Your browser is old and dusty. Try Google Chrome!

Details for ssl1004

ORF ssl1004
Accession NP_442808.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -99 -85 9.34103 0.0754
NP_441061.1_2 Reverse -232 -246 3.44117 0.164
NP_440557.1_1 Forward -62 -43 0.392778 0.265
NP_440795.1_7 Forward -62 -55 14.6904 0.0123
NP_440795.1_7 Reverse -55 -62 14.6904 0.0123
NP_440795.1_7 Forward -239 -232 8.8889 0.188
NP_441418.1_6 Forward -277 -258 -19.6667 0.093
NP_441418.1_6 Reverse -268 -287 -29.1065 0.216
NP_441418.1_6 Reverse -54 -73 -29.5982 0.23
NP_442291.1_5 Forward -64 -48 17.6598 0.0165
NP_442291.1_5 Reverse -53 -69 0.55019 0.162
NP_440897.1_6 Reverse -268 -287 10.0284 0.0705
NP_441453.1_4 Reverse -54 -62 16.539 0.00633
NP_441453.1_4 Forward -63 -55 16.539 0.00633
NP_441453.1_4 Reverse -231 -239 11.5241 0.043
NP_441453.1_4 Forward -277 -269 6.80426 0.121
NP_441453.1_4 Reverse -268 -276 6.11594 0.121
NP_441623.1_1 Reverse -132 -150 1.29745 0.215
NP_441960.1_9 Forward -152 -133 16.2241 0.259
NP_442151.1_6 Forward -63 -49 16.9125 0.013
NP_442151.1_6 Reverse -231 -245 9.73436 0.141
NP_442151.1_6 Reverse -54 -68 6.6861 0.224
NP_441818.1_1 Forward -62 -51 18.8393 0.00301
NP_441818.1_1 Reverse -55 -66 9.69459 0.232
NP_440226.1_1 Forward -277 -258 7.27595 0.109
NP_440226.1_1 Forward -63 -44 4.62101 0.184
NP_440226.1_1 Reverse -54 -73 4.22769 0.199
NP_441630.1_3 Reverse -46 -65 0.58944 0.272
NP_442173.1_1 Forward -62 -54 15.4574 0.00633
NP_442173.1_1 Reverse -55 -63 15.4574 0.00633
NP_442173.1_1 Reverse -269 -277 12.0158 0.0316
NP_442173.1_1 Forward -276 -268 4.83764 0.241
NP_442752.1_4 Forward -277 -270 13.8055 0.0199
NP_442752.1_4 Forward -63 -56 13.8055 0.0199
NP_442752.1_4 Reverse -54 -61 13.8055 0.0199
NP_443027.1_4 Forward -65 -55 14.828 0.0437
NP_443027.1_4 Reverse -52 -62 14.0414 0.0452
NP_441745.1_3 Reverse -262 -281 12.9783 0.298
NP_441812.1_3 Reverse -53 -67 17.8958 0.0479
NP_441812.1_3 Forward -64 -50 8.55439 0.251
NP_442975.1_10 Forward -67 -53 22.32 0.000414
NP_442975.1_10 Forward -244 -230 10.6187 0.0541
NP_442975.1_10 Reverse -50 -64 4.71887 0.241
NP_442975.1_10 Reverse -264 -278 2.45727 0.274
NP_440784.1_7 Forward -62 -55 15.9687 0.0123
NP_440784.1_7 Reverse -55 -62 15.9687 0.0123
NP_440784.1_7 Forward -276 -269 6.23397 0.241
NP_440784.1_7 Reverse -269 -276 6.13563 0.241
NP_441250.1_3 Forward -28 -9 3.34271 0.266
NP_440061.1_9 Reverse -258 -272 4.91554 0.3
NP_442062.1_8 Reverse -54 -64 19.4496 0.000558
NP_442062.1_8 Forward -63 -53 17.3846 0.00193
NP_442062.1_8 Forward -269 -259 8.33817 0.0769
NP_441859.1_3 Forward -278 -259 8.75009 0.136
NP_440304.1_4 Forward -65 -55 10.8948 0.051
NP_440304.1_4 Reverse -52 -62 10.8948 0.051
NP_440304.1_4 Forward -242 -232 7.74818 0.101
NP_442242.1_4 Forward -62 -55 14.3954 0.0124
NP_442242.1_4 Reverse -55 -62 14.3954 0.0124
NP_440044.1_8 Forward -62 -43 5.30933 0.103
NP_440044.1_8 Reverse -55 -74 -2.55715 0.264
NP_441035.1_3 Reverse -120 -139 4.22769 0.227
NP_441208.1_9 Forward -243 -229 12.291 0.141
NP_441208.1_9 Forward -265 -251 10.521 0.185
NP_441594.1_6 Forward -249 -230 -0.295539 0.298
NP_440370.1_10 Reverse -45 -64 9.14423 0.232
NP_442110.1_7 Forward -63 -49 9.14437 0.0755
NP_442110.1_7 Reverse -231 -245 -0.197071 0.276
NP_441083.1_5 Forward -63 -53 20.3345 0.00053
NP_441083.1_5 Reverse -54 -64 11.3864 0.0159
NP_441083.1_5 Reverse -268 -278 8.82982 0.03
NP_441083.1_5 Forward -277 -267 -0.904945 0.283
NP_442827.1_8 Reverse -46 -65 -1.27961 0.245
NP_441434.1_6 Reverse -321 -331 14.6313 0.278
NP_441738.1_2 Reverse -270 -277 15.28 0.0102
NP_441738.1_2 Forward -61 -54 15.28 0.0102
NP_441738.1_2 Reverse -56 -63 15.28 0.0102
NP_441558.1_5 Reverse -52 -71 12.5858 0.0675
NP_441558.1_5 Forward -65 -46 5.40766 0.251
NP_441942.1_7 Forward -278 -259 12.8808 0.277
NP_440209.1_1 Reverse -54 -62 18.1123 0.00295
NP_440209.1_1 Forward -63 -55 18.1123 0.00295
NP_440209.1_1 Forward -277 -269 8.57422 0.0425
NP_440209.1_1 Reverse -268 -276 5.52596 0.0821
NP_442889.1_8 Forward -66 -52 20.9434 0.00339
NP_442889.1_8 Reverse -201 -215 5.50552 0.226
NP_441770.1_4 Forward -155 -136 -8.752 0.245
NP_440178.1_7 Forward -64 -45 3.24438 0.0199
NP_440178.1_7 Reverse -53 -72 -12.7836 0.124
NP_442570.1_3 Forward -183 -164 -7.96535 0.279
NP_442570.1_3 Forward -102 -83 -8.55534 0.288
NP_442570.1_3 Reverse -202 -221 -9.44032 0.299
NP_441792.1_5 Reverse -127 -143 9.98996 0.234
NP_441716.1_1 Forward -63 -49 4.22782 0.256
NP_441716.1_1 Reverse -54 -68 4.22782 0.256
NP_442111.1_4 Reverse -267 -281 9.5377 0.0606
NP_441495.1_1 Forward -71 -52 6.98095 0.292
NP_440906.1_5 Forward -62 -55 15.8704 0.0124
NP_440906.1_5 Reverse -55 -62 15.8704 0.0124
NP_440906.1_5 Forward -276 -269 6.23397 0.234
NP_440906.1_5 Reverse -269 -276 6.13563 0.241
NP_442596.1_10 Forward -396 -377 15.0441 0.234
NP_440747.1_10 Reverse -51 -63 7.51213 0.00286
NP_440747.1_10 Forward -66 -54 -2.02597 0.0196
NP_440747.1_10 Reverse -228 -240 -12.1541 0.227
NP_441130.1_10 Forward -65 -51 10.816 0.11
NP_441130.1_10 Reverse -52 -66 8.65272 0.133
NP_442973.1_5 Forward -249 -230 14.1591 0.15
NP_441486.1_1 Forward -66 -52 19.9608 0.00312
NP_441486.1_1 Reverse -51 -65 19.6658 0.00323
NP_441194.1_2 Reverse -311 -330 19.0748 0.11
NP_442634.1_2 Forward -185 -166 1.96607 0.285
NP_442634.1_4 Reverse -229 -243 -3.93365 0.176
NP_442634.1_4 Forward -242 -228 -5.50694 0.258
NP_441014.1_10 Reverse -53 -72 20.3531 0.0349
NP_441014.1_10 Forward -64 -45 -0.29631 0.249
NP_442848.1_1 Reverse -48 -62 7.17775 0.0791
NP_442848.1_1 Forward -69 -55 -2.36035 0.263
NP_442848.1_4 Forward -256 -242 7.76774 0.282
NP_442848.1_5 Reverse -230 -248 -0.964162 0.276
