 Forward -200 -181 -12.2919 0.277
NP_442066.2_9 Reverse -33 -46 6.50913 0.284
NP_441433.1_8 Reverse -371 -390 10.6192 0.147
NP_442777.1_3 Forward -62 -44 2.57501 0.274
NP_442830.1_5 Reverse -369 -383 5.89884 0.225
NP_442183.1_1 Forward -46 -32 11.996 0.0648
NP_441467.1_10 Forward -81 -67 5.30946 0.281
NP_442347.1_2 Reverse -38 -47 3.93297 0.284
NP_442888.1_6 Reverse -359 -378 12.8808 0.148
NP_441037.1_4 Forward -48 -38 6.92787 0.237
NP_441037.1_4 Reverse -191 -201 6.63549 0.25
NP_442594.1_8 Forward -289 -270 2.26107 0.295
NP_441633.1_3 Forward -48 -35 -1.25902 0.154
NP_441633.1_3 Forward -204 -191 -5.97891 0.236
NP_441633.1_3 Reverse -276 -289 -7.06055 0.288
NP_440136.1_2 Reverse -38 -45 6.23397 0.171
NP_440136.1_2 Forward -45 -38 6.13563 0.193
NP_442590.1_9 Forward -278 -259 8.16093 0.245
NP_442590.1_9 Forward -172 -153 3.83436 0.281
NP_442998.1_5 Reverse -347 -357 9.81313 0.233
NP_442998.1_10 Reverse -39 -46 15.5754 0.0102
NP_440899.1_1 Reverse -73 -92 6.74838 0.267
NP_440299.1_1 Reverse -24 -37 16.6366 0.00949
NP_440299.1_1 Forward -383 -370 3.06699 0.261
NP_441799.1_1 Forward -50 -36 8.65209 0.109
NP_441007.1_10 Forward -42 -29 7.59077 0.136
NP_441007.1_10 Forward -51 -38 6.31247 0.167
NP_441007.1_10 Reverse -32 -45 1.39592 0.203
NP_442333.2_5 Forward -383 -364 -12.5869 0.249
NP_440256.1_1 Reverse -159 -178 -0.590531 0.095
NP_440256.1_1 Forward -397 -378 -9.14533 0.275
NP_440256.1_1 Forward -376 -357 -9.24366 0.275
NP_441559.1_8 Forward -206 -192 -4.13031 0.217
NP_441559.1_8 Reverse -244 -258 -5.50694 0.264
NP_441559.1_8 Reverse -245 -259 -7.47356 0.294
NP_441559.1_8 Forward -331 -317 -7.57189 0.295
NP_441270.1_5 Reverse -162 -181 11.14 0.294
NP_440915.1_5 Forward -48 -29 14.9085 0.283
NP_440915.1_6 Reverse -366 -380 1.08123 0.147
NP_441179.1_9 Reverse -368 -378 12.3692 0.272
NP_442866.1_1 Forward -207 -188 -3.54046 0.221
NP_440748.1_1 Forward -206 -187 11.7008 0.285
NP_440306.1_8 Reverse -134 -153 4.52188 0.204
NP_442993.1_1 Forward -248 -232 -7.70961 0.146
NP_442386.1_9 Reverse -369 -378 12.1923 0.0704
NP_442386.1_9 Reverse -36 -45 8.06244 0.209
NP_442386.1_9 Forward -203 -194 6.78414 0.219
NP_442386.1_9 Forward -172 -163 5.0142 0.27
NP_441340.1_5 Reverse -29 -36 11.0522 0.0749
NP_441340.1_5 Forward -45 -38 6.13563 0.175
NP_441340.1_5 Reverse -38 -45 5.93897 0.198
NP_441340.1_5 Reverse -371 -378 4.07068 0.239
NP_441340.1_5 Forward -378 -371 4.07068 0.239
NP_440186.1_8 Forward -101 -82 3.04771 0.264
NP_440168.1_4 Forward -383 -364 -5.50708 0.255
NP_440168.1_9 Forward -173 -154 -3.63879 0.296
NP_440327.1_6 Reverse -73 -92 7.57094 0.228
NP_440161.1_3 Reverse -368 -387 8.16093 0.276
NP_441160.1_5 Forward -288 -269 -5.99873 0.288
NP_440586.1_1 Forward -376 -357 -5.40875 0.285
NP_440586.1_8 Forward -45 -38 11.4451 0.0645
