Your browser is old and dusty. Try Google Chrome!

Details for ssl0769

ORF ssl0769
Accession NP_442190.1
Symbol
Category Transposon-related functions
Definition putative transposase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -136 -122 -1.27871 0.255
NP_441453.1_7 Forward -367 -360 11.9372 0.298
NP_441818.1_9 Forward -326 -307 3.73603 0.18
NP_441818.1_9 Reverse -254 -273 -7.86702 0.274
NP_441818.1_9 Forward -301 -282 -8.35868 0.277
NP_440150.1_6 Forward -128 -109 2.45773 0.27
NP_442287.1_3 Forward -207 -190 13.5094 0.294
NP_440110.1_8 Forward -244 -225 1.47442 0.211
NP_441476.1_5 Reverse -309 -328 4.42435 0.171
NP_442062.1_8 Forward -308 -298 4.3066 0.221
NP_440761.1_4 Forward -303 -284 -14.8485 0.273
NP_441594.1_6 Forward -329 -310 1.76941 0.262
NP_440370.1_10 Reverse -113 -132 8.25926 0.243
NP_440132.1_9 Forward -380 -361 18.1907 0.06
NP_442110.1_1 Reverse -14 -33 24.0067 0.00358
NP_441925.1_4 Reverse -81 -100 -17.3075 0.293
NP_440209.1_1 Reverse -122 -130 2.1827 0.254
NP_442570.1_3 Reverse -114 -133 1.17943 0.198
NP_441716.1_1 Forward -137 -123 4.62115 0.254
NP_441163.1_1 Reverse -291 -308 4.26636 0.291
NP_440747.1_10 Forward -140 -128 -11.5641 0.125
NP_442634.1_4 Forward -300 -286 -4.7203 0.217
NP_441014.1_10 Forward -393 -374 -2.16459 0.274
NP_441014.1_10 Forward -324 -305 -2.75457 0.287
NP_443018.1_3 Forward -130 -123 11.3472 0.0846
NP_443018.1_3 Reverse -123 -130 4.16902 0.278
NP_440376.1_1 Reverse -128 -137 6.48957 0.0963
NP_440376.1_1 Forward -245 -236 1.96635 0.236
NP_440376.1_1 Forward -308 -299 0.688044 0.262
NP_441857.1_6 Forward -246 -236 15.0247 0.215
NP_442687.1_7 Forward -204 -194 5.28991 0.211
NP_441422.1_7 Reverse -312 -329 -6.451 0.251
NP_440667.1_2 Reverse -29 -48 -5.70374 0.261
NP_442296.1_9 Reverse -347 -366 -5.21209 0.282
NP_442658.1_9 Forward -320 -301 11.2092 0.289
NP_442782.1_2 Forward -298 -284 3.63784 0.263
NP_440656.1_8 Forward -54 -35 -7.96535 0.27
NP_442544.1_2 Reverse -375 -389 0.491246 0.217
NP_442937.1_5 Forward -148 -129 11.2092 0.144
NP_439990.1_5 Forward -397 -384 5.62415 0.283
NP_442911.1_2 Reverse -118 -137 -3.63879 0.115
NP_440153.1_8 Reverse -317 -330 -2.24233 0.235
NP_442064.1_4 Reverse -112 -131 12.4867 0.153
NP_442032.1_5 Forward -172 -162 16.2041 0.279
NP_441712.1_3 Reverse -200 -213 13.3923 0.288
NP_442431.1_10 Forward -329 -311 1.10079 0.26
NP_440147.1_4 Reverse -381 -394 3.36254 0.188
NP_440147.1_4 Reverse -312 -325 0.707601 0.247
NP_441175.1_7 Forward -122 -103 13.2741 0.113
NP_440569.1_7 Reverse -317 -336 14.5524 0.199
NP_439966.1_7 Reverse -120 -130 4.50281 0.269
NP_440202.1_8 Forward -366 -347 11.3625 0.282
NP_442575.1_8 Reverse -195 -214 -0.983855 0.232
NP_001035871.2_7 Forward -248 -238 13.5497 0.219