NP_443018.1_3 Forward -62 -55 14.8871 0.0123
NP_443018.1_3 Reverse -55 -62 14.8871 0.0123
NP_443018.1_3 Reverse -269 -276 11.7405 0.0655
NP_443018.1_3 Forward -276 -269 5.44732 0.193
NP_443018.1_3 Reverse -232 -239 4.56234 0.241
NP_443018.1_3 Forward -239 -232 4.46401 0.244
NP_441634.1_8 Reverse -52 -66 11.8976 0.0529
NP_441634.1_8 Reverse -229 -243 -4.52363 0.295
NP_440376.1_1 Forward -63 -54 19.4693 0.000692
NP_440376.1_1 Reverse -54 -63 19.4693 0.000692
NP_440376.1_1 Reverse -231 -240 7.76787 0.0688
NP_440376.1_1 Forward -240 -231 6.39124 0.1
NP_440376.1_1 Forward -277 -268 5.99792 0.111
NP_440376.1_1 Reverse -268 -277 -0.196935 0.285
NP_441588.1_4 Forward -61 -51 8.63316 0.14
NP_441588.1_4 Reverse -56 -66 6.96153 0.178
NP_442687.1_7 Forward -64 -54 15.8113 0.0125
NP_442687.1_7 Reverse -53 -63 8.92815 0.0994
NP_442687.1_7 Forward -278 -268 4.50326 0.245
NP_442687.1_7 Reverse -230 -240 4.40493 0.249
NP_442687.1_7 Forward -384 -374 4.0116 0.271
NP_441797.1_7 Forward -97 -79 11.1305 0.286
NP_442485.1_3 Reverse -220 -239 -0.39387 0.252
NP_442958.1_3 Reverse -43 -62 0.0977854 0.267
NP_442530.1_2 Reverse -181 -191 11.0914 0.284
NP_440642.1_10 Reverse -372 -386 2.16228 0.283
NP_440042.1_2 Reverse -258 -277 9.14423 0.184
NP_442658.1_1 Forward -65 -55 15.9091 0.00966
NP_442658.1_1 Reverse -83 -93 9.02601 0.169
NP_442658.1_1 Reverse -266 -276 6.96107 0.214
NP_442658.1_1 Reverse -52 -62 6.76441 0.214
NP_442658.1_1 Forward -279 -269 6.17443 0.235
NP_442658.1_1 Forward -242 -232 5.68278 0.258
NP_440141.1_8 Reverse -76 -95 5.40766 0.275
NP_442782.1_2 Forward -246 -232 0.687908 0.286
NP_442496.1_5 Forward -390 -372 4.05072 0.299
NP_442544.1_2 Forward -101 -87 -0.492064 0.229
NP_441414.1_9 Forward -277 -258 5.99764 0.0435
NP_441414.1_9 Forward -63 -44 -2.65548 0.12
NP_441414.1_9 Reverse -54 -73 -4.42544 0.153
NP_441414.1_9 Forward -360 -341 -4.81876 0.162
NP_440720.1_1 Forward -251 -232 3.83436 0.26
NP_442937.1_5 Forward -146 -127 7.07928 0.263
NP_442321.1_1 Forward -150 -131 -5.21209 0.216
NP_442321.1_3 Forward -270 -251 14.3558 0.163
NP_441958.1_5 Forward -64 -54 12.2714 0.00183
NP_441958.1_5 Reverse -53 -63 12.2714 0.00183
NP_441958.1_5 Reverse -230 -240 1.65166 0.0872
NP_441958.1_5 Forward -241 -231 1.65166 0.0872
NP_441958.1_5 Forward -278 -268 0.865012 0.12
NP_442836.1_5 Reverse -48 -67 9.53756 0.131
NP_442836.1_10 Forward -276 -266 13.943 0.212
NP_440203.1_5 Reverse -262 -272 10.0093 0.242
NP_439905.1_1 Forward -93 -80 8.47575 0.234
NP_440984.1_7 Reverse -49 -63 7.57108 0.166
NP_440984.1_7 Forward -347 -333 6.48943 0.214
NP_441338.2_9 Forward -194 -175 14.3558 0.146
NP_442911.1_2 Reverse -258 -277 -0.0988766 0.0718
NP_442911.1_2 Reverse -44 -63 -2.45882 0.0982
NP_442911.1_2 Forward -73 -54 -10.522 0.282
NP_440153.1_5 Forward -62 -48 8.75105 0.132
NP_440153.1_5 Reverse -55 -69 0.491246 0.299
NP_443055.1_6 Reverse -260 -278 11.0314 0.114
NP_440993.1_3 Reverse -258 -277 -2.26292 0.299
NP_440602.1_8 Forward -63 -49 17.5025 0.0898
NP_443044.1_1 Reverse -114 -133 2.26107 0.296
NP_441099.1_5 Reverse -258 -277 -9.83364 0.234
NP_442002.1_9 Forward -278 -271 10.7572 0.185
NP_442002.1_9 Forward -64 -57 10.7572 0.185
NP_442598.1_2 Forward -164 -155 14.0611 0.268
NP_441294.1_7 Forward -67 -53 16.6418 0.0133
NP_441504.1_1 Forward -150 -132 10.0489 0.213
NP_441646.1_1 Forward -247 -228 -0.295539 0.26
NP_441646.1_1 Forward -107 -88 -1.08219 0.278
NP_442438.1_10 Reverse -49 -63 7.86607 0.0859
NP_442438.1_10 Forward -68 -54 1.67122 0.19
NP_441000.1_6 Reverse -53 -67 5.01447 0.0933
NP_441000.1_6 Forward -64 -50 3.53951 0.111
NP_441000.1_6 Reverse -267 -281 -4.7203 0.251
NP_440147.1_4 Reverse -229 -242 7.09911 0.0755
NP_440147.1_4 Forward -65 -52 3.36254 0.188
NP_440147.1_4 Reverse -52 -65 0.805932 0.244
NP_440147.1_4 Forward -279 -266 0.412608 0.255
NP_440147.1_4 Forward -242 -229 -0.570702 0.291
NP_441550.1_8 Reverse -52 -62 12.3692 0.0336
NP_441550.1_8 Forward -65 -55 6.0761 0.214
NP_441550.1_8 Reverse -266 -276 5.87944 0.224
NP_441550.1_8 Forward -279 -269 4.7978 0.283
NP_441916.1_7 Reverse -54 -64 18.4663 0.00144
NP_441916.1_7 Forward -63 -53 10.3048 0.0261
NP_441916.1_7 Forward -240 -230 6.37155 0.0988
NP_441916.1_7 Reverse -231 -241 6.07655 0.108
NP_440206.1_9 Reverse -164 -183 8.65258 0.272
NP_441041.1_4 Reverse -54 -73 5.11266 0.0533
NP_441041.1_4 Forward -63 -44 -13.0786 0.28
NP_441041.1_7 Forward -66 -54 10.916 0.0864
NP_441725.1_5 Forward -62 -52 11.2881 0.0247
NP_441725.1_5 Reverse -55 -65 11.2881 0.0247
NP_441725.1_5 Forward -317 -307 3.61828 0.115
NP_441725.1_5 Reverse -269 -279 1.455 0.135
NP_439966.1_7 Forward -65 -55 18.4657 0.00473
NP_439966.1_7 Reverse -266 -276 17.1874 0.0068
NP_439966.1_7 Reverse -52 -62 15.8108 0.0124
NP_439966.1_7 Forward -279 -269 8.73102 0.13
NP_439966.1_9 Reverse -266 -275 9.83282 0.215
NP_439966.1_9 Forward -279 -270 0.983037 0.253
NP_439966.1_9 Forward -65 -56 0.983037 0.253
NP_442941.1_3 Forward -62 -52 19.9412 0.00262
NP_442941.1_3 Reverse -55 -65 11.4848 0.0116
NP_442941.1_3 Reverse -269 -279 1.65166 0.147
NP_442941.1_3 Forward -239 -229 -0.314959 0.256
NP_440289.1_2 Forward -66 -53 21.3571 0.00262
NP_440289.1_2 Reverse -51 -64 6.60746 0.0591
NP_440260.1_8 Forward -103 -85 5.03403 0.154
NP_442281.1_1 Reverse -49 -63 17.2068 0.00633
NP_442281.1_1 Forward -68 -54 11.9953 0.0418
NP_442281.1_1 Reverse -226 -240 4.32555 0.199
NP_442281.1_1 Reverse -255 -269 2.65393 0.26
NP_442281.1_1 Reverse -134 -148 2.16228 0.276
NP_440437.1_1 Forward -69 -50 10.8159 0.0427
NP_440437.1_1 Reverse -48 -67 1.67108 0.145
NP_442012.1_5 Forward -247 -228 -0.0988766 0.288
NP_441196.1_7 Reverse -214 -233 11.0125 0.294