NP_440586.1_8 Forward -378 -371 7.61025 0.227
NP_440586.1_8 Reverse -371 -378 7.61025 0.227
NP_440586.1_8 Reverse -194 -201 7.41359 0.251
NP_442251.1_6 Reverse -38 -45 12.0355 0.0627
NP_440684.1_9 Reverse -250 -264 13.2743 0.168
NP_441262.1_3 Forward -46 -39 14.7888 0.0223
NP_440027.1_3 Reverse -262 -280 9.06482 0.187
NP_440027.1_3 Reverse -354 -372 1.69003 0.299
NP_443051.1_1 Forward -47 -38 0.786375 0.125
NP_439996.1_6 Forward -47 -28 16.3677 0.132
NP_439937.1_8 Forward -164 -145 -4.72043 0.286
NP_439937.1_9 Reverse -277 -294 -17.0714 0.291
NP_439937.1_9 Forward -98 -81 -17.3663 0.298
NP_442294.1_3 Forward -309 -295 14.6503 0.222
NP_442294.1_3 Forward -273 -259 12.2903 0.29
NP_440626.1_1 Forward -45 -26 13.5683 0.203
NP_440439.1_6 Forward -82 -63 5.01433 0.242
NP_440372.1_2 Forward -45 -38 6.72562 0.0929
NP_440372.1_2 Reverse -38 -45 6.62729 0.151
NP_441789.1_7 Reverse -269 -288 -3.83621 0.28
NP_441789.1_7 Reverse -365 -384 -4.03287 0.28
NP_440316.1_10 Reverse -192 -202 7.25653 0.251
NP_439977.1_5 Reverse -22 -41 4.42435 0.153
NP_442368.1_2 Reverse -273 -292 7.96426 0.246
NP_440139.1_1 Reverse -357 -376 7.27514 0.134
NP_441572.1_7 Reverse -364 -383 13.2741 0.0342
NP_441155.1_2 Reverse -40 -59 15.7324 0.225
NP_442384.1_10 Reverse -229 -242 3.36254 0.193
NP_442384.1_10 Reverse -37 -50 3.16588 0.199
NP_442035.1_6 Reverse -370 -389 6.78429 0.285
NP_442035.1_8 Reverse -34 -48 13.3726 0.237
NP_440364.1_2 Reverse -23 -42 15.6875 0.213
NP_442262.1_10 Forward -378 -371 10.4622 0.145
NP_442262.1_10 Reverse -371 -378 10.4622 0.145
NP_442262.1_10 Reverse -29 -36 7.90559 0.266
NP_440163.1_10 Reverse -360 -370 9.7148 0.226
NP_440163.1_10 Reverse -367 -377 7.84651 0.299
NP_440344.1_10 Reverse -30 -47 6.33202 0.0183
NP_440282.1_10 Reverse -312 -331 -9.93197 0.29
NP_440531.1_6 Forward -164 -145 2.26107 0.16
NP_440531.1_6 Reverse -362 -381 0.0977854 0.199
NP_440531.1_6 Forward -54 -35 -3.83545 0.272
NP_440531.1_6 Reverse -185 -204 -5.50708 0.299
NP_441335.1_8 Reverse -116 -135 16.2241 0.124
NP_441965.1_10 Reverse -34 -50 13.6282 0.0977
NP_442065.1_7 Reverse -35 -53 7.29564 0.215
NP_440297.1_8 Forward -101 -83 15.7521 0.177
NP_440297.1_9 Reverse -371 -381 9.91146 0.0917
NP_440297.1_9 Forward -201 -191 0.0783647 0.282
NP_440297.1_9 Forward -378 -368 -0.118297 0.282
NP_442187.1_3 Forward -47 -37 16.893 0.0619
NP_442280.1_10 Reverse -18 -36 7.49983 0.268
NP_440999.1_9 Reverse -33 -47 10.9143 0.0483
NP_440999.1_9 Forward -206 -192 6.78443 0.0947
NP_440999.1_9 Reverse -366 -380 -3.04867 0.283
NP_440888.1_2 Forward -248 -234 6.0955 0.249
NP_440888.1_2 Reverse -268 -282 5.70218 0.267
NP_440491.1_1 Reverse -34 -53 14.6161 0.101
NP_439969.1_1 Reverse -146 -165 6.4893 0.171
NP_439969.1_3 Reverse -365 -384 -1.18052 0.271
NP_441543.1_2 Reverse -29 -38 11.6028 0.0504