NP_441810.1_9 Forward -138 -119 7.47261 0.172
NP_440929.1_8 Forward -137 -128 5.40793 0.138
NP_440929.1_8 Reverse -299 -308 2.16301 0.262
NP_441751.2_8 Reverse -129 -143 -5.21195 0.199
NP_442554.1_8 Reverse -290 -300 6.17489 0.125
NP_441762.1_7 Reverse -313 -325 -5.86088 0.246
NP_442142.1_4 Reverse -119 -132 5.62358 0.187
NP_440895.1_6 Forward -368 -355 12.0157 0.202
NP_441448.1_1 Forward -226 -207 5.60432 0.261
NP_441468.1_1 Reverse -123 -130 3.97235 0.277
NP_440920.1_1 Forward -324 -305 7.57094 0.176
NP_441020.2_3 Reverse -296 -315 9.93088 0.297
NP_441015.1_10 Reverse -18 -37 -10.1286 0.283
NP_441015.1_10 Forward -328 -309 -11.3086 0.294
NP_441673.1_1 Reverse -128 -137 -7.86675 0.187
NP_441673.1_1 Forward -137 -128 -7.96508 0.206
NP_441826.1_2 Reverse -116 -130 -2.45868 0.271
NP_442719.1_2 Reverse -376 -394 -3.12816 0.199
NP_442808.1_1 Reverse -235 -245 10.501 0.0481
NP_442808.1_1 Forward -197 -187 1.06124 0.296
NP_442820.1_2 Reverse -190 -209 15.899 0.269
NP_441114.1_3 Reverse -384 -393 14.5527 0.193
NP_440558.1_2 Forward -146 -127 -4.6221 0.247
NP_442789.1_4 Forward -325 -306 -2.85214 0.242
NP_442593.1_6 Forward -263 -244 17.0428 0.279
NP_441878.1_6 Reverse -133 -143 0.766681 0.134
NP_441590.1_4 Reverse -310 -329 3.04693 0.29
NP_440101.1_3 Forward -328 -309 0.58944 0.297
NP_441574.1_1 Forward -143 -124 -1.47551 0.22
NP_441574.1_1 Forward -155 -136 -6.58872 0.277
NP_441549.1_9 Reverse -124 -142 -8.92897 0.238
NP_441633.1_3 Reverse -312 -325 2.87088 0.0834
NP_441633.1_3 Reverse -297 -310 -4.9956 0.22
NP_442961.1_7 Reverse -315 -334 10.4225 0.263
NP_442069.1_6 Forward -272 -253 8.35759 0.179
NP_442386.1_9 Reverse -298 -307 4.81753 0.282
NP_441750.1_1 Forward -307 -288 -9.53865 0.3
NP_441340.1_5 Forward -130 -123 4.07068 0.239
NP_442791.1_5 Forward -331 -312 -3.93378 0.262
NP_442240.1_2 Forward -220 -201 -15.2418 0.205
NP_440586.1_8 Forward -130 -123 12.8218 0.0395
NP_440439.1_1 Forward -301 -288 -1.25902 0.259
NP_442384.1_10 Reverse -353 -366 3.46087 0.19
NP_441877.1_7 Reverse -309 -328 1.47364 0.242
NP_442790.1_4 Reverse -172 -191 -10.1286 0.201
NP_442262.1_10 Forward -130 -123 10.3639 0.153
NP_440282.1_10 Reverse -124 -143 -1.96717 0.224
NP_442750.1_1 Reverse -6 -25 7.37347 0.261
NP_442750.1_3 Reverse -31 -50 -12.0953 0.272
NP_440298.1_2 Reverse -317 -336 12.5858 0.139
NP_441896.1_3 Reverse -290 -309 -2.85214 0.294
NP_440894.1_10 Reverse -294 -313 3.04771 0.279
NP_440937.1_5 Reverse -62 -81 8.65258 0.278
NP_440999.1_9 Reverse -313 -327 3.8345 0.122
NP_440888.1_2 Forward -323 -309 7.07881 0.208
NP_440179.1_6 Reverse -107 -126 4.22769 0.246
NP_442147.1_4 Reverse -288 -307 18.879 0.13
NP_442225.1_10 Forward -214 -195 5.60352 0.287
NP_439969.1_1 Reverse -319 -338 -7.37537 0.297
NP_442578.1_5 Forward -33 -14 2.45773 0.257