NP_442068.1_2 Reverse -228 -247 14.3558 0.3
NP_441644.1_6 Forward -63 -53 17.3841 0.00127
NP_441644.1_6 Reverse -54 -64 10.1076 0.0628
NP_441644.1_6 Reverse -231 -241 8.04271 0.11
NP_441644.1_6 Forward -240 -230 7.94438 0.113
NP_441644.1_6 Reverse -268 -278 7.15773 0.133
NP_443049.1_6 Forward -278 -268 11.6409 0.24
NP_442215.1_2 Forward -65 -49 5.95839 0.0749
NP_442215.1_2 Forward -96 -80 1.73016 0.128
NP_442215.1_2 Reverse -82 -98 -0.0397962 0.159
NP_442215.1_2 Forward -102 -86 -5.64466 0.254
NP_442247.1_1 Reverse -85 -104 14.2574 0.29
NP_442247.1_8 Reverse -349 -363 10.1277 0.247
NP_440253.1_2 Reverse -54 -72 20.177 0.00508
NP_440253.1_2 Forward -63 -45 12.0155 0.0302
NP_440253.1_2 Forward -277 -259 7.59063 0.0682
NP_440253.1_2 Reverse -268 -286 4.83737 0.1
NP_440929.1_8 Forward -63 -54 19.2726 0.000701
NP_440929.1_8 Reverse -54 -63 19.2726 0.000701
NP_440929.1_8 Reverse -268 -277 7.07956 0.0713
NP_442933.1_10 Forward -63 -54 17.601 0.00325
NP_442933.1_10 Reverse -54 -63 17.601 0.00325
NP_442933.1_10 Forward -240 -231 4.42462 0.246
NP_441751.2_8 Forward -62 -48 -3.24533 0.137
NP_441751.2_8 Reverse -55 -69 -4.22864 0.166
NP_441751.2_8 Reverse -232 -246 -6.88358 0.289
NP_442554.1_8 Forward -62 -52 15.9097 0.00747
NP_442554.1_8 Reverse -55 -65 13.8447 0.0145
NP_442554.1_8 Reverse -232 -242 8.92815 0.0652
NP_442554.1_8 Forward -239 -229 6.96153 0.102
NP_442554.1_8 Forward -276 -266 4.10993 0.198
NP_442554.1_8 Reverse -269 -279 4.0116 0.2
NP_441762.1_7 Forward -278 -266 13.9036 0.0142
NP_441762.1_7 Reverse -53 -65 2.89058 0.0676
NP_441762.1_7 Forward -64 -52 2.30059 0.0676
NP_441762.1_7 Reverse -267 -279 -5.27089 0.195
NP_442142.1_4 Reverse -51 -64 16.7349 0.0264
NP_442142.1_4 Forward -66 -53 15.85 0.0264
NP_442142.1_4 Reverse -228 -241 2.87033 0.273
NP_442142.1_4 Reverse -265 -278 2.57534 0.286
NP_442292.1_1 Forward -62 -53 18.486 0.00229
NP_442292.1_1 Reverse -55 -64 9.63616 0.0183
NP_442292.1_1 Reverse -232 -241 4.81794 0.17
NP_442292.1_1 Reverse -269 -278 -0.196935 0.239
NP_440421.1_1 Reverse -6 -20 15.5359 0.19
NP_442381.1_8 Reverse -257 -276 -6.1954 0.154
NP_442381.1_8 Forward -280 -261 -13.9635 0.28
NP_441711.1_4 Reverse -259 -278 4.42435 0.213
NP_443009.1_5 Reverse -53 -64 18.3477 0.00265
NP_443009.1_5 Reverse -230 -241 4.18809 0.259
NP_441715.1_4 Reverse -55 -65 16.303 0.0117
NP_441715.1_4 Forward -62 -52 14.828 0.0268
NP_441715.1_4 Reverse -269 -279 6.46988 0.143
NP_440357.1_3 Forward -150 -131 0.196116 0.285
NP_441198.1_8 Forward -242 -232 11.2205 0.217
NP_440379.1_5 Forward -249 -230 -11.0136 0.288
NP_441468.1_1 Forward -62 -55 15.8704 0.0124
NP_441468.1_1 Reverse -55 -62 15.8704 0.0124
NP_441468.1_1 Forward -276 -269 6.13563 0.209
NP_441468.1_1 Reverse -269 -276 6.0373 0.223
NP_441468.1_1 Forward -239 -232 3.97235 0.277
NP_441020.2_6 Forward -279 -262 14.4935 0.0528
NP_441673.1_1 Forward -63 -54 20.8459 0.000698
NP_441673.1_1 Reverse -54 -63 20.8459 0.000698
NP_441673.1_1 Forward -277 -268 1.37636 0.114
NP_441673.1_1 Forward -240 -231 1.27803 0.155
NP_441673.1_1 Reverse -231 -240 1.27803 0.155
NP_441673.1_1 Reverse -268 -277 1.1797 0.163
NP_441096.1_5 Reverse -369 -387 14.178 0.297
NP_441826.1_2 Reverse -48 -62 13.8643 0.0213
NP_441826.1_2 Forward -69 -55 2.2612 0.132
NP_442811.1_3 Forward -54 -35 6.98095 0.295
NP_442868.1_6 Reverse -52 -62 9.91146 0.038
NP_442868.1_6 Forward -65 -55 0.963343 0.205
NP_442719.1_2 Reverse -375 -393 -10.4046 0.273
NP_442719.1_2 Forward -201 -183 -11.0929 0.287
NP_442719.1_2 Forward -100 -82 -11.4863 0.292
NP_442719.1_2 Forward -200 -182 -11.5846 0.292
NP_441251.1_7 Reverse -12 -25 11.7207 0.27
NP_441056.1_1 Forward -63 -44 -8.85033 0.285
NP_441612.1_2 Forward -63 -53 8.54929 0.21
NP_442427.1_8 Forward -157 -138 4.81767 0.293
NP_442808.1_1 Reverse -267 -277 19.449 0.00201
NP_442808.1_1 Forward -64 -54 18.4657 0.00201
NP_442808.1_1 Reverse -53 -63 8.63269 0.0481
NP_442808.1_1 Reverse -230 -240 4.60114 0.195
NP_441315.1_2 Reverse -81 -99 14.9878 0.245
NP_440145.1_3 Forward -73 -54 -1.57384 0.154
NP_440145.1_3 Forward -250 -231 -4.6221 0.242
NP_442542.1_2 Forward -65 -52 11.4257 0.114
NP_442542.1_2 Reverse -266 -279 5.72248 0.253
NP_442113.1_10 Forward -350 -331 -7.86702 0.271
NP_442113.1_10 Reverse -119 -138 -8.752 0.289
NP_442050.1_5 Reverse -52 -62 16.4991 0.00812
NP_442050.1_5 Forward -65 -55 9.12434 0.193
NP_442342.1_9 Reverse -266 -282 11.6616 0.119
NP_441114.1_3 Forward -92 -83 14.5527 0.193
NP_442789.1_4 Reverse -202 -221 -7.4737 0.297
NP_441518.1_3 Reverse -44 -63 -13.7669 0.264
NP_441518.1_3 Forward -73 -54 -15.7335 0.299
NP_441878.1_6 Forward -64 -54 10.4031 0.0176
NP_441878.1_6 Reverse -53 -63 10.4031 0.0176
NP_441878.1_6 Forward -241 -231 2.24165 0.0462
NP_441878.1_6 Reverse -230 -240 1.35667 0.101
NP_441878.1_6 Reverse -84 -94 -7.39479 0.222
NP_441036.1_8 Forward -64 -54 17.7779 0.000554
NP_441036.1_8 Reverse -53 -63 8.33817 0.174
NP_441036.1_8 Forward -278 -268 6.8632 0.213
NP_441036.1_8 Reverse -267 -277 6.07655 0.242
NP_442650.1_2 Reverse -85 -99 5.80112 0.139
NP_441557.1_5 Forward -63 -54 19.9609 0.000699
NP_441557.1_5 Reverse -54 -63 19.9609 0.000699
NP_441557.1_5 Forward -277 -268 1.08137 0.0794
NP_441557.1_5 Reverse -268 -277 0.589713 0.134
NP_441557.1_5 Forward -240 -231 0.393051 0.166
NP_441557.1_5 Reverse -231 -240 0.393051 0.166
NP_441445.1_1 Forward -72 -53 9.63589 0.104
NP_441445.1_1 Reverse -45 -64 1.67108 0.248
NP_442066.2_9 Reverse -264 -277 7.09911 0.247
NP_441308.1_8 Forward -65 -55 10.1081 0.22
NP_441308.1_8 Forward -279 -269 8.4365 0.254
NP_442183.1_1 Forward -277 -263 15.2409 0.0228
NP_442183.1_1 Reverse -54 -68 10.226 0.0869
NP_442183.1_1 Forward -63 -49 7.37441 0.143