NP_441543.1_2 Reverse -38 -47 7.17789 0.131
NP_441543.1_2 Forward -378 -369 6.68623 0.142
NP_441543.1_3 Reverse -275 -289 6.58715 0.286
NP_442845.1_2 Forward -43 -29 5.70279 0.225
NP_441178.1_6 Forward -205 -186 2.35861 0.27
NP_441469.1_8 Reverse -369 -378 13.6677 0.073
NP_441469.1_8 Forward -380 -371 11.3078 0.173
NP_441469.1_8 Reverse -192 -201 8.94785 0.227
NP_441469.1_8 Reverse -36 -45 5.70292 0.257
NP_442315.1_1 Forward -288 -270 2.96908 0.294
NP_443064.1_6 Reverse -37 -47 8.39772 0.292
NP_442337.1_8 Forward -390 -371 0.786102 0.244
NP_442578.1_7 Forward -45 -38 5.93897 0.183
NP_440071.1_1 Reverse -362 -379 9.96952 0.259
NP_441462.1_2 Forward -46 -36 -0.118297 0.184
NP_441621.1_7 Reverse -26 -40 4.12949 0.0934
NP_441621.1_7 Reverse -35 -49 -3.147 0.188
NP_441621.1_7 Forward -164 -150 -3.63866 0.192
NP_443062.1_1 Forward -379 -361 6.20575 0.206
NP_443062.1_6 Forward -387 -368 1.76941 0.268
NP_443062.1_6 Forward -266 -247 0.687771 0.291
NP_440516.1_8 Forward -46 -37 17.6993 0.00442
NP_440516.1_8 Reverse -193 -202 -0.491928 0.262
NP_442080.1_7 Forward -377 -358 13.7658 0.0449
NP_442428.1_5 Reverse -38 -45 6.13563 0.209
NP_442428.1_5 Forward -45 -38 6.0373 0.212
NP_442428.1_5 Reverse -194 -201 4.56234 0.249
NP_442428.1_5 Forward -378 -371 4.36568 0.271
NP_442428.1_5 Reverse -371 -378 4.36568 0.271
NP_442428.1_5 Forward -36 -29 4.36568 0.271
NP_441443.1_10 Forward -377 -359 6.40989 0.236
NP_442120.1_10 Forward -234 -215 -14.8485 0.289
NP_440673.1_2 Reverse -18 -37 14.9745 0.0961
NP_440673.1_3 Reverse -39 -46 12.4288 0.0426
NP_440673.1_3 Forward -200 -193 9.38056 0.192
NP_441714.1_3 Reverse -30 -48 19.0945 0.0434
NP_441052.1_2 Reverse -37 -47 10.7964 0.0285
NP_441052.1_2 Forward -202 -192 5.68323 0.107
NP_441052.1_2 Forward -37 -27 3.81494 0.173
NP_441052.1_2 Reverse -229 -239 1.455 0.244
NP_442219.1_8 Forward -275 -256 6.62097 0.292
NP_442219.1_9 Reverse -38 -47 8.06287 0.0696
NP_440436.1_4 Reverse -38 -47 13.9623 0.0193
NP_440436.1_4 Forward -45 -36 5.80084 0.182
NP_440436.1_4 Forward -378 -369 5.70251 0.186
NP_440436.1_4 Reverse -29 -38 4.7192 0.244
NP_441884.1_9 Reverse -34 -53 -5.11376 0.0594
NP_441884.1_9 Forward -49 -30 -24.0916 0.284
NP_440314.1_9 Reverse -29 -48 -9.53865 0.269
NP_441719.1_4 Forward -45 -38 6.72562 0.093
NP_441719.1_4 Reverse -38 -45 6.62729 0.151
NP_441004.1_1 Reverse -187 -206 -10.3253 0.219
NP_441004.1_1 Forward -384 -365 -18.1918 0.298
NP_441004.1_2 Forward -42 -23 -2.0655 0.263
NP_441004.1_3 Forward -46 -27 4.916 0.224
NP_441004.1_5 Reverse -189 -203 9.5377 0.252
NP_442366.1_3 Reverse -362 -380 -4.01242 0.262
NP_442366.1_5 Forward -49 -39 14.0409 0.0497
NP_442873.1_3 Reverse -270 -289 11.11 0.169
NP_442873.1_9 Reverse -258 -277 9.14342 0.236
NP_440296.1_10 Reverse -190 -209 -14.2585 0.269
