Your browser is old and dusty. Try Google Chrome!

Details for ssl0787

ORF ssl0787
Accession NP_442175.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -352 -366 6.19444 0.123
NP_440557.1_1 Reverse -352 -371 -1.86883 0.278
NP_440795.1_7 Forward -359 -352 14.6904 0.0123
NP_440795.1_7 Reverse -352 -359 14.6904 0.0123
NP_441418.1_6 Reverse -351 -370 -2.0655 0.0169
NP_441418.1_6 Reverse -141 -160 -30.4831 0.28
NP_442291.1_5 Forward -361 -345 0.156866 0.173
NP_441453.1_4 Reverse -351 -359 16.539 0.00633
NP_441453.1_4 Forward -360 -352 16.539 0.00633
NP_441453.1_4 Reverse -30 -38 4.73931 0.252
NP_441623.1_1 Reverse -190 -208 -5.78238 0.299
NP_442151.1_6 Forward -360 -346 13.1759 0.0573
NP_442151.1_6 Reverse -351 -365 6.98109 0.214
NP_441818.1_1 Reverse -352 -363 9.30127 0.246
NP_441818.1_9 Forward -177 -158 3.44104 0.18
NP_440226.1_1 Reverse -351 -370 14.8474 0.0289
NP_441630.1_3 Reverse -343 -362 7.27595 0.122
NP_440150.1_6 Forward -363 -344 0.982764 0.295
NP_443002.1_5 Reverse -157 -175 18.0129 0.192
NP_442173.1_1 Forward -359 -351 15.4574 0.00633
NP_442173.1_1 Reverse -352 -360 15.4574 0.00633
NP_442752.1_4 Forward -360 -353 13.8055 0.0199
NP_442752.1_4 Reverse -351 -358 13.8055 0.0199
NP_442752.1_4 Reverse -10 -17 7.90559 0.144
NP_442752.1_4 Reverse -30 -37 4.26735 0.293
NP_443027.1_4 Forward -362 -352 14.828 0.0437
NP_441812.1_3 Forward -268 -254 7.17775 0.286
NP_441812.1_3 Reverse -350 -364 6.88276 0.287
NP_442975.1_10 Forward -364 -350 4.52221 0.245
NP_442975.1_10 Forward -43 -29 2.06395 0.284
NP_442975.1_10 Reverse -347 -361 1.86729 0.29
NP_441225.1_2 Forward -352 -333 4.916 0.217
NP_440784.1_7 Forward -359 -352 15.9687 0.0123
NP_440784.1_7 Reverse -352 -359 15.9687 0.0123
NP_442909.1_7 Forward -359 -345 7.47213 0.215
NP_440061.1_9 Forward -362 -348 12.782 0.0922
NP_440110.1_8 Reverse -349 -368 0.884433 0.211
NP_441145.1_1 Reverse -350 -369 5.60432 0.254
NP_441476.1_5 Forward -211 -192 -6.78538 0.276
NP_442062.1_8 Reverse -351 -361 19.4496 0.000558
NP_442062.1_8 Forward -360 -350 17.6796 0.00193
NP_442062.1_8 Forward -159 -149 4.40493 0.217
NP_441900.1_2 Forward -121 -103 0.0184138 0.263
NP_440304.1_4 Forward -362 -352 10.8948 0.051
NP_440304.1_4 Reverse -349 -359 9.91146 0.051
NP_442242.1_4 Forward -359 -352 14.3954 0.0124
NP_442242.1_4 Reverse -352 -359 14.3954 0.0124
NP_441781.1_7 Forward -360 -341 8.25926 0.156
NP_439918.1_2 Reverse -221 -240 -3.83545 0.262
NP_441208.1_9 Reverse -348 -362 14.4542 0.0974
NP_442110.1_7 Reverse -351 -365 1.67122 0.222
NP_441925.1_4 Forward -363 -344 -14.8492 0.263
NP_441083.1_5 Forward -360 -350 19.3512 0.000718
NP_441083.1_5 Reverse -351 -361 11.3864 0.0159
NP_441083.1_5 Forward -39 -29 -1.10161 0.295
NP_442827.1_8 Forward -368 -349 4.32522 0.137
NP_442827.1_8 Reverse -343 -362 1.17865 0.185
NP_441434.1_7 Reverse -152 -166 2.65453 0.273
NP_441738.1_2 Forward -358 -351 15.28 0.0102
NP_441738.1_2 Reverse -353 -360 15.28 0.0102
NP_441558.1_5 Forward -362 -343 4.42435 0.281
NP_440209.1_1 Reverse -351 -359 18.1123 0.00295
NP_440209.1_1 Forward -360 -352 18.1123 0.00295
NP_442889.1_1 Reverse -365 -384 -14.8485 0.283
NP_442889.1_8 Forward -363 -349 4.12889 0.27
NP_442889.1_8 Forward -162 -148 3.44058 0.278
NP_441713.1_1 Forward -290 -271 -13.7669 0.257
NP_441713.1_1 Forward -45 -26 -16.0285 0.275
NP_441713.1_5 Reverse -92 -111 7.66927 0.255
NP_441770.1_1 Forward -354 -335 14.6499 0.277
NP_441770.1_4 Forward -126 -107 -2.45882 0.188
NP_441770.1_4 Forward -158 -139 -6.68705 0.228
NP_440178.1_7 Reverse -350 -369 -12.6852 0.123
NP_440178.1_7 Reverse -365 -384 -20.5517 0.194
NP_442706.1_10 Forward -278 -260 21.357 0.0744
NP_441792.1_5 Reverse -130 -146 8.515 0.267
NP_441716.1_1 Forward -360 -346 11.6026 0.0936
NP_442111.1_4 Reverse -350 -364 5.60446 0.158
NP_442111.1_4 Forward -40 -26 3.73617 0.233
NP_441163.1_1 Reverse -343 -360 14.9844 0.174
NP_440906.1_5 Forward -359 -352 15.8704 0.0124
NP_440906.1_5 Reverse -352 -359 15.8704 0.0124
NP_440747.1_10 Reverse -348 -360 5.54551 0.0128
NP_440747.1_10 Forward -363 -351 -2.02597 0.0196
NP_441130.1_10 Forward -362 -348 12.3893 0.0957
NP_441486.1_1 Forward -363 -349 22.714 0.00162
NP_441486.1_1 Reverse -348 -362 11.0127 0.0178
NP_442634.1_2 Forward -304 -285 2.16274 0.285
NP_442634.1_4 Reverse -349 -363 -3.63866 0.161
NP_441265.1_6 Reverse -120 -139 21.0414 0.0786
NP_440403.1_4 Forward -369 -350 -7.76869 0.248
NP_440842.1_6 Reverse -124 -143 11.5033 0.261
NP_440842.1_10 Reverse -101 -115 1.96621 0.281
NP_443018.1_3 Forward -359 -352 14.8871 0.0123