NP_442166.1_3 Reverse -314 -333 -10.9153 0.271
NP_441459.1_8 Forward -284 -271 13.9823 0.286
NP_441549.1_9 Reverse -227 -245 -10.0106 0.268
NP_442170.1_5 Reverse -54 -73 -3.24547 0.269
NP_442347.1_2 Forward -62 -53 12.4878 0.056
NP_442347.1_2 Reverse -55 -64 11.1111 0.056
NP_442347.1_2 Reverse -269 -278 8.94785 0.0718
NP_442347.1_2 Forward -212 -203 4.81794 0.257
NP_442645.1_2 Reverse -46 -65 -4.72043 0.0608
NP_442888.1_6 Reverse -155 -174 7.47261 0.207
NP_441037.1_4 Forward -242 -232 11.0211 0.17
NP_441037.1_4 Forward -65 -55 7.02532 0.237
NP_441037.1_4 Forward -385 -375 5.95329 0.289
NP_442317.1_6 Reverse -226 -245 8.06259 0.216
NP_442317.1_6 Reverse -369 -388 5.01433 0.24
NP_441633.1_3 Reverse -52 -65 1.29759 0.109
NP_441633.1_3 Forward -65 -52 -3.81562 0.177
NP_441633.1_3 Forward -279 -266 -6.07724 0.236
NP_440136.1_2 Forward -62 -55 15.9687 0.0123
NP_440136.1_2 Reverse -55 -62 15.9687 0.0123
NP_440136.1_2 Forward -276 -269 6.23397 0.171
NP_440136.1_2 Reverse -269 -276 6.13563 0.193
NP_442998.1_10 Reverse -270 -277 15.5754 0.0102
NP_442998.1_10 Forward -61 -54 15.5754 0.0102
NP_442998.1_10 Reverse -56 -63 15.5754 0.0102
NP_442998.1_10 Reverse -187 -194 7.21728 0.144
NP_442998.1_10 Forward -238 -231 4.16902 0.259
NP_440899.1_2 Reverse -220 -239 9.43841 0.178
NP_440299.1_1 Forward -98 -85 6.11523 0.152
NP_440299.1_1 Reverse -50 -63 4.44361 0.207
NP_440299.1_1 Forward -281 -268 2.47701 0.288
NP_440299.1_1 Forward -67 -54 2.28034 0.292
NP_441799.1_1 Reverse -50 -64 12.5853 0.0421
NP_441799.1_1 Forward -67 -53 8.75042 0.106
NP_441799.1_1 Reverse -227 -241 6.19383 0.179
NP_441799.1_1 Reverse -264 -278 4.62054 0.242
NP_441007.1_10 Forward -245 -232 3.5592 0.182
NP_441007.1_10 Reverse -49 -62 0.805932 0.216
NP_442334.1_2 Forward -393 -376 -5.86102 0.214
NP_442333.2_5 Reverse -128 -147 -5.9004 0.214
NP_440256.1_1 Reverse -51 -70 6.88262 0.0282
NP_440256.1_1 Forward -66 -47 -1.08219 0.0997
NP_441559.1_8 Forward -68 -54 -6.19526 0.275
NP_442756.1_2 Reverse -260 -279 9.14423 0.261
NP_440915.1_6 Forward -244 -230 12.586 0.0208
NP_440915.1_6 Forward -281 -267 3.8345 0.1
NP_440915.1_6 Forward -67 -53 -3.147 0.29
NP_441704.1_8 Reverse -43 -62 5.40686 0.294
NP_441939.1_3 Reverse -232 -251 11.4058 0.112
NP_441939.1_3 Forward -62 -43 9.73422 0.134
NP_441939.1_3 Forward -276 -257 6.58763 0.231
NP_442993.1_1 Reverse -54 -70 10.6783 0.0168
NP_442993.1_1 Forward -63 -47 -7.70961 0.146
NP_442993.1_1 Reverse -337 -353 -10.1679 0.21
NP_442993.1_1 Reverse -231 -247 -10.5612 0.222
NP_442386.1_9 Forward -64 -55 15.7322 0.0144
NP_442386.1_9 Reverse -267 -276 13.8639 0.0289
NP_442386.1_9 Reverse -53 -62 13.8639 0.0289
NP_442386.1_9 Forward -278 -269 5.9975 0.23
NP_442386.1_9 Reverse -90 -99 5.9975 0.23
NP_441340.1_5 Forward -62 -55 15.6737 0.0124
NP_441340.1_5 Reverse -55 -62 15.6737 0.0124
NP_441340.1_5 Forward -276 -269 13.5105 0.0314
NP_441340.1_5 Reverse -232 -239 11.0522 0.0749
NP_441340.1_5 Reverse -269 -276 5.84064 0.208
NP_440168.1_9 Forward -182 -163 -5.50708 0.296
NP_440168.1_9 Reverse -298 -317 -5.80207 0.296
NP_442506.1_2 Reverse -220 -239 1.86774 0.296
NP_442240.1_2 Reverse -55 -74 -14.5535 0.182
NP_442714.1_5 Reverse -92 -111 2.26107 0.238
NP_440586.1_1 Forward -250 -231 5.80098 0.182
NP_440586.1_1 Reverse -336 -355 -0.688862 0.237
NP_440586.1_8 Forward -62 -55 13.2151 0.026
NP_440586.1_8 Reverse -55 -62 13.2151 0.026
NP_440586.1_8 Reverse -269 -276 9.47853 0.146
NP_440586.1_8 Forward -276 -269 5.74197 0.283
NP_442251.1_6 Forward -62 -55 15.2804 0.0124
NP_442251.1_6 Reverse -55 -62 15.2804 0.0124
NP_441262.1_3 Reverse -54 -61 14.7888 0.0223
NP_441262.1_3 Forward -277 -270 14.7888 0.0223
NP_441262.1_3 Forward -63 -56 14.7888 0.0223
NP_443051.1_1 Reverse -53 -62 10.4228 0.00754
NP_443051.1_1 Forward -64 -55 10.4228 0.00754
NP_443051.1_1 Forward -278 -269 7.47288 0.0571
NP_443051.1_1 Reverse -230 -239 -0.000272808 0.245
NP_443051.1_1 Forward -241 -232 -0.000272808 0.245
NP_439996.1_6 Reverse -299 -318 6.06693 0.3
NP_439937.1_8 Forward -279 -260 -3.54046 0.27
NP_439937.1_9 Reverse -267 -284 -3.30509 0.157
NP_440626.1_1 Forward -276 -257 15.3382 0.16
NP_440439.1_1 Forward -66 -53 1.19926 0.159
NP_440439.1_1 Reverse -51 -64 0.117615 0.202
NP_440439.1_1 Forward -280 -267 -2.144 0.298
NP_440372.1_2 Forward -62 -55 16.3621 0.0124
NP_440372.1_2 Reverse -55 -62 16.3621 0.0124
NP_440372.1_2 Forward -276 -269 13.8055 0.0214
NP_440372.1_2 Reverse -269 -276 6.52896 0.188
NP_440171.1_3 Forward -397 -378 12.7825 0.177
NP_440574.1_3 Forward -68 -49 2.55606 0.173
NP_440316.1_10 Forward -278 -268 11.1898 0.214
NP_440316.1_10 Forward -241 -231 6.37155 0.263
NP_439977.1_5 Reverse -225 -244 -1.86883 0.263
NP_440139.1_1 Reverse -353 -372 0.490334 0.291
NP_440139.1_1 Reverse -262 -281 0.490334 0.291
NP_440267.1_2 Reverse -49 -63 8.45543 0.162
NP_442384.1_10 Reverse -268 -281 3.95252 0.172
NP_442384.1_10 Forward -63 -50 1.10092 0.268
NP_442339.1_3 Forward -68 -50 17.7187 0.116
NP_440693.1_8 Forward -396 -377 16.7157 0.229
NP_441604.1_4 Forward -176 -157 3.24438 0.211
NP_442790.1_4 Forward -286 -267 -11.8986 0.237
NP_442262.1_10 Forward -62 -55 14.1988 0.0123
NP_442262.1_10 Reverse -55 -62 14.1988 0.0123
NP_442262.1_10 Reverse -269 -276 13.2155 0.0213
NP_442262.1_10 Reverse -232 -239 7.90559 0.266
NP_441689.1_5 Reverse -52 -62 15.3192 0.0403
NP_441689.1_5 Forward -65 -55 8.53436 0.132
NP_441689.1_5 Forward -279 -269 5.97777 0.197
NP_440163.1_10 Forward -66 -56 15.2213 0.0762
NP_440163.1_10 Forward -280 -270 14.238 0.102
NP_440163.1_10 Reverse -51 -61 11.3864 0.169
NP_440344.1_10 Forward -70 -53 3.18543 0.0274
NP_440344.1_10 Forward -284 -267 -1.33779 0.0527