NP_440296.1_10 Forward -290 -271 -15.1435 0.286
NP_441729.1_1 Forward -36 -17 15.3391 0.28
NP_441115.1_4 Reverse -369 -387 8.76983 0.237
NP_442694.1_4 Forward -288 -279 12.2911 0.253
NP_441966.1_7 Reverse -143 -162 4.62021 0.192
NP_441851.1_10 Forward -249 -239 4.69992 0.254
NP_441851.1_10 Forward -380 -370 4.60159 0.259
NP_441851.1_10 Reverse -369 -379 4.50326 0.266
NP_441851.1_10 Forward -38 -28 4.3066 0.277
NP_441396.1_5 Forward -321 -312 16.2243 0.203
NP_441683.1_7 Reverse -51 -70 1.37609 0.241
NP_440593.1_3 Reverse -257 -276 -1.37718 0.211
NP_440593.1_3 Reverse -23 -42 -7.37537 0.293
NP_441982.1_6 Forward -141 -132 12.4854 0.275
NP_440940.1_7 Reverse -229 -247 3.95163 0.267
NP_441349.1_4 Reverse -244 -263 7.47261 0.138
NP_440432.1_9 Forward -201 -186 -2.67504 0.175
NP_442843.1_1 Forward -295 -276 -8.55534 0.255
NP_442843.1_1 Reverse -154 -173 -9.34199 0.265
NP_439960.1_10 Forward -166 -148 0.0191479 0.216
NP_439960.1_10 Forward -53 -35 -2.0458 0.248
NP_440474.1_8 Forward -233 -219 5.80051 0.242
NP_441524.1_6 Forward -86 -68 6.80398 0.243
NP_442168.1_5 Forward -383 -364 -3.93378 0.297
NP_440588.1_2 Reverse -144 -163 -1.67217 0.156
NP_440588.1_2 Forward -388 -369 -4.81876 0.23
NP_440588.1_2 Forward -211 -192 -5.9004 0.264
NP_440943.1_1 Forward -225 -206 18.1907 0.0975
NP_440943.1_4 Forward -54 -42 15.0836 0.198
NP_442006.1_2 Reverse -193 -210 -8.12263 0.192
NP_442006.1_2 Reverse -43 -60 -17.8574 0.283
NP_441570.1_1 Forward -287 -269 -17.6804 0.287
NP_441078.1_4 Forward -37 -28 6.09625 0.0863
NP_441078.1_4 Reverse -37 -46 0.0980582 0.205
NP_441078.1_4 Forward -46 -37 0.0980582 0.205
NP_441078.1_4 Reverse -370 -379 -1.6719 0.266
NP_441078.1_4 Forward -379 -370 -1.77023 0.266
NP_441078.1_4 Reverse -193 -202 -1.86856 0.272
NP_441078.1_4 Reverse -28 -37 -2.06522 0.295
NP_442729.1_5 Forward -47 -37 8.1415 0.248
NP_441663.1_8 Reverse -31 -50 1.17943 0.212
NP_442348.1_2 Forward -229 -220 13.2744 0.198
NP_440526.1_3 Reverse -29 -40 8.02298 0.126
NP_440526.1_3 Reverse -38 -49 5.17139 0.253
NP_440526.1_3 Forward -45 -34 0.943182 0.267
NP_441432.1_8 Forward -38 -29 12.7828 0.0354
NP_441432.1_8 Forward -47 -38 7.17789 0.102
NP_441432.1_8 Reverse -192 -201 2.55633 0.298
NP_442320.1_8 Reverse -22 -36 -3.44199 0.122
NP_442003.1_1 Forward -266 -247 19.2412 0.299
NP_442003.1_4 Reverse -240 -259 9.73422 0.299
NP_442797.1_1 Forward -170 -151 -6.39206 0.296
NP_440578.1_10 Forward -393 -374 9.63589 0.282
NP_441945.1_10 Forward -373 -354 8.25926 0.273
NP_441057.1_4 Forward -47 -29 5.91901 0.195
NP_441328.2_8 Forward -62 -43 16.2232 0.268
NP_440281.1_4 Forward -70 -51 14.0599 0.297
NP_442751.1_2 Reverse -146 -165 4.91521 0.261
NP_442489.1_7 Reverse -37 -46 0.786375 0.152
NP_442489.1_7 Forward -46 -37 0.589713 0.17
NP_442489.1_7 Reverse -193 -202 -1.57357 0.213
