Your browser is old and dusty. Try Google Chrome!

Details for ssl0707

ORF ssl0707
Accession NP_441855.2
Symbol glnB
Category Glutamate family / Nitrogen assimilation
Definition nitrogen regulatory protein P-II
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -122 -108 11.111 0.0538
NP_441061.1_2 Reverse -202 -216 5.70279 0.131
NP_441418.1_6 Reverse -349 -368 -19.4701 0.0888
NP_440897.1_6 Forward -188 -169 -1.08295 0.187
NP_440897.1_6 Reverse -114 -133 -1.67294 0.194
NP_441453.1_1 Forward -365 -347 4.83661 0.257
NP_441453.1_4 Forward -358 -350 14.8674 0.00947
NP_441453.1_4 Reverse -349 -357 6.80426 0.121
NP_441453.1_7 Forward -269 -262 11.9372 0.298
NP_441818.1_9 Reverse -349 -368 -2.95047 0.213
NP_440226.1_1 Forward -358 -339 16.0274 0.022
NP_442623.1_3 Forward -115 -96 -11.8986 0.263
NP_440931.1_9 Reverse -141 -160 10.9142 0.257
NP_440150.1_2 Forward -121 -102 12.29 0.193
NP_440996.1_3 Reverse -367 -385 11.7205 0.221
NP_442173.1_1 Reverse -350 -358 13.8841 0.0225
NP_442173.1_1 Forward -357 -349 12.0158 0.0316
NP_442173.1_3 Forward -268 -258 16.598 0.196
NP_442752.1_4 Reverse -349 -356 13.8055 0.0199
NP_441675.1_4 Forward -87 -68 2.65439 0.287
NP_440784.1_7 Reverse -350 -357 6.23397 0.241
NP_440784.1_7 Forward -357 -350 6.13563 0.241
NP_442000.2_2 Reverse -350 -369 19.764 0.0942
NP_440061.1_9 Forward -360 -346 6.19383 0.255
NP_442062.1_8 Reverse -349 -359 7.94484 0.0848
NP_442062.1_8 Forward -358 -348 5.09324 0.184
NP_441594.1_6 Reverse -105 -124 3.34271 0.231
NP_441594.1_6 Forward -126 -107 -0.295539 0.298
NP_440370.1_10 Forward -367 -348 12.1925 0.155
NP_441083.1_5 Forward -358 -348 9.81313 0.0224
NP_441083.1_5 Reverse -349 -359 6.96153 0.0717
NP_441738.1_2 Forward -356 -349 15.28 0.0102
NP_440209.1_1 Reverse -349 -357 8.57422 0.0425
NP_442570.1_3 Reverse -105 -124 -8.94866 0.294
NP_441716.1_2 Forward -97 -78 0.293125 0.264
NP_441716.1_2 Forward -96 -77 -1.62095 0.289
NP_442111.1_4 Reverse -348 -362 1.67122 0.296
NP_441163.1_4 Forward -133 -114 18.4388 0.154
NP_440906.1_5 Reverse -350 -357 6.23397 0.234
NP_440906.1_5 Forward -357 -350 6.13563 0.241
NP_442801.1_5 Reverse -121 -138 16.8527 0.116
NP_440747.1_10 Reverse -346 -358 7.02048 0.0108
NP_440747.1_10 Forward -361 -349 -11.7607 0.142
NP_441486.1_1 Reverse -104 -118 0.0979218 0.145
NP_441486.1_1 Reverse -346 -360 -4.62196 0.204
NP_442634.1_4 Reverse -347 -361 -1.37704 0.149
NP_442634.1_4 Forward -349 -335 -5.60527 0.264
NP_440057.1_5 Reverse -159 -178 11.995 0.297
NP_441014.1_5 Reverse -116 -134 14.1788 0.2
NP_441014.1_8 Forward -369 -350 -8.45701 0.283
NP_443018.1_3 Forward -357 -350 11.7405 0.0655
NP_443018.1_3 Reverse -115 -122 9.38056 0.128
NP_443018.1_3 Reverse -350 -357 5.44732 0.193
NP_441634.1_8 Forward -125 -111 4.62115 0.122
NP_440376.1_1 Reverse -349 -358 5.89959 0.116
NP_440376.1_1 Forward -123 -114 2.65466 0.216