NP_443018.1_3 Reverse -352 -359 14.8871 0.0123
NP_443018.1_3 Forward -158 -151 10.2655 0.107
NP_441634.1_8 Forward -161 -147 1.57289 0.188
NP_441634.1_8 Reverse -349 -363 -3.63866 0.295
NP_441634.1_9 Reverse -334 -353 16.8132 0.129
NP_440376.1_1 Forward -360 -351 19.4693 0.000692
NP_440376.1_1 Reverse -351 -360 19.4693 0.000692
NP_440376.1_1 Reverse -30 -39 4.12963 0.173
NP_442687.1_7 Reverse -350 -360 18.5646 0.0028
NP_442687.1_7 Forward -361 -351 15.8113 0.0125
NP_442485.1_3 Reverse -355 -374 5.40766 0.169
NP_442485.1_3 Forward -170 -151 1.37609 0.229
NP_442485.1_3 Reverse -349 -368 -0.885524 0.254
NP_441846.1_10 Reverse -333 -352 -23.5016 0.289
NP_440042.1_2 Reverse -341 -360 0.884433 0.213
NP_442296.1_9 Forward -359 -340 3.34271 0.17
NP_440360.1_5 Reverse -141 -160 -1.27885 0.297
NP_442658.1_1 Forward -362 -352 15.9091 0.00966
NP_442658.1_1 Reverse -349 -359 14.8275 0.0188
NP_440141.1_8 Reverse -206 -225 7.86593 0.232
NP_441855.2_4 Forward -214 -195 13.4757 0.172
NP_442782.1_2 Reverse -271 -285 3.14618 0.267
NP_442782.1_2 Reverse -15 -29 3.14618 0.267
NP_442782.1_2 Reverse -366 -380 1.37622 0.281
NP_440656.1_8 Forward -371 -352 -3.83545 0.198
NP_440656.1_8 Reverse -139 -158 -8.65367 0.273
NP_441414.1_9 Reverse -351 -370 -5.01543 0.166
NP_441487.1_9 Reverse -350 -369 -3.04881 0.298
NP_441958.1_5 Reverse -350 -360 20.5312 0.000966
NP_441958.1_5 Forward -361 -351 12.2714 0.00183
NP_441958.1_5 Reverse -29 -39 0.0783647 0.168
NP_442836.1_5 Reverse -345 -364 3.34271 0.237
NP_439905.1_1 Reverse -352 -365 13.0973 0.178
NP_440984.1_7 Forward -365 -351 13.8643 0.0968
NP_440984.1_7 Reverse -346 -360 7.47274 0.171
NP_442911.1_2 Forward -370 -351 2.3594 0.0515
NP_440153.1_5 Reverse -352 -366 3.34284 0.215
NP_440153.1_8 Reverse -168 -181 -3.02898 0.276
NP_442064.1_1 Reverse -346 -365 -13.7669 0.298
NP_443055.1_6 Reverse -142 -160 11.2281 0.114
NP_442236.1_3 Reverse -345 -364 10.6192 0.199
NP_440993.1_4 Reverse -90 -107 6.03703 0.255
NP_442002.1_9 Reverse -350 -357 14.1004 0.074
NP_442002.1_9 Forward -361 -354 10.7572 0.185
NP_440809.1_9 Forward -369 -351 -7.35568 0.225
NP_441294.1_7 Reverse -347 -361 10.4025 0.191
NP_441646.1_1 Reverse -344 -363 -0.295539 0.26
NP_442438.1_10 Forward -365 -351 11.701 0.0448
NP_442431.1_10 Reverse -93 -111 2.96908 0.226
NP_441000.1_6 Reverse -350 -364 5.1128 0.0933
NP_441000.1_6 Forward -361 -347 2.85119 0.126
NP_440147.1_4 Reverse -349 -362 11.9173 0.0326
NP_440147.1_4 Forward -362 -349 3.75586 0.181
NP_440147.1_4 Reverse -28 -41 0.904263 0.244
NP_441550.1_8 Reverse -349 -359 17.6791 0.00754
NP_441550.1_8 Forward -362 -352 6.0761 0.214
NP_441916.1_7 Reverse -351 -361 18.4663 0.00144
NP_441916.1_7 Forward -360 -350 16.893 0.00407
NP_441916.1_7 Reverse -150 -160 2.63497 0.246
NP_441041.1_4 Forward -110 -91 -5.01543 0.146
NP_441041.1_4 Forward -183 -164 -5.40875 0.152
NP_441041.1_7 Reverse -348 -360 11.9849 0.0689
NP_441041.1_7 Reverse -154 -166 5.27969 0.265
NP_442396.1_5 Forward -364 -351 6.90245 0.215
NP_440569.1_5 Reverse -332 -351 15.9291 0.113
NP_442004.1_6 Reverse -351 -365 1.96621 0.276
NP_441725.1_5 Forward -359 -349 11.7798 0.0247
NP_441725.1_5 Reverse -352 -362 11.2881 0.0247
NP_439966.1_7 Forward -362 -352 18.4657 0.00473
NP_439966.1_9 Forward -362 -353 0.983037 0.253
NP_440202.1_8 Forward -368 -349 21.8669 0.101
NP_442941.1_3 Reverse -352 -362 11.4848 0.0116
NP_442941.1_3 Forward -359 -349 2.53664 0.14
NP_440289.1_2 Forward -363 -350 14.7689 0.0107
NP_440289.1_2 Reverse -348 -361 -2.24233 0.253
NP_440260.1_8 Forward -153 -135 -1.45582 0.233
NP_442281.1_1 Forward -365 -351 10.5204 0.0576
NP_442281.1_1 Forward -164 -150 8.65209 0.0783
NP_442281.1_1 Reverse -145 -159 6.48882 0.124
NP_442281.1_1 Reverse -346 -360 4.71887 0.184
NP_442575.1_8 Reverse -19 -38 -4.03212 0.26
NP_442256.1_2 Reverse -349 -367 -4.70074 0.214
NP_440437.1_1 Forward -366 -347 0.884433 0.162
NP_440647.1_9 Reverse -28 -46 3.85406 0.257
NP_442012.1_1 Reverse -191 -210 14.9458 0.058
NP_442012.1_1 Forward -366 -347 10.7175 0.0771
NP_440498.1_1 Forward -369 -351 8.08229 0.0795
NP_440498.1_1 Reverse -342 -360 -1.25915 0.222
NP_441644.1_6 Forward -360 -350 15.7125 0.0048
NP_441644.1_6 Reverse -351 -361 10.1076 0.0628
NP_441644.1_6 Forward -39 -29 6.66608 0.152
NP_442215.1_2 Reverse -87 -103 0.255197 0.154
NP_442215.1_2 Reverse -349 -365 -3.38305 0.214
NP_442215.1_2 Reverse -126 -142 -7.11963 0.286
NP_440929.1_8 Forward -360 -351 19.2726 0.000701
NP_440929.1_8 Reverse -351 -360 19.2726 0.000701