NP_442489.1_7 Forward -37 -28 -1.6719 0.235
NP_442489.1_7 Reverse -370 -379 -1.6719 0.235
NP_442489.1_7 Forward -379 -370 -1.77023 0.247
NP_442079.1_7 Forward -45 -26 1.86774 0.24
NP_440559.1_1 Reverse -38 -47 14.1594 0.0317
NP_441659.2_8 Reverse -370 -380 4.20827 0.142
NP_441659.2_8 Reverse -363 -373 2.53664 0.198
NP_440363.1_4 Reverse -96 -115 8.84924 0.273
NP_440363.1_9 Forward -289 -271 12.9988 0.26
NP_441800.1_10 Reverse -162 -181 1.47442 0.255
NP_442346.1_1 Forward -288 -269 11.6025 0.27
NP_442346.1_5 Forward -38 -28 10.8948 0.0813
NP_442346.1_5 Forward -47 -37 6.8632 0.188
NP_442346.1_5 Forward -380 -370 6.56821 0.198
NP_442346.1_5 Reverse -369 -379 5.78156 0.229
NP_442346.1_5 Reverse -192 -202 5.38824 0.248
NP_442346.1_10 Forward -48 -29 -0.885524 0.28
NP_440545.1_3 Forward -383 -366 6.13536 0.0568
NP_440545.1_3 Reverse -24 -41 -0.157821 0.149
NP_441856.1_7 Forward -247 -228 11.2092 0.246
NP_441923.1_6 Reverse -371 -385 10.816 0.252
NP_440459.1_2 Reverse -361 -378 16.9518 0.0834
NP_440010.1_10 Forward -49 -30 9.73422 0.209
NP_440847.1_3 Reverse -279 -293 11.012 0.275
NP_441888.1_7 Reverse -365 -379 1.57289 0.245
NP_441948.1_4 Forward -386 -368 6.50899 0.0633
NP_441948.1_4 Forward -53 -35 -3.22577 0.189
NP_441358.1_3 Forward -136 -118 11.5231 0.249
NP_441833.1_4 Reverse -38 -45 14.1004 0.0258
NP_441833.1_4 Forward -45 -38 6.13563 0.198
NP_442162.1_9 Reverse -38 -45 6.62729 0.142
NP_442162.1_9 Forward -45 -38 6.52896 0.178
NP_441044.1_4 Reverse -217 -235 5.13236 0.227
NP_442140.1_3 Forward -45 -35 17.7779 0.0159
NP_442140.1_3 Reverse -371 -381 9.7148 0.103
NP_442140.1_3 Forward -378 -368 9.41981 0.108
NP_442140.1_3 Reverse -194 -204 7.25653 0.146
NP_442140.1_3 Reverse -29 -39 6.17489 0.184
NP_442140.1_3 Forward -36 -26 3.81494 0.278
NP_440875.1_9 Forward -377 -367 12.7522 0.104
NP_442547.1_7 Reverse -360 -379 10.2223 0.279
NP_441813.1_5 Reverse -35 -45 0.471689 0.201
NP_441813.1_5 Reverse -368 -378 -0.118297 0.234
NP_440590.1_4 Forward -378 -365 2.18257 0.0972
NP_440590.1_4 Reverse -38 -51 -1.65234 0.225
NP_440567.1_1 Forward -45 -31 6.88276 0.08
NP_440567.1_1 Reverse -38 -52 3.24451 0.148
NP_442497.1_10 Reverse -38 -47 0.688044 0.141
NP_442497.1_10 Forward -201 -192 0.196389 0.208
NP_440821.1_4 Reverse -35 -45 6.66654 0.0837
NP_440821.1_4 Forward -48 -38 -0.41329 0.257
NP_441239.1_9 Reverse -368 -380 13.707 0.0355
NP_441239.1_9 Forward -381 -369 13.412 0.037
NP_441239.1_9 Forward -204 -192 6.52882 0.185
NP_441239.1_9 Reverse -35 -47 6.52882 0.185
NP_441239.1_9 Forward -173 -161 3.08724 0.296
NP_441951.1_4 Forward -378 -359 8.25926 0.266
NP_441009.1_4 Reverse -370 -389 15.4374 0.165
NP_441727.1_3 Reverse -21 -40 6.29264 0.244
NP_440400.1_1 Reverse -270 -289 8.84842 0.22
NP_441892.1_1 Reverse -184 -201 4.56207 0.11