NP_440344.1_10 Reverse -261 -278 -3.20608 0.0802
NP_440282.1_10 Reverse -221 -240 2.45773 0.154
NP_441335.1_8 Forward -151 -132 9.43923 0.228
NP_441640.1_8 Reverse -269 -288 -4.6221 0.266
NP_440297.1_9 Forward -62 -52 9.32148 0.0917
NP_440297.1_9 Reverse -55 -65 9.32148 0.0917
NP_440297.1_9 Reverse -269 -279 -0.511621 0.289
NP_440350.1_2 Forward -278 -259 4.52268 0.289
NP_441592.1_4 Reverse -231 -250 0.687771 0.23
NP_441896.1_3 Forward -286 -267 -2.75381 0.289
NP_441103.1_9 Reverse -378 -388 12.9778 0.276
NP_440999.1_9 Forward -67 -53 4.62115 0.116
NP_440888.1_2 Forward -63 -49 18.0918 0.00261
NP_440888.1_2 Reverse -54 -68 15.5352 0.0102
NP_440888.1_2 Reverse -268 -282 14.6503 0.0162
NP_440888.1_2 Forward -100 -86 12.192 0.0495
NP_440888.1_2 Reverse -231 -245 8.25877 0.167
NP_440052.1_5 Forward -105 -86 -3.54046 0.235
NP_442948.1_2 Forward -278 -259 2.85105 0.3
NP_442277.1_2 Forward -95 -81 10.226 0.287
NP_442277.1_4 Reverse -222 -241 9.24175 0.115
NP_441543.1_2 Reverse -55 -64 18.486 0.00236
NP_441543.1_2 Forward -62 -53 16.9127 0.00359
NP_441543.1_2 Reverse -232 -241 10.6195 0.0691
NP_441543.1_2 Reverse -269 -278 8.65285 0.0968
NP_441543.1_2 Forward -239 -230 4.81794 0.219
NP_442845.1_2 Forward -181 -167 11.5043 0.128
NP_442845.1_2 Forward -246 -232 5.60446 0.228
NP_442845.1_2 Reverse -48 -62 5.1128 0.243
NP_442845.1_2 Forward -283 -269 4.52282 0.258
NP_441469.1_8 Forward -64 -55 16.126 0.00797
NP_441469.1_8 Reverse -53 -62 6.48957 0.227
NP_441469.1_8 Forward -278 -269 6.39124 0.227
NP_441469.1_8 Reverse -267 -276 5.60459 0.258
NP_443064.1_6 Forward -63 -53 12.5669 0.0796
NP_442337.1_8 Forward -258 -239 4.81767 0.21
NP_442578.1_7 Forward -62 -55 14.5921 0.026
NP_442578.1_7 Reverse -55 -62 14.5921 0.026
NP_442578.1_7 Forward -276 -269 6.0373 0.18
NP_440710.1_1 Reverse -223 -241 -7.55234 0.24
NP_441462.1_2 Forward -63 -53 11.5831 0.00406
NP_441462.1_2 Reverse -54 -64 11.5831 0.00406
NP_441462.1_2 Forward -277 -267 7.55152 0.0543
NP_441462.1_2 Reverse -231 -241 0.668351 0.135
NP_441462.1_2 Forward -240 -230 0.668351 0.135
NP_441462.1_5 Forward -396 -377 1.76941 0.291
NP_441621.1_7 Forward -279 -265 -1.96703 0.188
NP_441621.1_7 Reverse -266 -280 -3.73699 0.193
NP_443062.1_1 Reverse -54 -72 8.44842 0.153
NP_443062.1_1 Forward -63 -45 5.6207 0.224
NP_443062.1_6 Forward -71 -52 5.11266 0.209
NP_443062.1_6 Reverse -46 -65 4.03102 0.224
NP_440519.1_3 Forward -111 -92 10.4225 0.25
NP_442204.1_1 Forward -307 -296 3.10693 0.266
NP_442204.1_1 Forward -281 -270 0.255333 0.282
NP_442204.1_5 Forward -250 -231 3.73603 0.186
NP_440516.1_8 Forward -277 -268 18.9776 0.00442
NP_440516.1_8 Forward -63 -54 16.9127 0.00442
NP_440516.1_8 Reverse -54 -63 16.9127 0.00442
NP_440516.1_8 Reverse -268 -277 5.01461 0.118
NP_441785.1_1 Reverse -54 -68 11.3809 0.3
NP_441033.1_2 Reverse -258 -277 -5.9004 0.293
NP_442428.1_4 Forward -64 -45 3.83436 0.238
NP_442428.1_5 Forward -62 -55 15.8704 0.0124
NP_442428.1_5 Reverse -55 -62 15.8704 0.0124
NP_442428.1_5 Forward -276 -269 6.13563 0.209
NP_442428.1_5 Reverse -269 -276 6.0373 0.212
NP_442428.1_5 Forward -239 -232 4.36568 0.271
NP_442120.1_10 Forward -246 -227 -15.4385 0.294
NP_440673.1_2 Forward -250 -231 9.12141 0.257
NP_440673.1_2 Forward -104 -85 7.85324 0.288
NP_440673.1_3 Forward -61 -54 12.4288 0.0426
NP_440673.1_3 Reverse -270 -277 12.4288 0.0426
NP_440673.1_3 Reverse -56 -63 12.4288 0.0426
NP_441052.1_2 Forward -63 -53 19.9412 0.00106
NP_441052.1_2 Reverse -54 -64 10.5014 0.0285
NP_441052.1_2 Forward -240 -230 4.0116 0.168
NP_441052.1_2 Reverse -268 -278 1.25834 0.249
NP_441052.1_2 Reverse -204 -214 0.57002 0.256
NP_442219.1_8 Reverse -74 -93 10.5829 0.202
NP_442219.1_8 Forward -67 -48 7.97384 0.257
NP_442219.1_8 Reverse -137 -156 6.42771 0.298
NP_442219.1_9 Forward -62 -53 17.7976 0.00718
NP_442219.1_9 Reverse -55 -64 8.35786 0.0681
NP_440436.1_4 Reverse -55 -64 18.1905 0.00233
NP_440436.1_4 Forward -62 -53 17.2072 0.00233
NP_440436.1_4 Reverse -269 -278 8.55409 0.0997
NP_440436.1_4 Forward -93 -84 6.48915 0.157
NP_441884.1_8 Forward -278 -259 -7.27704 0.248
NP_441884.1_9 Forward -66 -47 -23.1083 0.284
NP_441884.1_9 Forward -243 -224 -25.1733 0.29
NP_440041.1_6 Reverse -375 -394 11.5033 0.285
NP_439982.1_8 Forward -204 -185 22.1239 0.038
NP_441719.1_4 Forward -62 -55 16.3621 0.0124
NP_441719.1_4 Reverse -55 -62 16.3621 0.0124
NP_441719.1_4 Forward -276 -269 6.82395 0.0855
NP_441719.1_4 Reverse -269 -276 6.52896 0.188
NP_441733.1_10 Reverse -51 -64 9.95071 0.106
NP_441733.1_10 Forward -280 -267 8.18076 0.14
NP_441733.1_10 Reverse -265 -278 5.82081 0.203
NP_441004.1_1 Reverse -85 -104 -16.0285 0.281
NP_442813.1_5 Reverse -340 -359 3.93269 0.262
NP_441577.1_10 Reverse -50 -69 8.84924 0.198
NP_442366.1_3 Forward -101 -83 2.57575 0.127
NP_442366.1_3 Forward -64 -46 1.29745 0.153
NP_442366.1_3 Reverse -53 -71 -4.79907 0.276
NP_442873.1_3 Reverse -258 -277 3.44025 0.287
NP_440296.1_6 Forward -337 -319 11.7475 0.295
NP_440296.1_10 Forward -243 -224 -4.42544 0.209
NP_442206.1_1 Reverse -138 -157 -12.1936 0.226
NP_443054.1_2 Reverse -52 -66 12.4876 0.0722
NP_443054.1_2 Forward -65 -51 3.34284 0.24
NP_443054.1_2 Reverse -229 -243 0.687908 0.256
NP_443054.1_2 Reverse -89 -103 -0.000409212 0.283
NP_441851.1_10 Forward -64 -54 16.008 0.00552
NP_441851.1_10 Reverse -53 -63 15.8113 0.00552
NP_442515.1_1 Reverse -53 -67 2.75286 0.13
NP_442515.1_1 Forward -64 -50 0.687908 0.183
NP_440593.1_3 Reverse -80 -99 -2.85214 0.228
NP_440593.1_3 Reverse -376 -395 -5.21209 0.259
NP_440593.1_3 Forward -98 -79 -5.31042 0.259
NP_441349.1_10 Reverse -44 -63 8.35759 0.0274
NP_441409.1_6 Forward -69 -50 -6.09707 0.119