NP_442933.1_10 Forward -360 -351 17.601 0.00325
NP_442933.1_10 Reverse -351 -360 17.601 0.00325
NP_441751.2_8 Forward -359 -345 -3.04867 0.134
NP_442926.1_5 Reverse -346 -365 18.0364 0.115
NP_442554.1_8 Forward -359 -349 14.238 0.0144
NP_442554.1_8 Reverse -352 -362 13.8447 0.0145
NP_442554.1_8 Reverse -151 -161 2.14332 0.281
NP_441762.1_7 Reverse -350 -362 11.4454 0.0142
NP_441762.1_7 Forward -361 -349 9.47875 0.0142
NP_442313.1_8 Forward -287 -268 14.4541 0.134
NP_442142.1_4 Forward -162 -149 10.9334 0.0646
NP_442142.1_4 Reverse -357 -370 5.91857 0.178
NP_442142.1_4 Reverse -348 -361 5.32859 0.194
NP_442142.1_4 Reverse -147 -160 5.13193 0.201
NP_442142.1_4 Forward -108 -95 2.772 0.278
NP_442292.1_1 Reverse -352 -361 9.63616 0.0183
NP_442292.1_1 Forward -359 -350 9.53783 0.0183
NP_440122.1_2 Forward -107 -88 5.11266 0.234
NP_442476.1_6 Reverse -352 -366 7.27608 0.115
NP_443009.1_5 Reverse -350 -361 20.6093 0.001
NP_443009.1_5 Forward -361 -350 9.10461 0.0965
NP_443009.1_5 Reverse -306 -317 5.66304 0.193
NP_442408.2_1 Reverse -351 -370 3.93269 0.143
NP_442408.2_1 Forward -360 -341 1.47442 0.19
NP_441715.1_4 Reverse -352 -362 16.303 0.0117
NP_441198.1_8 Reverse -349 -359 12.5877 0.12
NP_440379.1_5 Forward -378 -359 -9.53865 0.264
NP_441468.1_1 Forward -359 -352 15.8704 0.0124
NP_441468.1_1 Reverse -352 -359 15.8704 0.0124
NP_441020.2_6 Reverse -349 -366 9.87194 0.159
NP_441673.1_1 Forward -360 -351 20.8459 0.000698
NP_441673.1_1 Reverse -351 -360 20.8459 0.000698
NP_441826.1_2 Forward -366 -352 2.5562 0.125
NP_442490.1_10 Reverse -350 -368 10.7372 0.223
NP_442868.1_6 Reverse -349 -359 9.12481 0.0539
NP_442868.1_6 Forward -362 -352 0.963343 0.205
NP_442808.1_1 Forward -361 -351 18.4657 0.00201
NP_442808.1_1 Reverse -350 -360 8.73102 0.0481
NP_442808.1_1 Reverse -149 -159 5.38779 0.155
NP_441101.1_10 Forward -367 -348 5.01433 0.173
NP_442542.1_9 Forward -367 -353 20.7467 0.00966
NP_442050.1_5 Forward -41 -31 10.0093 0.177
NP_442050.1_5 Forward -362 -352 9.12434 0.193
NP_442050.1_5 Reverse -349 -359 6.96107 0.27
NP_442050.1_5 Forward -231 -221 6.76441 0.282
NP_442342.1_9 Reverse -358 -374 15.1032 0.0889
NP_440558.1_2 Forward -42 -23 -7.4737 0.294
NP_442789.1_4 Reverse -349 -368 -0.000545616 0.197
NP_440274.1_4 Forward -108 -90 2.67408 0.221
NP_441518.1_3 Forward -370 -351 -6.09707 0.132
NP_441878.1_4 Forward -173 -154 7.57094 0.219
NP_441878.1_6 Reverse -350 -360 20.2362 0.0046
NP_441878.1_6 Forward -361 -351 10.4031 0.0176
NP_441878.1_6 Forward -160 -150 0.668351 0.139
NP_441878.1_6 Reverse -149 -159 0.57002 0.14
NP_441878.1_6 Reverse -365 -375 -7.68978 0.255
NP_441036.1_6 Reverse -261 -279 8.86894 0.292
NP_441036.1_8 Forward -361 -351 17.7779 0.000554
NP_441036.1_8 Reverse -350 -360 8.4365 0.174
NP_441557.1_5 Forward -360 -351 19.9609 0.000699
NP_441557.1_5 Reverse -351 -360 19.9609 0.000699
NP_441445.1_1 Forward -369 -350 10.5209 0.0945
NP_441445.1_1 Reverse -255 -274 0.392778 0.275
NP_441445.1_1 Reverse -342 -361 0.294447 0.278
NP_441308.1_8 Forward -362 -352 10.1081 0.22
NP_442183.1_1 Reverse -351 -365 11.406 0.0702
NP_442397.1_9 Forward -302 -283 4.52268 0.254
NP_441574.1_1 Forward -171 -152 -1.47551 0.22
NP_441549.1_9 Reverse -347 -365 -7.25734 0.206
NP_441549.1_9 Forward -364 -346 -7.25734 0.206
NP_442347.1_2 Reverse -352 -361 11.1111 0.056
NP_442347.1_2 Forward -359 -350 3.34298 0.284
NP_441037.1_4 Reverse -349 -359 17.3558 0.0127
NP_441037.1_4 Forward -362 -352 7.02532 0.237
NP_442594.1_8 Reverse -375 -394 9.14423 0.199
NP_442594.1_8 Reverse -7 -26 5.70265 0.241
NP_442594.1_8 Reverse -23 -42 3.6377 0.279
NP_441633.1_3 Forward -362 -349 5.72248 0.0481
NP_441633.1_3 Reverse -349 -362 1.29759 0.109
NP_441633.1_3 Reverse -305 -318 -2.04567 0.171
NP_440136.1_2 Forward -359 -352 15.9687 0.0123
NP_440136.1_2 Reverse -352 -359 15.9687 0.0123
NP_442590.1_10 Forward -366 -347 7.66927 0.221
NP_442998.1_5 Reverse -140 -150 12.3697 0.174
NP_442998.1_5 Reverse -139 -149 11.3864 0.187
NP_442998.1_10 Forward -358 -351 15.5754 0.0102
NP_442998.1_10 Reverse -353 -360 15.5754 0.0102
NP_442998.1_10 Forward -37 -30 13.5105 0.0225
NP_440899.1_2 Forward -371 -352 8.4551 0.2
NP_440299.1_1 Forward -364 -351 8.08184 0.098
NP_440299.1_1 Reverse -347 -360 7.09854 0.121
NP_441799.1_1 Reverse -347 -361 20.8451 0.00422
NP_441799.1_1 Forward -364 -350 8.16044 0.122
NP_441799.1_9 Reverse -350 -369 7.57094 0.108
NP_440640.1_6 Reverse -90 -109 6.58763 0.18
NP_441007.1_10 Forward -365 -352 1.9859 0.202