NP_441892.1_1 Reverse -361 -378 -2.3211 0.22
NP_442044.1_1 Reverse -23 -42 -7.57203 0.224
NP_441017.1_6 Reverse -366 -380 12.2903 0.221
NP_440212.1_5 Forward -384 -365 20.2556 0.0619
NP_440949.1_7 Forward -45 -26 15.6332 0.162
NP_440949.1_7 Forward -179 -160 9.43841 0.264
NP_442052.1_8 Forward -236 -226 11.9764 0.297
NP_440546.1_4 Forward -46 -36 11.0156 0.0991
NP_440462.1_6 Reverse -35 -45 7.45319 0.0788
NP_442611.1_1 Reverse -148 -167 -2.16383 0.284
NP_440868.1_4 Forward -50 -38 5.54551 0.0954
NP_440868.1_4 Reverse -33 -45 4.07055 0.128
NP_440868.1_4 Forward -206 -194 -0.649339 0.28
NP_441497.1_3 Reverse -288 -307 -11.0136 0.294
NP_442499.1_1 Reverse -29 -48 11.1109 0.201
NP_442499.1_3 Forward -38 -20 10.8356 0.225
NP_441474.1_1 Forward -346 -327 -2.16459 0.272
NP_442258.1_2 Forward -377 -358 -3.83545 0.248
NP_442023.1_2 Reverse -377 -396 5.01433 0.286
NP_442696.1_1 Forward -17 -3 22.714 0.0225
NP_442696.1_2 Forward -47 -29 22.9303 0.0102
NP_442696.1_4 Forward -135 -121 16.5317 0.283
NP_442696.1_6 Forward -175 -156 29.4987 0.000178
NP_442837.1_3 Reverse -38 -45 6.13563 0.25
NP_442837.1_3 Forward -45 -38 5.93897 0.265
NP_442053.1_1 Forward -46 -37 7.76787 0.0895
NP_442053.1_1 Reverse -37 -46 7.17789 0.104
NP_440505.1_3 Forward -48 -38 7.94484 0.147
NP_440505.1_3 Forward -250 -240 4.99491 0.252
NP_442456.1_5 Forward -105 -87 7.29564 0.26
NP_442471.1_3 Reverse -338 -357 17.9927 0.238
NP_442532.1_7 Forward -37 -23 5.89945 0.171
NP_442532.1_7 Forward -46 -32 3.8345 0.187
NP_440914.1_1 Reverse -37 -47 13.4947 0.0297
NP_442470.1_3 Reverse -30 -49 18.2882 0.12
NP_441011.1_6 Reverse -250 -269 12.1925 0.258
NP_441011.1_8 Forward -45 -36 5.60459 0.247
NP_442533.1_6 Forward -372 -363 8.55452 0.0747
NP_442533.1_6 Reverse -370 -379 7.17789 0.0948
NP_442533.1_6 Forward -379 -370 6.68623 0.105
NP_442533.1_6 Reverse -193 -202 4.32629 0.184
NP_442533.1_6 Reverse -268 -277 3.14632 0.224
NP_442232.1_3 Forward -387 -368 2.0644 0.108
NP_442232.1_3 Forward -294 -275 -10.817 0.274
NP_442535.1_2 Forward -264 -245 8.75091 0.228
NP_441219.1_6 Reverse -27 -45 11.9172 0.193
NP_439944.1_9 Forward -36 -26 11.6814 0.0887
NP_440816.1_7 Reverse -33 -52 10.9142 0.218
NP_439945.1_2 Forward -140 -123 12.289 0.257
NP_442202.1_4 Forward -207 -193 13.417 0.252
NP_442202.1_10 Forward -380 -366 4.91614 0.255
NP_440115.1_6 Forward -49 -39 9.32148 0.115
NP_440007.1_9 Reverse -19 -33 3.93283 0.267
NP_441961.1_4 Forward -45 -26 2.45773 0.295
NP_443045.1_9 Reverse -148 -166 13.1947 0.201
NP_441106.1_1 Reverse -36 -45 5.70292 0.131
NP_441106.1_1 Reverse -369 -378 5.21127 0.167
NP_441869.1_2 Reverse -134 -153 13.0775 0.228
NP_442588.1_1 Forward -375 -356 7.57094 0.257
NP_441286.1_1 Forward -47 -35 11.2487 0.013
NP_441286.1_1 Reverse -27 -39 0.825626 0.107
NP_441286.1_1 Forward -38 -26 -7.04085 0.3