NP_442314.1_1 Forward -280 -262 -0.374176 0.231
NP_440389.1_5 Reverse -178 -197 15.8859 0.194
NP_440432.1_9 Forward -62 -47 5.3881 0.0555
NP_440432.1_9 Reverse -55 -70 -2.77337 0.175
NP_440432.1_9 Forward -239 -224 -3.95334 0.194
NP_440432.1_9 Reverse -375 -390 -6.41162 0.299
NP_442843.1_1 Forward -147 -128 -4.42544 0.239
NP_442843.1_1 Forward -155 -136 -11.5053 0.291
NP_439960.1_4 Forward -142 -123 11.8967 0.299
NP_440474.1_8 Reverse -55 -69 7.47213 0.204
NP_440431.1_3 Reverse -184 -203 -10.817 0.278
NP_442450.1_5 Reverse -52 -62 9.32148 0.115
NP_442450.1_5 Forward -65 -55 9.32148 0.115
NP_440588.1_2 Forward -286 -267 -4.72043 0.226
NP_442006.1_2 Reverse -91 -108 10.7569 0.0595
NP_441003.1_9 Forward -109 -90 3.73603 0.291
NP_440483.1_1 Forward -245 -226 -4.03212 0.218
NP_441570.1_1 Forward -63 -45 -0.374176 0.046
NP_441570.1_1 Reverse -204 -222 -11.3872 0.194
NP_441570.1_1 Reverse -54 -72 -16.5988 0.249
NP_441078.1_4 Forward -63 -54 19.6659 0.0007
NP_441078.1_4 Reverse -54 -63 19.6659 0.0007
NP_441078.1_4 Forward -240 -231 15.831 0.00457
NP_441078.1_4 Reverse -231 -240 7.76787 0.0454
NP_441078.1_4 Forward -277 -268 0.196389 0.205
NP_441078.1_4 Reverse -268 -277 -0.000272808 0.205
NP_441663.1_7 Forward -280 -261 8.06259 0.209
NP_440526.1_3 Forward -62 -51 10.1862 0.0646
NP_440526.1_3 Reverse -232 -243 1.92649 0.267
NP_440526.1_3 Reverse -55 -66 1.92649 0.267
NP_441432.1_8 Reverse -53 -62 16.8143 0.00595
NP_441432.1_8 Forward -241 -232 12.7828 0.0354
NP_441432.1_8 Forward -64 -55 8.25953 0.0755
NP_441432.1_8 Reverse -90 -99 5.60459 0.147
NP_441432.1_8 Forward -278 -269 5.50626 0.151
NP_441432.1_8 Reverse -203 -212 2.94966 0.28
NP_443024.1_3 Forward -150 -140 15.2213 0.255
NP_442320.1_8 Reverse -48 -62 11.996 0.0175
NP_442320.1_8 Forward -283 -269 5.99778 0.0309
NP_442320.1_8 Forward -69 -55 5.99778 0.0309
NP_442320.1_8 Reverse -262 -276 -4.52363 0.171
NP_441732.1_2 Forward -67 -51 -16.6577 0.186
NP_440199.1_10 Reverse -51 -61 16.7946 0.0381
NP_440199.1_10 Forward -66 -56 14.533 0.0861
NP_440913.1_1 Forward -242 -224 7.4923 0.202
NP_442489.1_7 Forward -63 -54 20.1576 0.000695
NP_442489.1_7 Reverse -54 -63 20.1576 0.000695
NP_442489.1_7 Forward -240 -231 8.06287 0.0371
NP_442489.1_7 Reverse -231 -240 1.08137 0.109
NP_442489.1_7 Forward -277 -268 0.688044 0.152
NP_442489.1_7 Reverse -268 -277 0.688044 0.152
NP_440565.1_3 Forward -103 -84 15.7735 0.218
NP_442079.1_7 Reverse -55 -74 2.3594 0.229
NP_442079.1_7 Forward -276 -257 1.67108 0.244
NP_440559.1_1 Forward -62 -53 17.4043 0.00658
NP_440559.1_1 Reverse -55 -64 8.75118 0.0586
NP_441659.2_8 Forward -63 -53 18.1713 0.00133
NP_441659.2_8 Reverse -54 -64 11.9764 0.0147
NP_441659.2_8 Reverse -231 -241 9.12481 0.0355
NP_441659.2_8 Forward -240 -230 1.65166 0.233
NP_442913.1_10 Forward -235 -216 -5.11376 0.257
NP_442346.1_5 Reverse -53 -63 16.6963 0.00248
NP_442346.1_5 Forward -241 -231 11.7798 0.0567
NP_442346.1_5 Forward -64 -54 9.02648 0.118
NP_442346.1_5 Reverse -230 -240 6.07655 0.216
NP_442346.1_10 Forward -110 -91 -2.36049 0.294
NP_440545.1_3 Forward -244 -227 -5.07437 0.24
NP_440025.1_1 Forward -67 -48 7.47261 0.243
NP_441629.1_1 Forward -71 -52 10.8159 0.154
NP_440459.1_2 Reverse -331 -348 8.98696 0.243
NP_440459.1_2 Reverse -45 -62 7.80699 0.278
NP_440010.1_10 Forward -144 -125 8.75091 0.213
NP_442551.1_4 Forward -96 -81 -1.69173 0.247
NP_442311.1_5 Reverse -180 -199 0.294447 0.277
NP_440847.1_3 Reverse -140 -154 12.6836 0.234
NP_442603.1_7 Reverse -268 -282 6.78381 0.23
NP_441585.1_5 Reverse -132 -151 10.3234 0.211
NP_440449.1_6 Forward -248 -230 15.0643 0.0907
NP_441948.1_4 Forward -284 -266 -1.94747 0.156
NP_441948.1_4 Forward -70 -52 -2.3408 0.163
NP_441948.1_4 Reverse -47 -65 -3.91409 0.21
NP_441047.1_2 Reverse -238 -257 0.392778 0.239
NP_441833.1_4 Forward -62 -55 15.9687 0.0124
NP_441833.1_4 Reverse -55 -62 15.9687 0.0124
NP_441833.1_4 Reverse -269 -276 6.52896 0.0924
NP_441833.1_4 Forward -276 -269 6.23397 0.163
NP_441112.1_6 Reverse -175 -194 -3.44213 0.296
NP_442699.1_3 Reverse -256 -275 -1.08219 0.273
NP_442162.1_9 Forward -62 -55 16.2637 0.0124
NP_442162.1_9 Reverse -55 -62 16.2637 0.0124
NP_442162.1_9 Forward -276 -269 12.9205 0.0282
NP_442162.1_9 Reverse -269 -276 12.9205 0.0282
NP_440671.1_4 Forward -69 -55 14.5526 0.0587
NP_440671.1_4 Reverse -48 -62 13.7659 0.0748
NP_440671.1_4 Forward -283 -269 9.5377 0.18
NP_441044.1_4 Reverse -257 -275 4.44404 0.227
NP_442199.1_5 Reverse -260 -279 -4.32711 0.224
NP_442199.1_7 Reverse -177 -196 -0.00131823 0.286
NP_442140.1_3 Forward -276 -266 10.0098 0.0949
NP_442140.1_3 Reverse -55 -65 8.33817 0.119
NP_442140.1_3 Reverse -269 -279 6.27322 0.176
NP_442140.1_3 Forward -62 -52 4.40493 0.243
NP_441671.1_10 Forward -186 -167 3.53937 0.227
NP_440875.1_9 Reverse -56 -66 8.37203 0.233
NP_441813.1_5 Forward -65 -55 17.188 0.00979
NP_441813.1_5 Reverse -52 -62 15.9097 0.01
NP_441813.1_5 Forward -279 -269 7.45319 0.0746
NP_441813.1_5 Reverse -266 -276 6.8632 0.0784
NP_442089.1_1 Forward -280 -261 1.86774 0.226
NP_440590.1_4 Reverse -55 -68 5.23083 0.0585
NP_440590.1_4 Reverse -269 -282 3.85419 0.0672
NP_440590.1_4 Forward -62 -49 2.57589 0.0845
NP_440567.1_1 Forward -276 -262 -0.295402 0.276
NP_442497.1_10 Forward -62 -53 10.4228 0.0087
NP_442497.1_10 Reverse -55 -64 10.4228 0.0087
NP_442497.1_10 Reverse -269 -278 0.589713 0.153
NP_440821.1_4 Forward -65 -55 19.0562 0.00399
NP_440821.1_4 Reverse -52 -62 18.2696 0.00448
NP_440821.1_4 Forward -279 -269 9.32148 0.03
NP_440821.1_4 Reverse -266 -276 6.56821 0.0853
NP_441239.1_9 Reverse -266 -278 17.0502 0.0153
NP_441239.1_9 Forward -65 -53 13.3137 0.037