NP_440256.1_1 Reverse -348 -367 1.57275 0.0733
NP_440256.1_1 Reverse -92 -111 -3.63879 0.137
NP_440256.1_1 Forward -190 -171 -7.67036 0.243
NP_440087.1_1 Forward -369 -350 2.94938 0.167
NP_441512.1_2 Forward -384 -365 16.9115 0.161
NP_441559.1_8 Forward -144 -130 -0.688726 0.179
NP_441559.1_8 Reverse -346 -360 -6.68692 0.279
NP_441559.1_8 Forward -365 -351 -7.08024 0.283
NP_442158.1_4 Forward -146 -136 10.6981 0.283
NP_441179.1_1 Forward -363 -344 3.34271 0.247
NP_442785.1_7 Forward -362 -348 10.4227 0.228
NP_442866.1_1 Forward -155 -136 -4.6221 0.228
NP_440748.1_5 Forward -357 -338 -3.14714 0.291
NP_441464.1_8 Forward -360 -346 17.2075 0.0726
NP_441464.1_10 Forward -182 -168 8.35772 0.284
NP_440026.1_4 Reverse -348 -367 19.764 0.203
NP_440695.1_5 Reverse -351 -370 -1.96717 0.293
NP_442993.1_1 Forward -360 -344 1.92682 0.0502
NP_442993.1_1 Reverse -351 -367 -9.28291 0.181
NP_442993.1_1 Reverse -150 -166 -11.3479 0.244
NP_442386.1_9 Forward -361 -352 15.7322 0.0144
NP_442386.1_9 Reverse -350 -359 6.39082 0.219
NP_441750.1_4 Forward -171 -152 1.76941 0.276
NP_441340.1_5 Forward -359 -352 15.6737 0.0124
NP_441340.1_5 Reverse -352 -359 15.6737 0.0124
NP_441340.1_5 Reverse -31 -38 11.0522 0.0749
NP_441947.1_4 Forward -371 -352 21.2389 0.0188
NP_440168.1_9 Reverse -349 -368 -4.13045 0.296
NP_440327.1_6 Reverse -333 -352 5.60432 0.259
NP_440586.1_8 Forward -359 -352 13.2151 0.026
NP_440586.1_8 Reverse -352 -359 13.2151 0.026
NP_440586.1_8 Forward -158 -151 9.08521 0.178
NP_440586.1_8 Reverse -169 -176 7.1186 0.272
NP_442251.1_6 Forward -359 -352 15.2804 0.0124
NP_442251.1_6 Reverse -352 -359 15.2804 0.0124
NP_440684.1_9 Reverse -345 -359 9.14437 0.221
NP_441262.1_3 Reverse -351 -358 14.7888 0.0223
NP_441262.1_3 Forward -360 -353 14.7888 0.0223
NP_441262.1_3 Reverse -30 -37 5.25066 0.215
NP_440027.1_3 Forward -370 -352 5.32826 0.245
NP_443051.1_1 Reverse -350 -359 18.0926 0.00402
NP_443051.1_1 Forward -361 -352 10.4228 0.00754
NP_443051.1_1 Reverse -29 -38 6.8829 0.066
NP_439937.1_8 Reverse -157 -176 -4.6221 0.286
NP_439937.1_9 Forward -361 -344 -6.84499 0.157
NP_439937.1_9 Reverse -350 -367 -16.0881 0.287
NP_439937.1_9 Forward -40 -23 -17.0714 0.291
NP_441595.1_5 Reverse -344 -362 14.8671 0.126
NP_440439.1_1 Forward -363 -350 19.7838 0.0105
NP_440439.1_1 Reverse -348 -361 2.67422 0.13
NP_439943.1_1 Forward -149 -130 -5.50708 0.232
NP_440372.1_2 Forward -359 -352 16.3621 0.0124
NP_440372.1_2 Reverse -352 -359 16.3621 0.0124
NP_440372.1_2 Reverse -31 -38 4.07068 0.262
NP_440171.1_3 Reverse -381 -400 5.30933 0.284
NP_442511.1_6 Reverse -227 -246 4.03102 0.229
NP_440316.1_10 Forward -370 -360 6.96153 0.251
NP_440316.1_10 Reverse -29 -39 6.17489 0.265
NP_441803.1_2 Forward -365 -346 4.32602 0.18
NP_439977.1_5 Reverse -162 -181 -2.16383 0.272
NP_440210.1_8 Forward -111 -95 8.71166 0.262
NP_441572.1_7 Forward -366 -347 -2.45882 0.196
NP_442384.1_10 Reverse -351 -364 15.4572 0.00986
NP_442384.1_10 Forward -360 -347 10.639 0.0428
NP_442384.1_10 Forward -207 -194 3.06754 0.203
NP_442384.1_10 Forward -375 -362 1.69091 0.249
NP_441877.1_5 Reverse -272 -291 -0.39387 0.276
NP_442262.1_10 Forward -359 -352 14.1988 0.0123
NP_442262.1_10 Reverse -352 -359 14.1988 0.0123
NP_442262.1_10 Forward -158 -151 9.18389 0.211
NP_441689.1_5 Forward -362 -352 8.53436 0.132
NP_440163.1_10 Forward -162 -152 7.84651 0.299
NP_440344.1_10 Forward -367 -350 -9.10594 0.139
NP_440344.1_10 Reverse -344 -361 -11.6625 0.223
NP_440282.1_10 Forward -370 -351 -4.22878 0.25
NP_440282.1_10 Reverse -356 -375 -7.67036 0.253
NP_440531.1_6 Forward -368 -349 15.0441 0.0375
NP_440189.1_2 Reverse -343 -362 -0.0988766 0.284
NP_440189.1_10 Reverse -340 -359 6.4893 0.249
NP_440487.1_1 Reverse -348 -367 -5.40875 0.218
NP_441965.1_10 Reverse -348 -364 5.17175 0.216
NP_440297.1_9 Forward -374 -364 13.353 0.0917
NP_440297.1_9 Forward -359 -349 9.61647 0.0917
NP_440297.1_9 Reverse -352 -362 9.32148 0.0917
NP_442280.1_10 Reverse -329 -347 5.74663 0.283
NP_441592.1_4 Forward -360 -341 -3.44213 0.281
NP_441896.1_3 Forward -369 -350 0.0977854 0.23
NP_440700.1_8 Forward -193 -179 13.4709 0.232
NP_442067.1_4 Forward -371 -352 15.6341 0.0681
NP_442067.1_4 Reverse -355 -374 4.62101 0.256
NP_440999.1_9 Forward -364 -350 6.88276 0.0932
NP_440999.1_9 Reverse -356 -370 -2.06536 0.257
NP_440888.1_2 Reverse -351 -365 15.9285 0.00837
NP_442147.1_7 Reverse -342 -361 9.63589 0.256
NP_442033.1_10 Forward -107 -88 -2.55715 0.153
NP_442033.1_10 Forward -362 -343 -12.6852 0.274
NP_441543.1_2 Reverse -352 -361 18.486 0.00236