NP_441621.1_3 Forward -394 -376 16.9321 0.148
NP_443062.1_1 Reverse -122 -140 4.06059 0.276
NP_441560.1_8 Forward -142 -123 11.4153 0.299
NP_440504.1_7 Reverse -195 -214 0.491109 0.238
NP_442428.1_5 Reverse -123 -130 4.36568 0.271
NP_440673.1_3 Reverse -196 -203 8.59391 0.213
NP_441052.1_2 Forward -131 -121 4.40493 0.159
NP_441052.1_2 Forward -266 -256 1.35667 0.248
NP_442694.1_4 Forward -309 -300 10.9145 0.287
NP_443054.1_2 Reverse -297 -311 0.786239 0.254
NP_443054.1_2 Forward -360 -346 -0.295402 0.293
NP_441851.1_10 Forward -324 -314 4.3066 0.277
NP_441501.1_2 Reverse -321 -340 14.7491 0.263
NP_440588.1_3 Forward -393 -374 14.2574 0.237
NP_440954.1_1 Forward -326 -307 -4.6221 0.289
NP_442006.1_2 Forward -335 -318 -14.9075 0.211
NP_442243.1_1 Reverse -121 -139 -0.571569 0.252
NP_441570.1_1 Forward -131 -113 0.904127 0.0353
NP_441078.1_4 Forward -137 -128 -0.885252 0.209
NP_441078.1_4 Reverse -128 -137 -1.86856 0.272
NP_442443.1_1 Reverse -307 -326 1.37609 0.205
NP_442906.1_3 Reverse -317 -336 5.40766 0.2
NP_441732.1_2 Reverse -124 -140 -17.346 0.253
NP_440760.1_1 Forward -323 -304 -22.6167 0.263
NP_441328.2_8 Reverse -381 -400 19.5664 0.24
NP_442353.1_4 Reverse -122 -141 1.86696 0.24
NP_440913.1_1 Forward -133 -115 3.95239 0.285
NP_441659.2_8 Forward -203 -193 1.35667 0.242
NP_440363.1_9 Reverse -125 -143 12.6055 0.265
NP_439956.1_7 Forward -319 -300 2.45773 0.275
NP_442776.1_1 Forward -142 -123 9.24257 0.181
NP_442776.1_1 Forward -202 -183 5.50599 0.241
NP_442346.1_5 Reverse -133 -143 10.5014 0.0934
NP_442346.1_5 Forward -204 -194 7.84651 0.156
NP_440545.1_5 Forward -312 -295 4.6604 0.244
NP_441786.1_10 Reverse -374 -393 9.14423 0.233
NP_441585.1_5 Reverse -96 -115 0.490334 0.291
NP_442199.1_5 Forward -253 -234 -6.78538 0.281
NP_442199.1_7 Reverse -98 -117 -0.00131823 0.286
NP_440590.1_4 Forward -307 -294 -5.48725 0.28
NP_441239.1_9 Reverse -297 -309 6.03717 0.202
NP_441009.1_4 Reverse -257 -276 10.2259 0.276
NP_441892.1_1 Reverse -125 -142 1.90713 0.147
NP_442193.1_1 Forward -115 -97 17.1287 0.117
NP_442052.1_8 Forward -205 -195 11.9764 0.297
NP_440462.1_6 Forward -133 -123 4.69992 0.187
NP_440868.1_4 Reverse -118 -130 3.18557 0.14
NP_442499.1_3 Forward -210 -192 8.7706 0.279
NP_441811.1_8 Forward -329 -315 12.4876 0.207
NP_442053.1_1 Reverse -128 -137 4.22796 0.261
NP_442053.1_1 Reverse -122 -131 3.63797 0.298
NP_440520.1_1 Forward -393 -374 -4.32711 0.272
NP_440914.1_1 Reverse -383 -393 10.7621 0.122
NP_442470.1_3 Reverse -99 -118 13.6666 0.162
NP_442533.1_6 Forward -298 -289 8.65285 0.0727
NP_442533.1_6 Forward -143 -134 4.62128 0.179
NP_442533.1_6 Reverse -134 -143 4.22796 0.186
NP_442232.1_3 Reverse -126 -145 -8.94866 0.239
NP_441482.1_7 Reverse -231 -245 -6.58858 0.193