NP_441239.1_9 Reverse -52 -64 6.92215 0.173
NP_441239.1_9 Reverse -130 -142 6.72548 0.178
NP_441239.1_9 Forward -242 -230 6.03717 0.202
NP_441239.1_9 Reverse -229 -241 4.66053 0.248
NP_440706.1_1 Reverse -50 -69 -3.44213 0.258
NP_441727.1_3 Forward -253 -234 3.93269 0.275
NP_442270.1_9 Reverse -80 -99 -10.6203 0.259
NP_442270.1_9 Forward -251 -232 -11.3086 0.27
NP_441017.1_6 Forward -67 -53 12.487 0.217
NP_441017.1_6 Reverse -50 -64 11.7987 0.242
NP_440833.1_6 Reverse -183 -197 8.06211 0.277
NP_440949.1_7 Forward -317 -298 9.24175 0.264
NP_442138.1_10 Forward -262 -243 -6.68705 0.286
NP_440412.1_2 Forward -261 -242 6.98095 0.281
NP_440391.1_6 Reverse -13 -32 18.4857 0.0312
NP_442052.1_8 Reverse -83 -93 13.4514 0.253
NP_442052.1_8 Forward -248 -238 13.353 0.253
NP_440546.1_4 Forward -277 -267 14.0213 0.0459
NP_440546.1_4 Reverse -54 -64 11.8882 0.0679
NP_440546.1_4 Forward -63 -53 10.046 0.109
NP_440546.1_4 Forward -240 -230 9.75513 0.121
NP_440546.1_4 Reverse -231 -241 9.07643 0.156
NP_440546.1_4 Forward -175 -165 8.97947 0.16
NP_440546.1_4 Reverse -268 -278 6.55553 0.291
NP_440546.1_6 Forward -157 -138 10.7175 0.245
NP_440462.1_6 Forward -65 -55 15.418 0.0142
NP_440462.1_6 Reverse -266 -276 14.0414 0.0235
NP_440462.1_6 Reverse -52 -62 7.74818 0.0699
NP_440462.1_6 Forward -279 -269 5.87989 0.135
NP_440868.1_4 Forward -67 -55 8.49544 0.0602
NP_440868.1_4 Reverse -50 -62 5.93884 0.0879
NP_440868.1_4 Reverse -264 -276 1.61227 0.177
NP_440868.1_4 Forward -281 -269 -0.944332 0.284
NP_441249.1_1 Forward -132 -113 9.14423 0.197
NP_442402.1_4 Forward -59 -40 -7.57277 0.276
NP_442402.1_6 Reverse -79 -88 13.0777 0.289
NP_440843.1_8 Forward -246 -227 13.8641 0.297
NP_442039.1_4 Forward -62 -55 15.1821 0.0124
NP_442039.1_4 Reverse -55 -62 15.1821 0.0124
NP_442039.1_4 Forward -276 -269 11.6422 0.0747
NP_441811.1_4 Forward -279 -260 -0.4922 0.295
NP_442829.1_2 Reverse -185 -201 8.23773 0.287
NP_441926.1_3 Reverse -54 -70 6.25339 0.17
NP_441926.1_3 Forward -63 -47 5.56507 0.17
NP_440825.1_6 Forward -150 -131 8.16093 0.285
NP_442837.1_3 Forward -62 -55 15.7721 0.0124
NP_442837.1_3 Reverse -55 -62 15.7721 0.0124
NP_442837.1_3 Forward -276 -269 6.0373 0.25
NP_442837.1_3 Reverse -269 -276 6.0373 0.25
NP_440160.1_9 Reverse -84 -103 12.2908 0.216
NP_442053.1_1 Forward -63 -54 18.3876 0.0007
NP_442053.1_1 Reverse -54 -63 18.3876 0.0007
NP_442053.1_1 Reverse -268 -277 14.4544 0.0114
NP_442053.1_1 Forward -277 -268 7.86621 0.0863
NP_440505.1_3 Reverse -52 -62 16.303 0.00696
NP_440505.1_3 Forward -65 -55 13.8447 0.0247
NP_440505.1_3 Forward -279 -269 12.2714 0.0543
NP_440505.1_3 Reverse -229 -239 6.37155 0.183
NP_441102.1_2 Forward -202 -183 5.99764 0.298
NP_441252.1_6 Forward -197 -190 14.3954 0.168
NP_442532.1_7 Forward -277 -263 11.701 0.121
NP_441408.2_7 Reverse -229 -248 -5.11376 0.291
NP_440914.1_1 Forward -63 -53 17.5935 0.000537
NP_440914.1_1 Reverse -85 -95 10.6645 0.129
NP_440914.1_1 Reverse -54 -64 8.6151 0.186
NP_441011.1_8 Reverse -55 -64 16.9127 0.00602
NP_441011.1_8 Forward -276 -267 11.7994 0.0629
NP_441011.1_8 Forward -239 -230 10.3245 0.108
NP_441011.1_8 Forward -62 -53 8.25953 0.144
NP_441011.1_8 Reverse -269 -278 7.07956 0.179
NP_442533.1_6 Forward -63 -54 17.2076 0.00137
NP_442533.1_6 Reverse -54 -63 17.2076 0.00137
NP_442533.1_6 Reverse -231 -240 8.35786 0.0767
NP_442533.1_6 Forward -240 -231 7.57121 0.0898
NP_442533.1_6 Reverse -268 -277 4.42462 0.179
NP_441482.1_7 Forward -69 -55 -8.94853 0.193
NP_441482.1_7 Reverse -48 -62 -8.94853 0.193
NP_441482.1_7 Forward -283 -269 -11.0135 0.229
NP_439944.1_9 Forward -62 -52 19.0562 0.00329
NP_439944.1_9 Reverse -55 -65 10.3048 0.0887
NP_440116.1_8 Forward -62 -43 -10.0303 0.297
NP_441527.1_4 Forward -389 -370 -10.3613 0.27
NP_441527.1_4 Forward -390 -371 -12.8441 0.294
NP_441680.1_4 Reverse -167 -186 2.94938 0.224
NP_442492.1_2 Forward -277 -258 1.37609 0.227
NP_441106.1_1 Forward -64 -55 18.191 0.0028
NP_441106.1_1 Reverse -53 -62 9.63616 0.0311
NP_441106.1_1 Forward -278 -269 8.45619 0.0548
NP_441106.1_1 Forward -241 -232 5.50626 0.145
NP_439903.1_6 Reverse -228 -247 2.9486 0.216
NP_441286.1_1 Reverse -53 -65 14.4936 0.00418
NP_441286.1_1 Forward -64 -52 11.8387 0.0114
NP_441286.1_1 Forward -278 -266 -5.17256 0.192
NP_440670.1_8 Forward -63 -54 18.3876 0.000699
NP_440670.1_8 Reverse -54 -63 18.3876 0.000699
NP_440670.1_8 Forward -277 -268 8.75118 0.0606
NP_440670.1_8 Reverse -268 -277 6.19458 0.124
NP_440886.1_7 Forward -64 -54 17.7774 0.0011
NP_440886.1_7 Reverse -267 -277 16.4991 0.0104
NP_440886.1_7 Reverse -53 -63 7.94438 0.0805
NP_440886.1_7 Forward -278 -268 6.86274 0.113
NP_442614.1_2 Forward -63 -49 5.80112 0.297
NP_442072.1_9 Forward -64 -46 -3.02911 0.0326
NP_442072.1_9 Reverse -53 -71 -4.60241 0.0476
NP_442072.1_9 Reverse -230 -248 -14.6322 0.153
NP_442022.1_4 Forward -234 -215 6.29264 0.273
NP_440907.2_8 Reverse -55 -65 7.84605 0.117
NP_440907.2_8 Reverse -269 -279 6.0761 0.179
NP_440030.1_2 Reverse -120 -139 13.9625 0.269
NP_440664.1_9 Reverse -248 -267 10.6192 0.226
NP_441021.1_1 Reverse -232 -251 2.16274 0.083
NP_441021.1_1 Forward -99 -80 -11.8986 0.275
NP_441021.1_8 Reverse -49 -67 11.8189 0.11
NP_441021.1_8 Forward -68 -50 2.0841 0.253
NP_441463.1_3 Reverse -258 -277 12.4875 0.0403
NP_441463.1_3 Forward -73 -54 -7.67036 0.259
NP_441463.1_6 Reverse -52 -66 5.64286 0.287
NP_442842.1_4 Forward -180 -161 0.884433 0.299
NP_441626.1_2 Forward -62 -55 15.7721 0.0124
NP_441626.1_2 Reverse -55 -62 15.7721 0.0124
NP_441626.1_2 Forward -276 -269 12.2322 0.0511
NP_441626.1_2 Reverse -269 -276 5.93897 0.231
NP_442615.1_1 Forward -72 -54 1.39578 0.0853