NP_440376.1_1 Forward -358 -349 -0.0986038 0.285
NP_442687.1_7 Reverse -348 -358 5.68323 0.189
NP_441013.1_2 Forward -134 -116 -4.50408 0.299
NP_442658.1_1 Forward -118 -108 7.45273 0.214
NP_440141.1_8 Forward -132 -113 5.01433 0.278
NP_441855.2_4 Forward -366 -347 19.6458 0.022
NP_441855.2_7 Forward -61 -42 23.8939 0.0161
NP_441414.1_6 Reverse -228 -247 0.196116 0.227
NP_442937.1_5 Forward -128 -109 7.57094 0.248
NP_441958.1_5 Reverse -348 -358 8.73149 0.0255
NP_441958.1_5 Forward -359 -349 0.963343 0.12
NP_442376.1_2 Forward -363 -344 -13.2752 0.292
NP_441580.1_6 Forward -369 -350 -8.26035 0.254
NP_440827.1_3 Forward -134 -115 17.404 0.101
NP_441099.1_5 Forward -368 -349 2.45773 0.0561
NP_441646.1_1 Forward -117 -98 -0.39387 0.264
NP_441000.1_6 Forward -359 -345 -3.93365 0.225
NP_441110.1_2 Reverse -97 -116 17.6007 0.172
NP_440147.1_4 Reverse -347 -360 5.13249 0.136
NP_440147.1_4 Forward -125 -112 4.34585 0.164
NP_440147.1_4 Forward -360 -347 -0.275709 0.279
NP_441550.1_8 Reverse -347 -357 13.8442 0.0207
NP_441550.1_8 Forward -360 -350 9.616 0.0898
NP_441550.1_8 Forward -212 -202 5.97777 0.22
NP_441916.1_7 Reverse -349 -359 5.09324 0.146
NP_441916.1_7 Forward -358 -348 1.35667 0.286
NP_441041.1_4 Reverse -349 -368 -11.8986 0.254
NP_440569.1_10 Forward -84 -65 2.33913 0.293
NP_441725.1_5 Reverse -350 -360 2.24165 0.115
NP_439966.1_7 Reverse -347 -357 5.58445 0.216
NP_442941.1_3 Forward -357 -347 9.41981 0.0319
NP_442941.1_3 Reverse -350 -360 -0.904945 0.274
NP_442281.1_1 Forward -363 -349 11.2087 0.0497
NP_442281.1_1 Reverse -109 -123 9.24208 0.0726
NP_442281.1_1 Forward -121 -107 3.24392 0.238
NP_441079.1_7 Reverse -277 -296 -5.99948 0.269
NP_440437.1_1 Forward -364 -345 -1.7705 0.205
NP_441556.1_7 Reverse -254 -273 1.17865 0.287
NP_441644.1_6 Forward -358 -348 14.7292 0.0105
NP_441644.1_6 Reverse -114 -124 6.37109 0.161
NP_441071.1_3 Reverse -319 -338 9.14342 0.276
NP_442215.1_2 Reverse -105 -121 7.72835 0.0674
NP_442029.1_1 Reverse -112 -131 -13.6686 0.268
NP_442029.1_10 Reverse -106 -125 5.70265 0.284
NP_440929.1_8 Forward -358 -349 7.17789 0.0713
NP_442933.1_10 Forward -358 -349 8.06287 0.0885
NP_442933.1_10 Reverse -349 -358 7.96454 0.0937
NP_441751.2_8 Forward -357 -343 -4.62196 0.176
NP_442926.1_1 Forward -129 -110 -5.31042 0.278
NP_442554.1_8 Forward -122 -112 11.4848 0.0355
NP_442554.1_8 Forward -357 -347 6.37155 0.12
NP_442554.1_8 Reverse -350 -360 2.83163 0.253
NP_442554.1_8 Reverse -115 -125 2.14332 0.281
NP_441762.1_7 Forward -359 -347 -6.2542 0.284
NP_442142.1_4 Reverse -111 -124 6.41022 0.168
NP_442142.1_4 Reverse -258 -271 3.16532 0.265
NP_442292.1_1 Forward -357 -348 8.65285 0.0335
NP_440775.1_4 Forward -88 -69 11.5187 0.216
NP_440895.1_6 Reverse -343 -356 19.8821 0.0221
NP_441523.1_6 Forward -362 -343 6.39097 0.215