NP_439965.1_7 Reverse -370 -389 10.8063 0.294
NP_441961.1_4 Forward -316 -297 5.30933 0.27
NP_441602.1_3 Forward -328 -309 7.37428 0.12
NP_441972.1_5 Forward -325 -306 -9.24366 0.282
NP_442588.1_6 Forward -119 -100 7.57094 0.173
NP_440670.1_8 Forward -308 -299 3.24465 0.29
NP_440886.1_7 Reverse -322 -332 3.71617 0.267
NP_441463.1_3 Forward -153 -134 -4.42544 0.205
NP_441901.1_1 Forward -248 -229 10.8159 0.11
NP_441962.1_4 Reverse -129 -148 -10.4236 0.228
NP_441836.1_2 Reverse -377 -396 -4.91709 0.268
NP_442084.1_6 Forward -242 -224 5.42735 0.264
NP_442437.1_3 Reverse -316 -335 12.4867 0.17
NP_442698.1_10 Reverse -130 -149 1.0811 0.297
NP_441510.2_6 Reverse -304 -323 12.6833 0.268
NP_441272.1_7 Forward -245 -235 13.1564 0.271
NP_440632.1_2 Reverse -121 -140 7.96426 0.257
NP_439910.1_2 Forward -254 -237 -13.3342 0.162
NP_442509.1_9 Reverse -276 -286 7.25606 0.229
NP_442509.1_9 Reverse -299 -309 5.97777 0.298
NP_442936.1_10 Reverse -36 -50 10.3166 0.246
NP_442514.1_5 Reverse -223 -242 0.293673 0.178
NP_441440.1_8 Forward -311 -298 14.9656 0.299
NP_441885.1_5 Forward -137 -127 0.668351 0.133
NP_442341.1_7 Reverse -256 -270 5.1128 0.167
NP_442341.1_7 Reverse -313 -327 4.12949 0.2
NP_442341.1_9 Forward -133 -119 11.4053 0.127
NP_442513.1_5 Forward -313 -294 5.80018 0.287
NP_440679.1_10 Forward -330 -311 -5.50708 0.161
NP_442451.1_2 Reverse -291 -310 -9.047 0.258
NP_439962.1_4 Reverse -306 -325 10.3242 0.134
NP_442495.1_4 Forward -369 -359 13.0581 0.198
NP_440149.1_8 Forward -392 -373 1.47442 0.124
NP_441105.1_3 Forward -142 -123 -1.47551 0.15
NP_441105.1_3 Reverse -123 -142 -6.09707 0.229
NP_440172.1_1 Forward -298 -288 2.43831 0.279
NP_442015.1_10 Reverse -295 -308 0.314277 0.231
NP_442015.1_10 Reverse -130 -143 -1.06236 0.293
NP_440198.1_3 Forward -140 -121 13.2733 0.294
NP_441757.1_2 Forward -205 -187 9.0656 0.276
NP_440416.1_9 Forward -132 -113 -17.8968 0.248
NP_443052.1_10 Forward -148 -129 18.8974 0.219
NP_442154.1_1 Forward -325 -307 -6.37237 0.137
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTTTTGTGGACATTGCTAAAACGGGGCTTAATTCCCTGGAGTTCAGTGCCCGATTATTAGAATCCCACCAGGTGGCGGTGATTCCTGGAGCGGCGTTTGGAGCCGATGACTGTGTGCGTTTTTCCTACGCTACCGATATGGACACCATTAAACAGGGTTTGGCCGAGTTAGAGCGGTTTGTCAGCACTTTGGCTTGAGCAACCGTCCAACCCGTTGAGAGGAGTCAGTTTTACTCCCTGTAGGTAACGTTTAATTCGGTCATGGCTCACGCCATCGAGATGCTTGGCAAGGTTTGTTAGGGTGTAGTTAGTTGGACTGCTCAGTAAATACTGACAGTAATCTAAACGAGTGAAAAAAGTCATCCTACCACCTTAACCTCATCTATCTTGCGTAAGTCCT

CDS

GTGGGGGTTTTAATCGGGATTATGCGTGATATAGCAAAAGCTGGGGGTGAGGTTATATTTTTACCGTCATATTCACCGGACTTGAACAAAATTGAGAAGTTCTGGGCGAAACTAAAACGTTATGTTTCCCAACTTGTTAGTAATGGAGAATCGCTGATTTCTGGATTTGATGTAGCGTTGAGAAAATTGTCCTAA

Protein

MGVLIGIMRDIAKAGGEVIFLPSYSPDLNKIEKFWAKLKRYVSQLVSNGESLISGFDVALRKLS