NP_442674.1_3 Forward -45 -26 14.8466 0.174
NP_442674.1_3 Forward -54 -35 2.75194 0.299
NP_440670.1_8 Reverse -37 -46 6.8829 0.0907
NP_442908.1_8 Forward -50 -31 11.5042 0.294
NP_440886.1_7 Reverse -36 -46 8.53436 0.0805
NP_440886.1_7 Forward -203 -193 7.64939 0.0865
NP_440886.1_7 Reverse -305 -315 3.51951 0.279
NP_440828.1_4 Reverse -27 -46 6.78348 0.124
NP_440828.1_4 Reverse -146 -165 2.45694 0.152
NP_442614.1_2 Reverse -370 -384 12.586 0.155
NP_442614.1_2 Reverse -256 -270 6.78443 0.285
NP_442072.1_9 Forward -380 -362 -13.6489 0.118
NP_441427.1_6 Reverse -159 -177 13.0972 0.211
NP_441427.1_6 Forward -376 -358 9.0656 0.277
NP_440907.2_8 Reverse -307 -317 7.25606 0.123
NP_441463.1_3 Forward -62 -43 -10.3253 0.293
NP_441626.1_2 Forward -45 -38 6.0373 0.212
NP_441626.1_2 Reverse -38 -45 6.0373 0.212
NP_440107.1_5 Reverse -261 -280 -2.36049 0.178
NP_442794.1_1 Forward -50 -38 2.30059 0.296
NP_442615.1_1 Forward -55 -37 2.37909 0.0686
NP_442615.1_1 Forward -388 -370 -3.12744 0.156
NP_441962.1_4 Reverse -23 -42 8.06259 0.0666
NP_441962.1_4 Forward -42 -23 -12.1936 0.253
NP_441962.1_4 Forward -291 -272 -14.4552 0.288
NP_441431.1_2 Reverse -367 -381 12.9786 0.102
NP_441431.1_2 Reverse -34 -48 7.66879 0.237
NP_441431.1_2 Forward -205 -191 5.99717 0.281
NP_441488.1_8 Reverse -148 -162 7.96378 0.214
NP_441836.1_1 Forward -48 -29 12.9603 0.232
NP_441836.1_2 Forward -49 -30 13.7658 0.0686
NP_441836.1_2 Forward -283 -264 4.71934 0.133
NP_441836.1_2 Reverse -22 -41 -3.14714 0.234
NP_441193.1_1 Reverse -232 -251 8.65176 0.292
NP_440634.1_1 Reverse -368 -387 18.7807 0.174
NP_440634.1_4 Reverse -362 -381 16.7157 0.182
NP_440634.1_10 Reverse -256 -275 6.09517 0.269
NP_441993.1_1 Forward -379 -360 4.28566 0.222
NP_442224.1_1 Forward -204 -185 4.916 0.164
NP_442805.1_5 Reverse -269 -288 -1.77127 0.262
NP_442437.1_3 Reverse -241 -260 15.2399 0.106
NP_442698.1_10 Reverse -30 -49 0.294447 0.297
NP_441510.2_7 Reverse -262 -276 10.6187 0.28
NP_440293.1_3 Forward -45 -26 3.14605 0.192
NP_440766.1_4 Reverse -149 -163 0.982901 0.259
NP_441237.1_9 Reverse -38 -48 10.5014 0.228
NP_441311.1_2 Forward -52 -38 12.0937 0.236
NP_440801.1_8 Reverse -271 -290 11.2092 0.134
NP_440801.1_9 Forward -381 -367 13.3201 0.276
NP_440801.1_10 Forward -275 -256 4.12936 0.291
NP_440942.1_9 Reverse -269 -288 6.98015 0.255
NP_441984.1_3 Reverse -359 -377 10.7372 0.184
NP_441984.1_3 Reverse -360 -378 6.90232 0.261
NP_441984.1_4 Forward -162 -148 12.7826 0.289
NP_440554.1_4 Forward -378 -368 3.81494 0.213
NP_441885.1_5 Reverse -37 -47 1.35667 0.11
NP_441885.1_5 Forward -37 -27 0.766681 0.123
NP_442341.1_9 Reverse -322 -336 5.21053 0.277
NP_440423.1_10 Forward -53 -34 10.7175 0.259
NP_443000.1_7 Forward -48 -38 0.471689 0.298
NP_441842.1_7 Reverse -232 -251 12.4867 0.231