NP_443009.1_5 Reverse -348 -359 4.97473 0.222
NP_443009.1_5 Forward -26 -15 3.40144 0.296
NP_441715.1_4 Forward -357 -347 7.55152 0.108
NP_441715.1_9 Reverse -109 -123 17.2075 0.261
NP_440357.1_3 Reverse -199 -218 -0.885524 0.296
NP_440183.1_1 Reverse -350 -369 6.78429 0.275
NP_440379.1_5 Reverse -105 -124 -9.14533 0.259
NP_441468.1_1 Reverse -350 -357 6.13563 0.209
NP_441468.1_1 Forward -357 -350 6.0373 0.223
NP_441015.1_10 Reverse -109 -128 -8.65367 0.276
NP_441673.1_1 Forward -358 -349 1.27803 0.155
NP_441673.1_1 Reverse -349 -358 1.27803 0.155
NP_440286.1_2 Reverse -76 -89 17.3255 0.242
NP_441764.1_8 Forward -301 -291 11.5978 0.284
NP_442868.1_6 Reverse -347 -357 9.51814 0.0447
NP_441056.1_1 Reverse -349 -368 -0.590531 0.166
NP_441612.1_2 Forward -396 -386 11.7441 0.21
NP_442427.1_8 Reverse -134 -153 5.40766 0.266
NP_441911.1_7 Reverse -64 -83 -19.0774 0.275
NP_442808.1_1 Reverse -113 -123 7.25606 0.0831
NP_440145.1_3 Reverse -339 -358 -2.36049 0.168
NP_442542.1_2 Reverse -347 -360 6.50913 0.222
NP_442050.1_5 Forward -360 -350 12.7626 0.0516
NP_442342.1_4 Reverse -107 -126 14.7491 0.283
NP_440334.1_2 Forward -304 -291 13.884 0.287
NP_440385.1_8 Reverse -77 -96 11.1244 0.223
NP_440558.1_2 Forward -126 -107 -5.60541 0.262
NP_440558.1_2 Forward -367 -348 -6.39206 0.274
NP_441878.1_6 Forward -117 -107 0.963343 0.128
NP_441878.1_6 Forward -359 -349 0.668351 0.139
NP_441878.1_6 Forward -124 -114 0.668351 0.139
NP_441878.1_6 Reverse -113 -123 0.57002 0.14
NP_441557.1_5 Reverse -349 -358 8.94785 0.0289
NP_441557.1_5 Forward -358 -349 0.688044 0.128
NP_441445.1_1 Reverse -340 -359 4.12936 0.2
NP_441590.1_4 Forward -127 -108 6.09517 0.26
NP_441458.1_10 Reverse -105 -124 1.86774 0.279
NP_442347.1_2 Forward -357 -348 10.3245 0.058
NP_442508.1_8 Forward -288 -271 11.5436 0.256
NP_440151.1_5 Reverse -349 -368 3.04771 0.289
NP_442317.1_6 Forward -283 -264 5.80098 0.24
NP_441633.1_3 Forward -154 -141 -5.58558 0.236
NP_441633.1_3 Forward -125 -112 -5.78224 0.236
NP_441633.1_3 Reverse -347 -360 -6.76555 0.271
NP_442764.1_5 Forward -143 -124 7.7676 0.284
NP_440136.1_2 Reverse -350 -357 6.23397 0.171
NP_440136.1_2 Forward -357 -350 6.13563 0.193
NP_442998.1_5 Forward -243 -233 8.1415 0.271
NP_442998.1_10 Forward -356 -349 15.5754 0.0102
NP_440899.1_2 Forward -369 -350 8.94676 0.187
NP_440299.1_1 Forward -362 -349 6.0169 0.155
NP_442333.2_5 Forward -369 -350 -3.44213 0.214
NP_440256.1_1 Reverse -346 -365 1.17943 0.0775
NP_441090.1_6 Forward -270 -256 16.8142 0.111
NP_441559.1_8 Forward -128 -114 -6.68692 0.279
NP_441270.1_5 Reverse -114 -133 11.14 0.294
NP_441270.1_5 Forward -341 -322 10.9448 0.296
NP_440915.1_6 Forward -127 -113 1.67122 0.132
NP_440915.1_6 Reverse -345 -359 -0.590395 0.202
NP_440717.1_1 Reverse -108 -127 11.8975 0.199
NP_442866.1_1 Reverse -14 -33 -5.21209 0.24
NP_442993.1_1 Forward -123 -107 -12.2328 0.268