NP_441543.1_2 Forward -359 -350 9.34117 0.0818
NP_441543.1_2 Forward -158 -149 4.81794 0.219
NP_441543.1_2 Forward -38 -29 4.52295 0.234
NP_442845.1_2 Reverse -24 -38 6.58777 0.207
NP_442845.1_2 Reverse -345 -359 3.63784 0.282
NP_441551.1_5 Forward -364 -348 9.00595 0.222
NP_441178.1_6 Forward -351 -332 2.16195 0.273
NP_441319.1_8 Forward -366 -348 11.7205 0.147
NP_440982.1_2 Forward -175 -156 20.832 0.0662
NP_441469.1_8 Forward -361 -352 16.126 0.00797
NP_441469.1_8 Reverse -350 -359 13.3727 0.073
NP_442315.1_1 Forward -371 -353 8.47561 0.213
NP_443064.1_6 Forward -360 -350 13.8273 0.0796
NP_443064.1_6 Forward -84 -74 9.65817 0.205
NP_443064.1_6 Reverse -293 -303 9.17338 0.242
NP_442337.1_6 Reverse -337 -356 13.9346 0.245
NP_442337.1_8 Reverse -275 -294 -2.0655 0.293
NP_442578.1_7 Forward -359 -352 14.5921 0.026
NP_442578.1_7 Reverse -352 -359 14.5921 0.026
NP_440710.1_1 Forward -368 -350 -8.92897 0.287
NP_440071.1_5 Forward -378 -359 10.4225 0.261
NP_441462.1_2 Forward -360 -350 20.1379 0.000967
NP_441462.1_2 Reverse -351 -361 11.5831 0.00406
NP_441462.1_2 Reverse -30 -40 6.46988 0.0664
NP_441621.1_7 Reverse -349 -363 -5.40861 0.252
NP_441621.1_7 Reverse -28 -42 -5.40861 0.252
NP_443062.1_6 Reverse -343 -362 1.67108 0.271
NP_441601.1_2 Reverse -345 -364 9.73422 0.14
NP_440519.1_3 Reverse -366 -385 11.9958 0.192
NP_442204.1_1 Reverse -6 -17 6.25352 0.17
NP_441351.1_8 Forward -161 -142 4.42435 0.225
NP_440516.1_2 Reverse -345 -363 0.21581 0.235
NP_440516.1_8 Forward -360 -351 16.9127 0.00442
NP_440516.1_8 Reverse -351 -360 16.9127 0.00442
NP_440516.1_8 Reverse -30 -39 9.24284 0.0264
NP_442428.1_5 Forward -359 -352 15.8704 0.0124
NP_442428.1_5 Reverse -352 -359 15.8704 0.0124
NP_441443.1_7 Reverse -93 -112 -0.590531 0.245
NP_442779.1_10 Forward -151 -133 14.768 0.273
NP_440455.1_2 Forward -260 -247 18.2607 0.225
NP_442859.1_2 Reverse -361 -380 13.8641 0.0878
NP_442120.1_10 Forward -171 -152 -13.7669 0.288
NP_442120.1_10 Reverse -221 -240 -14.8485 0.289
NP_440673.1_2 Reverse -140 -159 15.0721 0.0952
NP_440673.1_3 Forward -358 -351 12.4288 0.0426
NP_440673.1_3 Reverse -353 -360 12.4288 0.0426
NP_443048.1_5 Forward -166 -153 21.4554 0.0819
NP_441052.1_2 Reverse -351 -361 10.5014 0.0285
NP_441052.1_2 Forward -360 -350 10.4031 0.0285
NP_441052.1_2 Forward -159 -149 0.963343 0.255
NP_442219.1_8 Reverse -139 -158 6.71761 0.291
NP_442219.1_9 Reverse -352 -361 8.35786 0.0681
NP_442219.1_9 Forward -359 -350 8.25953 0.0681
NP_440436.1_4 Reverse -352 -361 18.1905 0.00233
NP_440436.1_4 Forward -359 -350 15.9289 0.00508
NP_441884.1_8 Reverse -365 -384 -1.86883 0.138
NP_441884.1_9 Reverse -348 -367 -5.60541 0.0594
NP_441884.1_9 Forward -155 -136 -22.125 0.275
NP_441884.1_9 Reverse -138 -157 -24.3866 0.286
NP_440314.1_9 Forward -359 -340 0.982764 0.0947
NP_441719.1_4 Forward -359 -352 16.3621 0.0124
NP_441719.1_4 Reverse -352 -359 16.3621 0.0124
NP_441004.1_1 Forward -171 -152 -2.55715 0.147
NP_441004.1_1 Reverse -26 -45 -11.7019 0.241
NP_441004.1_1 Reverse -335 -354 -13.1769 0.255
NP_442366.1_3 Forward -361 -343 5.52568 0.0875
NP_442366.1_5 Reverse -348 -358 17.2858 0.0141
NP_440296.1_10 Reverse -348 -367 -11.8986 0.269
NP_440328.1_4 Forward -366 -347 9.14423 0.105
NP_443054.1_2 Forward -362 -348 8.94771 0.104
NP_443054.1_2 Forward -161 -147 0.786239 0.254
NP_441851.1_10 Reverse -350 -360 17.4829 0.0027
NP_441851.1_10 Forward -361 -351 16.008 0.00552
NP_441851.1_10 Reverse -196 -206 8.4365 0.116
NP_442622.1_8 Forward -360 -342 -8.92897 0.138
NP_442856.1_7 Forward -369 -350 4.22769 0.137
NP_442856.1_7 Forward -168 -149 -6.58872 0.299
NP_441668.1_4 Reverse -16 -35 -2.26216 0.288
NP_442515.1_1 Reverse -350 -364 11.0127 0.0431
NP_442515.1_1 Forward -361 -347 3.93283 0.11
NP_441349.1_10 Reverse -341 -360 5.30933 0.0446
NP_442843.1_1 Forward -158 -139 -1.18052 0.192
NP_439960.1_4 Forward -145 -126 14.0599 0.225
NP_440474.1_8 Reverse -352 -366 12.192 0.0915
NP_442450.1_5 Reverse -349 -359 17.3846 0.0267
NP_442450.1_5 Forward -362 -352 9.32148 0.115
NP_440588.1_2 Reverse -342 -361 19.3707 0.0104
NP_441031.1_8 Reverse -265 -284 -3.54046 0.248
NP_441031.1_10 Forward -259 -240 14.5352 0.286
NP_442006.1_2 Forward -369 -352 -5.76269 0.146
NP_441570.1_1 Reverse -351 -369 1.29745 0.0315
NP_441078.1_4 Forward -360 -351 19.6659 0.0007
NP_441078.1_4 Reverse -351 -360 19.6659 0.0007
NP_441078.1_4 Forward -39 -30 -1.57357 0.266
NP_441078.1_4 Forward -159 -150 -1.6719 0.266
NP_441078.1_4 Reverse -150 -159 -1.77023 0.266