NP_440275.1_3 Reverse -35 -45 6.46988 0.105
NP_440091.1_1 Reverse -33 -45 3.87389 0.146
NP_442275.1_1 Reverse -268 -287 12.7825 0.221
NP_442275.1_1 Reverse -278 -297 0.294447 0.285
NP_440679.1_10 Forward -169 -150 -2.95047 0.136
NP_440679.1_10 Reverse -195 -214 -14.1602 0.226
NP_440679.1_10 Forward -44 -25 -14.2585 0.226
NP_440679.1_10 Forward -370 -351 -20.7484 0.286
NP_443010.1_10 Forward -280 -263 2.38426 0.277
NP_442451.1_2 Reverse -270 -289 -5.99873 0.228
NP_440175.1_4 Forward -381 -362 -5.99873 0.166
NP_442495.1_4 Forward -102 -92 10.9931 0.295
NP_440149.1_8 Forward -287 -268 -1.67217 0.162
NP_441105.1_3 Reverse -359 -378 1.0811 0.117
NP_442373.1_2 Forward -375 -356 11.2092 0.0729
NP_440216.1_1 Forward -379 -365 -11.3085 0.178
NP_440216.1_9 Reverse -372 -381 7.37455 0.286
NP_440172.1_1 Reverse -193 -203 4.10993 0.205
NP_442662.1_5 Reverse -123 -137 20.0591 0.175
NP_442015.1_10 Forward -383 -370 0.904263 0.216
NP_441226.1_7 Reverse -148 -155 8.59356 0.197
NP_441111.1_7 Reverse -38 -46 8.96754 0.0463
NP_440415.1_8 Forward -97 -78 17.2475 0.0583
NP_441766.1_2 Reverse -37 -46 8.65285 0.0495
NP_441766.1_2 Forward -372 -363 1.37636 0.294
NP_440416.1_9 Forward -386 -367 -7.17871 0.0972
NP_443052.1_9 Reverse -353 -372 -6.1954 0.279
NP_443052.1_9 Forward -173 -154 -6.49039 0.283
NP_443052.1_9 Reverse -155 -174 -6.98204 0.291
NP_440072.1_5 Forward -298 -280 6.31233 0.236
NP_442403.1_9 Forward -241 -222 3.73603 0.255
NP_442154.1_1 Forward -45 -27 -6.07737 0.129
NP_442154.1_1 Forward -288 -270 -9.61729 0.185
NP_442154.1_1 Forward -54 -36 -17.1888 0.249
NP_442154.1_1 Forward -374 -356 -17.9754 0.273
NP_442154.1_1 Reverse -331 -349 -19.0571 0.289
NP_440261.1_5 Reverse -38 -51 -1.25902 0.0687
NP_440261.1_5 Reverse -29 -42 -10.7971 0.21
NP_440988.1_3 Reverse -228 -246 4.73903 0.251
NP_440988.1_10 Reverse -260 -274 5.77014 0.24
NP_440988.1_10 Forward -39 -25 4.41476 0.261
NP_440988.1_10 Reverse -26 -40 3.9307 0.276
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCACTAGCCTTTTTCTGCTGTGCCATGGCCGGTGGCTGTATTGGTTTTGTACACCATAACCACAATCCTGCCCGGGTATTCATGGGGGATACGGGTTCTTTAGCCCTAGGGGGGAGTTTGGCAGCGGTGGGCATTATGACCGGCAACCTCTGGGGACTGCTGTTGATCAGCGGCATTTTTCTGGCAGAATCCCTCTCCGTCATCGCCCAAGTGGGTTACTACAAAGCCACCAAAGGCCCTGATGGCGTCGGCAAAAGGTTGTTAAAAATGGCTCCAATTCACCACCATTTAGAATTAAGTGGCTGGACCGAAACCCAAATTGTGGGCTCTTTTTACCTCATCAATACCCTCTTGGCGATCGTGGCTATGGCAACAGCATAACAGTAGAATCAAAGGGTA

CDS

ATGGTTGATGGTCGTCCAATGCAAATCACCTTAAATCTACCGGATAGGTTAAATCAGATCGGAGAATTTGATCAAAATGATTGGCTCCGGGAAATTGCCATTGCCCTATTTGAACAAGAACACATTTCTCTGGCTAGGGCCAGTAAAATCTCCTCCATGGAAATTATGGAATTTCAAAAACTTCTATCAGATCGGGGAATTTGTATTCACTACGATGTGGAAGAATTAGCACAGGACATTCAGCACCTACAAAATCGCAGTTGGTTATGA

Protein

MVDGRPMQITLNLPDRLNQIGEFDQNDWLREIAIALFEQEHISLARASKISSMEIMEFQKLLSDRGICIHYDVEELAQDIQHLQNRSWL