NP_442386.1_9 Reverse -113 -122 8.35743 0.201
NP_441291.1_2 Reverse -374 -393 7.57094 0.272
NP_441340.1_5 Reverse -350 -357 13.5105 0.0314
NP_441340.1_5 Forward -357 -350 5.84064 0.208
NP_441340.1_9 Forward -301 -291 7.966 0.256
NP_441340.1_9 Reverse -285 -295 7.29115 0.289
NP_440586.1_8 Forward -357 -350 9.47853 0.146
NP_440586.1_8 Reverse -350 -357 5.74197 0.283
NP_442959.1_5 Forward -328 -309 9.14423 0.224
NP_441262.1_3 Reverse -349 -356 14.7888 0.0223
NP_440027.1_3 Forward -368 -350 5.32826 0.245
NP_443051.1_1 Reverse -348 -357 7.47288 0.0571
NP_443051.1_1 Forward -359 -350 -1.08191 0.281
NP_439937.1_9 Forward -134 -117 -12.7448 0.276
NP_440439.1_1 Reverse -346 -359 9.55739 0.0454
NP_440372.1_2 Reverse -350 -357 13.8055 0.0214
NP_440372.1_2 Forward -357 -350 6.52896 0.188
NP_441803.1_2 Reverse -115 -134 4.916 0.171
NP_441803.1_2 Reverse -102 -121 -0.983855 0.293
NP_442384.1_10 Forward -358 -345 8.27909 0.0674
NP_442384.1_10 Reverse -114 -127 5.72248 0.121
NP_442384.1_10 Reverse -250 -263 1.9859 0.24
NP_441877.1_7 Forward -128 -109 -0.39464 0.284
NP_442262.1_10 Forward -357 -350 13.2155 0.0213
NP_442262.1_10 Reverse -115 -122 9.47889 0.187
NP_441689.1_5 Forward -360 -350 8.63269 0.132
NP_440163.1_10 Forward -120 -110 8.63316 0.266
NP_440344.1_10 Forward -365 -348 -9.59759 0.15
NP_440344.1_10 Reverse -107 -124 -10.1876 0.17
NP_440297.1_9 Reverse -350 -360 0.766681 0.282
NP_442280.1_10 Reverse -251 -269 4.87002 0.292
NP_442280.1_10 Forward -133 -115 4.77262 0.294
NP_440894.1_10 Forward -281 -262 4.42435 0.254
NP_440888.1_2 Forward -358 -344 9.6354 0.12
NP_440888.1_2 Forward -133 -119 6.68548 0.223
NP_440888.1_2 Reverse -114 -128 5.99717 0.254
NP_440888.1_4 Reverse -356 -370 16.1386 0.231
NP_442033.1_10 Forward -370 -351 -8.752 0.206
NP_441543.1_2 Forward -357 -348 7.07956 0.131
NP_441469.1_8 Forward -378 -369 8.94785 0.227
NP_443064.1_6 Forward -259 -249 10.5308 0.148
NP_443064.1_6 Reverse -349 -359 9.07643 0.247
NP_443064.1_6 Forward -210 -200 9.07643 0.247
NP_442578.1_7 Reverse -350 -357 6.0373 0.18
NP_440220.1_4 Reverse -330 -349 -2.06626 0.266
NP_441462.1_2 Reverse -349 -359 17.3846 0.00406
NP_442204.1_1 Reverse -345 -356 1.82863 0.266
NP_442204.1_5 Forward -126 -107 6.39097 0.144
NP_442204.1_5 Reverse -104 -123 3.44104 0.19
NP_442204.1_6 Forward -273 -254 4.42435 0.291
NP_441560.1_10 Forward -366 -347 11.5042 0.169
NP_440516.1_8 Reverse -349 -358 9.4395 0.0183
NP_440516.1_8 Forward -358 -349 5.11294 0.118
NP_442428.1_5 Reverse -350 -357 6.13563 0.209
NP_442428.1_5 Forward -357 -350 6.0373 0.212
NP_440673.1_3 Forward -356 -349 12.4288 0.0426
NP_441052.1_2 Forward -358 -348 1.65166 0.233
NP_442219.1_9 Forward -357 -348 7.96454 0.0696
NP_440436.1_4 Forward -357 -348 7.57079 0.124
NP_440436.1_4 Reverse -350 -359 5.11253 0.222