NP_442729.1_8 Forward -364 -351 9.45906 0.125
NP_442348.1_2 Reverse -226 -235 10.3245 0.27
NP_440707.1_6 Forward -368 -349 12.3883 0.217
NP_442443.1_1 Reverse -336 -355 -6.68705 0.295
NP_440526.1_3 Forward -359 -348 1.6315 0.267
NP_441432.1_8 Reverse -350 -359 8.35786 0.0755
NP_441432.1_8 Forward -361 -352 8.25953 0.0755
NP_441432.1_8 Reverse -29 -38 4.52295 0.206
NP_442320.1_8 Forward -366 -352 -3.83532 0.134
NP_441732.1_2 Reverse -347 -363 -7.41462 0.0849
NP_441732.1_2 Forward -364 -348 -7.61128 0.0861
NP_441732.1_2 Reverse -26 -42 -17.7394 0.292
NP_442343.1_8 Reverse -102 -118 17.364 0.293
NP_441030.1_6 Reverse -358 -377 11.3112 0.287
NP_440313.1_5 Reverse -135 -153 10.6381 0.294
NP_442003.1_4 Forward -359 -340 10.1275 0.291
NP_440760.1_1 Forward -360 -341 -12.6852 0.0945
NP_440760.1_1 Reverse -351 -370 -20.65 0.224
NP_440199.1_10 Forward -363 -353 13.2547 0.108
NP_440461.1_3 Reverse -343 -362 16.4207 0.212
NP_441057.1_3 Forward -147 -128 -13.4719 0.285
NP_441057.1_4 Reverse -95 -113 11.4255 0.14
NP_442353.1_4 Reverse -345 -364 -0.492971 0.29
NP_442510.1_5 Reverse -357 -376 15.2408 0.203
NP_442751.1_2 Reverse -350 -369 9.7334 0.206
NP_441072.1_2 Reverse -340 -359 10.0292 0.207
NP_440713.1_4 Forward -197 -178 0.982764 0.298
NP_442489.1_2 Forward -170 -151 3.04771 0.25
NP_442489.1_7 Forward -360 -351 20.1576 0.000695
NP_442489.1_7 Reverse -351 -360 20.1576 0.000695
NP_442489.1_7 Reverse -150 -159 5.21127 0.077
NP_442489.1_7 Forward -159 -150 -1.6719 0.235
NP_440559.1_1 Forward -359 -350 17.306 0.00658
NP_440559.1_1 Reverse -352 -361 8.75118 0.0586
NP_442763.1_10 Forward -211 -192 9.0459 0.251
NP_441659.2_8 Forward -360 -350 19.3512 0.000966
NP_441659.2_8 Reverse -351 -361 11.9764 0.0147
NP_442913.1_10 Reverse -342 -361 -1.27885 0.168
NP_439956.1_7 Forward -183 -164 5.89931 0.257
NP_441807.1_5 Forward -371 -352 8.55425 0.259
NP_442346.1_5 Reverse -350 -360 17.9746 0.00128
NP_442346.1_5 Forward -361 -351 9.02648 0.118
NP_440545.1_3 Reverse -347 -364 19.41 0.00865
NP_440545.1_3 Reverse -26 -43 -4.18939 0.22
NP_440545.1_5 Reverse -26 -43 4.56207 0.244
NP_440025.1_1 Reverse -347 -366 8.75091 0.212
NP_440831.1_3 Forward -369 -350 25.3172 0.00447
NP_440459.1_2 Forward -168 -151 10.5603 0.196
NP_441653.1_3 Reverse -335 -349 14.1593 0.265
NP_442137.1_8 Reverse -371 -389 16.9633 0.262
NP_442603.1_7 Reverse -351 -365 10.5204 0.125
NP_441585.1_5 Reverse -134 -153 5.11187 0.226
NP_441948.1_4 Reverse -344 -362 1.19912 0.133
NP_441948.1_4 Forward -367 -349 -1.75081 0.152
NP_441833.1_4 Forward -359 -352 15.9687 0.0124
NP_441833.1_4 Reverse -352 -359 15.9687 0.0124
NP_441112.1_6 Reverse -297 -316 2.45773 0.241
NP_442162.1_9 Forward -359 -352 16.2637 0.0124
NP_442162.1_9 Reverse -352 -359 16.2637 0.0124
NP_442140.1_3 Forward -359 -349 13.5497 0.0542
NP_442140.1_3 Reverse -352 -362 8.33817 0.119
NP_440875.1_9 Reverse -152 -162 12.7522 0.104
NP_440875.1_9 Forward -102 -92 7.00932 0.287
NP_441813.1_5 Forward -362 -352 17.188 0.00979
NP_441813.1_5 Reverse -349 -359 8.82982 0.0367
NP_442089.1_6 Forward -149 -130 12.6841 0.112
NP_440590.1_4 Reverse -352 -365 3.65753 0.0702
NP_440590.1_4 Forward -359 -346 3.26421 0.0749
NP_440567.1_1 Reverse -352 -366 15.4376 0.0176
NP_440567.1_1 Forward -38 -24 0.589577 0.24
NP_442497.1_10 Forward -359 -350 19.8626 0.00532
NP_442497.1_10 Reverse -352 -361 10.4228 0.0087
NP_440821.1_4 Forward -362 -352 19.0562 0.00399
NP_440821.1_4 Reverse -349 -359 10.9931 0.0146
NP_440227.1_10 Reverse -69 -88 17.6982 0.186
NP_441239.1_9 Forward -362 -350 16.8536 0.0155
NP_441239.1_9 Reverse -349 -361 13.3137 0.037
NP_441239.1_9 Forward -161 -149 7.11881 0.169
NP_441239.1_9 Reverse -148 -160 5.64384 0.213
NP_441239.1_9 Forward -41 -29 4.95553 0.234
NP_440156.1_4 Forward -151 -141 16.4991 0.176
NP_441892.1_1 Reverse -342 -359 2.89044 0.133
NP_441892.1_1 Forward -369 -352 -6.15601 0.298
NP_442044.1_1 Reverse -163 -182 -14.4552 0.291
NP_442270.1_9 Reverse -340 -359 -10.3253 0.253
NP_442643.1_7 Forward -116 -97 11.1109 0.124
NP_442643.1_8 Forward -34 -16 9.85146 0.29
NP_443035.1_10 Forward -367 -350 6.13536 0.273
NP_440212.1_9 Forward -132 -113 0.561225 0.293
NP_441526.1_6 Reverse -27 -46 7.7676 0.258
NP_440354.1_7 Forward -366 -348 11.3272 0.224
NP_442138.1_10 Reverse -351 -370 -6.49039 0.285
NP_442052.1_8 Reverse -349 -359 12.7631 0.253
NP_442809.1_6 Reverse -129 -148 6.78429 0.256
NP_440546.1_4 Forward -360 -350 12.8578 0.0572
NP_440546.1_4 Reverse -30 -40 12.8578 0.0572
NP_440546.1_4 Reverse -351 -361 11.8882 0.0679