NP_442615.1_1 Reverse -45 -63 1.39578 0.0853
NP_442615.1_1 Forward -249 -231 -6.66736 0.256
NP_441962.1_4 Forward -245 -226 -7.37537 0.188
NP_440387.1_1 Reverse -231 -247 6.64671 0.0282
NP_440387.1_1 Reverse -54 -70 -3.08806 0.155
NP_440387.1_1 Forward -63 -47 -4.36636 0.185
NP_441431.1_2 Reverse -228 -242 5.99717 0.281
NP_441836.1_1 Forward -288 -269 13.2525 0.229
NP_441836.1_2 Reverse -327 -346 -0.590531 0.213
NP_441193.1_1 Reverse -179 -198 9.14342 0.277
NP_441993.1_1 Forward -268 -249 10.4255 0.126
NP_441993.1_1 Forward -246 -227 4.77295 0.214
NP_441993.1_1 Forward -181 -162 2.92126 0.246
NP_440814.1_8 Forward -395 -376 0.392778 0.269
NP_440114.1_10 Forward -240 -226 14.5526 0.0382
NP_440114.1_10 Reverse -54 -68 14.1593 0.0429
NP_440114.1_10 Forward -63 -49 10.4227 0.148
NP_440114.1_10 Forward -277 -263 8.75105 0.195
NP_441510.2_7 Reverse -85 -99 11.9953 0.28
NP_441510.2_7 Reverse -48 -62 10.3237 0.28
NP_441272.1_4 Forward -286 -267 4.71934 0.214
NP_440766.1_4 Forward -281 -267 13.8643 0.0365
NP_440766.1_4 Reverse -50 -64 8.06273 0.0871
NP_440766.1_4 Forward -396 -382 3.04785 0.159
NP_441237.1_9 Forward -93 -83 10.0098 0.255
NP_442930.1_1 Forward -25 -15 12.9592 0.239
NP_439910.1_2 Forward -71 -54 24.6216 0.000724
NP_439910.1_2 Reverse -46 -63 5.25038 0.0287
NP_442867.1_8 Forward -260 -241 5.50599 0.276
NP_440457.1_1 Forward -281 -269 9.28209 0.0929
NP_440457.1_1 Forward -67 -55 0.0389777 0.25
NP_440457.1_1 Reverse -50 -62 0.0389777 0.25
NP_441801.1_4 Reverse -162 -172 2.63497 0.29
NP_441984.1_3 Reverse -227 -245 8.27895 0.232
NP_442509.1_9 Reverse -54 -64 16.2041 0.00739
NP_442509.1_9 Forward -277 -267 11.9759 0.107
NP_442509.1_9 Reverse -268 -278 9.71433 0.192
NP_442509.1_9 Forward -63 -53 8.14104 0.192
NP_440524.1_2 Reverse -270 -289 -3.24547 0.27
NP_440554.1_4 Reverse -55 -65 14.6313 0.02
NP_440554.1_4 Reverse -269 -279 11.6814 0.0377
NP_440554.1_4 Forward -62 -52 7.05986 0.106
NP_440554.1_4 Reverse -232 -242 2.7333 0.254
NP_442862.1_3 Forward -191 -174 15.3785 0.137
NP_441885.1_5 Forward -63 -53 20.9245 0.000538
NP_441885.1_5 Reverse -54 -64 11.4848 0.00668
NP_441885.1_5 Forward -240 -230 0.373358 0.164
NP_441885.1_5 Forward -277 -267 0.0783647 0.183
NP_442341.1_7 Reverse -53 -67 10.0294 0.0682
NP_442341.1_7 Reverse -267 -281 9.2427 0.0751
NP_442341.1_7 Forward -64 -50 8.35772 0.0881
NP_442341.1_9 Forward -65 -51 14.2569 0.0695
NP_443000.1_7 Reverse -52 -62 17.0896 0.00865
NP_443000.1_7 Forward -65 -55 8.73149 0.0437
NP_443000.1_7 Reverse -229 -239 0.766681 0.29
NP_442513.1_5 Forward -221 -202 10.4217 0.266
NP_442513.1_5 Reverse -46 -65 5.80018 0.287
NP_440275.1_3 Forward -65 -55 8.4365 0.0602
NP_440275.1_3 Reverse -52 -62 8.1415 0.0602
NP_440275.1_3 Forward -279 -269 5.87989 0.13
NP_440091.1_1 Forward -67 -55 18.3285 0.0114
NP_440091.1_1 Reverse -50 -62 16.4603 0.0153
NP_443010.1_10 Forward -66 -49 6.24961 0.192
NP_441122.1_1 Forward -98 -83 13.9429 0.126
NP_439962.1_4 Forward -285 -266 -8.06369 0.292
NP_440175.1_7 Forward -185 -167 12.2909 0.225
NP_440149.1_8 Forward -63 -44 4.62101 0.0809
NP_440149.1_8 Reverse -268 -287 -5.9004 0.235
NP_441105.1_3 Forward -251 -232 -7.57203 0.255
NP_440216.1_1 Forward -63 -49 7.9644 0.00737
NP_440216.1_1 Reverse -54 -68 6.3911 0.0156
NP_440216.1_1 Forward -240 -226 -11.6035 0.203
NP_440216.1_9 Reverse -87 -96 7.17789 0.286
NP_440216.1_9 Reverse -149 -158 5.3096 0.298
NP_440172.1_1 Forward -63 -53 15.0247 0.00945
NP_440172.1_1 Reverse -54 -64 8.73149 0.0586
NP_440172.1_1 Reverse -139 -149 7.45319 0.0789
NP_440172.1_1 Forward -240 -230 5.19158 0.149
NP_440172.1_1 Forward -342 -332 1.74999 0.299
NP_442015.1_10 Forward -67 -54 0.904263 0.216
NP_442015.1_10 Reverse -50 -63 0.60927 0.221
NP_442015.1_10 Forward -98 -85 -0.177378 0.255
NP_441226.1_7 Forward -62 -55 14.4934 0.0123
NP_441226.1_7 Reverse -55 -62 14.4934 0.0123
NP_441226.1_7 Forward -276 -269 12.7234 0.0312
NP_441226.1_7 Reverse -269 -276 11.5435 0.0757
NP_441226.1_7 Reverse -352 -359 5.93863 0.266
NP_441111.1_7 Forward -62 -54 18.7023 0.00294
NP_441111.1_7 Reverse -55 -63 18.7023 0.00294
NP_441111.1_7 Reverse -269 -277 8.86921 0.0589
NP_442379.1_10 Reverse -47 -64 -1.43612 0.223
NP_441766.1_2 Forward -63 -54 17.5026 0.00297
NP_441766.1_2 Reverse -54 -63 17.5026 0.00297
NP_441766.1_2 Reverse -268 -277 14.7494 0.00772
NP_442417.1_5 Reverse -268 -282 12.3893 0.0981
NP_440416.1_9 Forward -101 -82 -6.49039 0.0901
NP_443052.1_8 Forward -73 -54 0.392778 0.0664
NP_443052.1_8 Reverse -44 -63 -2.85214 0.0953
NP_443052.1_8 Reverse -113 -132 -9.73531 0.194
NP_440885.1_6 Reverse -182 -201 23.6949 0.0139
NP_440591.1_9 Forward -247 -229 7.19731 0.21
NP_440261.1_1 Forward -103 -90 17.9155 0.186
NP_440261.1_5 Forward -62 -49 -10.6005 0.201
NP_440261.1_5 Forward -93 -80 -12.4687 0.297
NP_440261.1_5 Reverse -55 -68 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGACCGGGTGAGAAAGGGGCAAAGGTTACAATTCCATTTGCGGGACCGGGAAACTTCCGCCGACGACTTACAAATTCTTTTGCGCCATTACACCGAAGGAGAGGCTAATCAATCTTCTTCTACGGCGATCGGGGCATTGATGTTTTCCTGTTTGGGCAGAGGCTATGGCCTGTATGGTACCCCCAATTTTGATAGCCAGATGTTTGGGCAATATTTTCCTGGAGTAGCCCTGGGTGGTTTCTTTTGTAATGGAGAAATTGGCCAGGTGGGTGCTCAGACCTTTTTACACGGTTACACTTCCGCCTTTGCCATTGTCCACAGAGCTAGTTAAATAAACGGCGATCGCCATTTGTTTACTCATATTCTGGTGCCGTCAAATAATTCCCGATGAGAGCAAGCT

CDS

ATGATCGGAGTTAGCGTTAATCCAGAGAAACTAGGATCCACTATGGAGACCGTCAATGTTGACCAAATAGAAATCAATCTTCCTGAGCTTTTGTACAGTATCAAACCAGGGGAAGAAGTCATCGTTGCTGACCAGGGTATTCCCATTGCTAAGTTGGTTCCTCTGCAAAGGCAAAAATCCGTGGATCGATGCTCCAGCTTAGGGGTAGATCGAGGATTATTTGTAGTGCCAGATGACTTTAACGATCCTTTACCAAATGATATTTGGCCATTATCTTGA

Protein

MIGVSVNPEKLGSTMETVNVDQIEINLPELLYSIKPGEEVIVADQGIPIAKLVPLQRQKSVDRCSSLGVDRGLFVVPDDFNDPLPNDIWPLS