NP_441656.1_6 Forward -111 -92 11.5042 0.193
NP_440462.1_6 Forward -362 -352 15.418 0.0142
NP_440462.1_6 Forward -41 -31 5.68323 0.145
NP_440462.1_6 Reverse -349 -359 1.455 0.294
NP_442340.1_3 Reverse -152 -171 -5.31042 0.223
NP_440868.1_4 Forward -364 -352 20.2952 0.00865
NP_440868.1_4 Reverse -347 -359 8.79043 0.0582
NP_440868.1_4 Reverse -26 -38 3.48056 0.135
NP_442499.1_3 Forward -178 -160 7.68896 0.282
NP_441249.1_8 Reverse -377 -396 9.3409 0.177
NP_441582.1_5 Forward -362 -343 10.9134 0.154
NP_440402.1_9 Reverse -379 -398 11.5042 0.262
NP_442402.1_4 Forward -146 -127 -4.52452 0.226
NP_442402.1_9 Reverse -340 -359 15.7324 0.177
NP_442258.1_2 Reverse -152 -171 -2.75381 0.198
NP_441084.1_6 Reverse -132 -146 15.0646 0.0931
NP_440696.1_6 Reverse -339 -358 15.6341 0.157
NP_442039.1_4 Forward -359 -352 15.1821 0.0124
NP_442039.1_4 Reverse -352 -359 15.1821 0.0124
NP_442039.1_4 Reverse -31 -38 8.59391 0.193
NP_441811.1_8 Reverse -345 -359 9.14437 0.227
NP_442409.1_5 Reverse -338 -357 12.8808 0.265
NP_440825.1_7 Forward -359 -349 11.8361 0.2
NP_442696.1_6 Forward -379 -360 -5.01543 0.186
NP_442837.1_3 Forward -359 -352 15.7721 0.0124
NP_442837.1_3 Reverse -352 -359 15.7721 0.0124
NP_442837.1_3 Reverse -281 -288 6.13563 0.25
NP_442053.1_1 Forward -360 -351 18.3876 0.0007
NP_442053.1_1 Reverse -351 -360 18.3876 0.0007
NP_442053.1_1 Forward -39 -30 4.62128 0.235
NP_440505.1_3 Forward -362 -352 13.8447 0.0247
NP_440505.1_3 Reverse -28 -38 4.99491 0.252
NP_441203.1_1 Reverse -227 -246 -15.9302 0.244
NP_441203.1_1 Forward -359 -340 -19.8634 0.297
NP_442174.1_1 Forward -77 -58 29.4987 0.000188
NP_442174.1_2 Forward -218 -199 20.059 0.0358
NP_442174.1_3 Forward -125 -106 21.5339 0.0443
NP_442174.1_4 Forward -100 -81 22.5172 0.0514
NP_442174.1_7 Forward -319 -301 18.8004 0.259
NP_440914.1_1 Reverse -351 -361 8.6151 0.186
NP_440914.1_1 Forward -360 -350 8.51751 0.186
NP_441011.1_8 Reverse -352 -361 16.9127 0.00602
NP_441011.1_8 Forward -359 -350 14.356 0.0249
NP_442533.1_1 Reverse -381 -400 -5.9004 0.155
NP_442533.1_1 Reverse -348 -367 -15.4385 0.254
NP_442533.1_6 Forward -360 -351 17.2076 0.00137
NP_442533.1_6 Reverse -351 -360 17.2076 0.00137
NP_442533.1_6 Reverse -150 -159 6.8829 0.101
NP_442533.1_6 Forward -159 -150 6.78456 0.103
NP_442232.1_3 Reverse -343 -362 -13.4719 0.282
NP_442322.1_4 Forward -377 -360 -9.69657 0.296
NP_439944.1_9 Reverse -352 -362 10.3048 0.0887
NP_439944.1_9 Forward -359 -349 8.82982 0.101
NP_440816.1_7 Forward -364 -345 9.53756 0.252
NP_440116.1_8 Reverse -221 -240 -9.73531 0.287
NP_440115.1_6 Reverse -348 -358 8.63316 0.128
NP_440007.1_9 Forward -233 -219 6.48943 0.223
NP_439965.1_1 Forward -117 -98 -8.55534 0.273
NP_439965.1_1 Forward -369 -350 -9.047 0.284
NP_442492.1_2 Reverse -30 -49 4.42435 0.212
NP_440608.1_6 Reverse -352 -371 5.2102 0.255
NP_441602.1_3 Forward -177 -158 3.44104 0.175
NP_441602.1_3 Reverse -192 -211 2.3594 0.199
NP_441106.1_1 Forward -361 -352 18.191 0.0028
NP_441106.1_1 Reverse -350 -359 9.73449 0.0311
NP_439903.1_7 Reverse -342 -361 4.81767 0.281
NP_442306.1_10 Forward -365 -346 -20.945 0.237
NP_441286.1_1 Forward -361 -349 5.93884 0.0258
NP_441286.1_1 Reverse -350 -362 5.05386 0.0259
NP_440670.1_8 Forward -360 -351 18.3876 0.000699
NP_440670.1_8 Reverse -351 -360 18.3876 0.000699
NP_440886.1_7 Forward -361 -351 17.7774 0.0011
NP_440886.1_7 Reverse -350 -360 8.04271 0.0805
NP_440886.1_7 Forward -40 -30 6.17443 0.141
NP_440886.1_7 Forward -354 -344 4.7978 0.218
NP_442614.1_2 Reverse -351 -365 8.35772 0.255
NP_442614.1_2 Forward -360 -346 7.27608 0.275
NP_442072.1_9 Reverse -350 -368 -21.3187 0.207
NP_440907.2_8 Forward -359 -349 16.2041 0.0161
NP_440907.2_8 Forward -38 -28 10.8943 0.0969
NP_440907.2_8 Reverse -352 -362 7.84605 0.117
NP_441021.1_1 Forward -359 -340 2.0644 0.083
NP_441021.1_8 Reverse -346 -364 14.6705 0.088
NP_441021.1_8 Forward -164 -146 8.08229 0.181
NP_441463.1_3 Forward -49 -30 -10.3253 0.293
NP_441463.1_6 Reverse -94 -108 7.86544 0.25
NP_441626.1_2 Forward -359 -352 15.7721 0.0124
NP_441626.1_2 Reverse -352 -359 15.7721 0.0124
NP_441626.1_2 Reverse -31 -38 10.7572 0.0837
NP_441988.1_2 Reverse -162 -181 13.2741 0.239
NP_442238.1_3 Reverse -221 -240 14.7491 0.0671
NP_442794.1_1 Reverse -92 -104 2.79224 0.286
NP_442615.1_1 Reverse -342 -360 4.14905 0.0489
NP_440387.1_1 Reverse -351 -367 4.77842 0.0388
NP_440387.1_1 Forward -360 -344 -0.138127 0.135
NP_441431.1_2 Forward -363 -349 12.0937 0.128
NP_441431.1_2 Forward -162 -148 5.99717 0.281
NP_441431.1_2 Reverse -348 -362 5.89884 0.284
NP_441431.1_3 Forward -165 -146 3.34271 0.268
NP_441836.1_2 Reverse -348 -367 0.687771 0.201
NP_440358.1_2 Forward -399 -382 18.5243 0.116
NP_440467.1_3 Forward -38 -19 14.772 0.156
NP_440114.1_10 Forward -360 -346 13.6676 0.0526
NP_440114.1_10 Reverse -351 -365 13.5693 0.0531
NP_440114.1_10 Forward -39 -25 10.1277 0.153
NP_442684.1_2 Forward -368 -349 14.3558 0.288
NP_440725.1_4 Forward -210 -191 8.94757 0.118
NP_441510.2_7 Forward -366 -352 10.2254 0.281
NP_440766.1_4 Forward -364 -350 5.40779 0.112
NP_439988.1_7 Reverse -353 -367 11.7003 0.292
NP_441237.1_9 Forward -359 -349 17.188 0.00445
NP_440643.1_6 Forward -386 -367 11.6025 0.107
NP_440457.1_1 Reverse -347 -359 2.98891 0.204
NP_440457.1_1 Forward -364 -352 1.80894 0.223
NP_440798.1_6 Forward -359 -346 13.4906 0.0445
NP_440798.1_6 Forward -38 -25 8.86907 0.11
NP_440798.1_6 Reverse -352 -365 6.1158 0.14
NP_440801.1_8 Forward -361 -342 11.3075 0.134
NP_442297.1_4 Reverse -26 -45 13.016 0.255
NP_442509.1_9 Forward -360 -350 17.3841 0.00128
NP_442509.1_9 Reverse -351 -361 16.2041 0.00739
NP_442509.1_9 Reverse -239 -249 7.0594 0.24
NP_442509.1_9 Forward -207 -197 6.27276 0.279
NP_442439.1_8 Reverse -149 -168 10.4225 0.246
NP_440554.1_4 Reverse -352 -362 14.6313 0.02
NP_442862.1_3 Forward -149 -132 12.6252 0.181
NP_441885.1_5 Reverse -351 -361 11.4848 0.00668
NP_441885.1_5 Forward -360 -350 11.3864 0.00668
NP_442341.1_7 Reverse -350 -364 13.3726 0.0355
NP_442341.1_7 Forward -361 -347 6.6861 0.12
NP_442341.1_9 Forward -362 -348 13.9619 0.0738
NP_440409.1_1 Forward -368 -349 2.16274 0.18
NP_443000.1_7 Forward -362 -352 8.73149 0.0437
NP_443000.1_7 Reverse -349 -359 2.04498 0.226
NP_442513.1_5 Forward -368 -349 6.98015 0.282
NP_440727.1_2 Forward -368 -349 0.982764 0.288
NP_441842.1_1 Forward -37 -24 11.2284 0.262
NP_441842.1_10 Reverse -23 -37 16.0275 0.0347
NP_441842.1_10 Forward -367 -353 15.9292 0.0359
NP_440275.1_3 Reverse -349 -359 9.91146 0.046
NP_440275.1_3 Forward -362 -352 8.4365 0.0602
NP_440091.1_1 Forward -364 -352 8.29878 0.0653
NP_442275.1_1 Reverse -334 -353 2.75272 0.284
NP_440679.1_10 Reverse -353 -372 -15.9302 0.25
NP_443010.1_10 Forward -363 -346 6.53951 0.182
NP_442451.1_2 Forward -368 -349 11.4058 0.0627
NP_439962.1_4 Forward -112 -93 -3.44213 0.251
NP_442495.1_4 Reverse -29 -39 10.8948 0.296
NP_440149.1_8 Reverse -351 -370 4.62101 0.0809
NP_440216.1_1 Reverse -351 -365 8.55439 0.00592
NP_440216.1_1 Forward -360 -346 6.78443 0.0124
NP_440216.1_9 Reverse -137 -146 8.25953 0.286
NP_440172.1_1 Forward -360 -350 16.303 0.00854
NP_440172.1_1 Reverse -351 -361 8.73149 0.0586
NP_440172.1_1 Forward -316 -306 8.1415 0.0678
NP_442015.1_10 Reverse -347 -360 11.4257 0.0372
NP_442015.1_10 Forward -364 -351 9.75405 0.0449
NP_441226.1_7 Forward -359 -352 14.4934 0.0123
NP_441226.1_7 Reverse -352 -359 14.4934 0.0123
NP_442446.1_7 Forward -200 -181 -1.96717 0.294
NP_441111.1_7 Forward -359 -351 18.7023 0.00294
NP_441111.1_7 Reverse -352 -360 18.7023 0.00294
NP_442379.1_10 Forward -367 -350 -2.91109 0.245
NP_441766.1_2 Forward -360 -351 17.5026 0.00297
NP_441766.1_2 Reverse -351 -360 17.5026 0.00297
NP_441766.1_2 Forward -39 -30 4.91628 0.154
NP_441766.1_9 Forward -368 -349 -0.983855 0.261
NP_440416.1_9 Forward -367 -348 -4.81876 0.0783
NP_443052.1_8 Forward -370 -351 2.3594 0.0563
NP_440261.1_5 Reverse -352 -365 6.80412 0.0316
NP_440261.1_5 Forward -359 -346 5.23083 0.045
NP_440261.1_5 Forward -374 -361 -12.1738 0.272
NP_440988.1_10 Reverse -262 -276 11.1917 0.187
NP_440988.1_10 Forward -275 -261 7.60958 0.216
NP_440988.1_10 Reverse -103 -117 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCGCACCCTACTCACCCTAGACCAAGCTAAGGCCCTGACGGCGATCGCCCACTACCAGGCCAAGCCGTTAAATGTAACCATGCGGCAATTACTAATTGCGGAACGACAAATGCGAGCCAAACAGTTGCCAGTGGGCACCAATTTTTTACTGTCGGATTACCTAGACCAATTCCGTTCCCATTTTAGTAGCCGGATGAATCCCCGCCGGGCTAAAGTATCGGTGTTGTTGGCTTCGGAACCGGCCATGGACGATTTTGCCCTGGGTTTGCTTAACCAATTGATGTTTTGCACCGGCACCATTGGCATGGAACGTTTATGGATCAGCTTGTTTGACGGAGAAGTAGCTTGAATATTCAACGACCCTATCGCCTACCCAACTGTACCCTCACCCTGGAGGGC

CDS

ATGGCCAGCGGCACTGACCCCGGTTCTAGCAACGGGGATTTGCAAATCATTCTCAATGCCCGTTGTCAGTTTCTCAGTACCAATCAAAGTTTAGAGGGGGGGAGGGCTTTTCTGGAAGCCTTGGCCAAGGCGGTCAACAGTTACGCCCAGGGTTGTTTGAGTGGGATTCCCCACCCCGCAGAAACCAAGGGGGAAAATGGGGAATGGGCCGAGTTAATGCCCCTGCCGGATCAGGCCCTGCACCGTTTGGTGTGGCATCCGCCGGCCGATGAATCCTCCAGGCGATCGCCGTTGACCTAA

Protein

MASGTDPGSSNGDLQIILNARCQFLSTNQSLEGGRAFLEALAKAVNSYAQGCLSGIPHPAETKGENGEWAELMPLPDQALHRLVWHPPADESSRRSPLT