NP_441884.1_8 Reverse -348 -367 -12.0953 0.271
NP_441884.1_9 Reverse -249 -268 -22.3217 0.277
NP_441884.1_9 Reverse -198 -217 -26.7466 0.29
NP_441884.1_9 Reverse -108 -127 -28.4182 0.295
NP_442907.1_9 Forward -122 -103 -2.85214 0.257
NP_441719.1_4 Reverse -350 -357 6.82395 0.0855
NP_441719.1_4 Forward -357 -350 6.52896 0.188
NP_441733.1_10 Reverse -346 -359 5.32916 0.218
NP_441004.1_1 Reverse -108 -127 -16.0285 0.281
NP_441004.1_4 Forward -196 -186 7.94484 0.282
NP_442366.1_3 Forward -124 -106 6.50899 0.0776
NP_442694.1_4 Forward -165 -156 11.7011 0.277
NP_442206.1_10 Reverse -349 -364 1.06154 0.238
NP_443054.1_2 Forward -125 -111 2.06454 0.245
NP_441851.1_10 Reverse -348 -358 7.35486 0.142
NP_441851.1_10 Forward -117 -107 4.40493 0.271
NP_442515.1_1 Forward -37 -23 -3.63866 0.295
NP_440593.1_3 Forward -121 -102 -5.31042 0.259
NP_441982.1_6 Reverse -331 -340 10.862 0.291
NP_442689.1_8 Reverse -135 -152 -3.79607 0.252
NP_441409.1_6 Forward -364 -345 3.93269 0.0422
NP_440389.1_5 Forward -80 -61 11.8368 0.277
NP_442843.1_1 Reverse -115 -134 -3.44213 0.222
NP_442843.1_1 Reverse -350 -369 -5.21209 0.243
NP_442843.1_1 Reverse -125 -144 -11.7019 0.291
NP_440954.1_1 Reverse -349 -368 -5.80207 0.289
NP_441570.1_1 Reverse -349 -367 -14.5338 0.226
NP_441078.1_4 Reverse -349 -358 0.0980582 0.205
NP_441078.1_4 Forward -358 -349 0.0980582 0.205
NP_441078.1_4 Forward -123 -114 -1.6719 0.266
NP_441078.1_4 Reverse -114 -123 -1.77023 0.266
NP_440526.1_3 Forward -151 -140 6.74468 0.184
NP_441432.1_8 Reverse -348 -357 14.0611 0.0258
NP_441732.1_2 Forward -362 -346 -17.4444 0.258
NP_440760.1_1 Reverse -349 -368 -21.83 0.245
NP_441057.1_4 Reverse -348 -366 -4.20908 0.299
NP_440913.1_1 Reverse -347 -365 3.75572 0.29
NP_442400.1_10 Forward -42 -29 8.27408 0.279
NP_440713.1_4 Reverse -355 -374 5.30933 0.212
NP_440713.1_4 Forward -269 -250 4.12936 0.231
NP_440713.1_4 Forward -368 -349 3.73603 0.239
NP_442489.1_7 Forward -358 -349 0.786375 0.152
NP_442489.1_7 Reverse -349 -358 0.589713 0.17
NP_442489.1_7 Reverse -114 -123 -1.57357 0.213
NP_442489.1_7 Forward -123 -114 -1.6719 0.235
NP_442079.1_7 Reverse -350 -369 12.4875 0.084
NP_440559.1_1 Reverse -350 -359 14.651 0.0144
NP_440559.1_1 Forward -357 -348 7.76787 0.0918
NP_441659.2_8 Forward -358 -348 12.7631 0.0147
NP_441659.2_8 Reverse -349 -359 0.176696 0.271
NP_441022.1_1 Reverse -76 -85 15.0954 0.183
NP_441022.1_1 Reverse -288 -297 12.4095 0.232
NP_441022.1_1 Forward -86 -77 12.4095 0.232
NP_441022.1_1 Forward -87 -78 12.0258 0.255
NP_441040.1_2 Forward -131 -112 -15.4385 0.286
NP_442346.1_5 Reverse -348 -358 7.05986 0.183
NP_442346.1_5 Forward -359 -349 5.97822 0.219
NP_440545.1_3 Reverse -345 -362 -5.95935 0.265
NP_441744.1_5 Reverse -350 -369 12.0942 0.162
NP_442603.1_7 Reverse -349 -363 15.4369 0.0462
NP_441888.1_7 Reverse -161 -175 2.16287 0.225
NP_440449.1_6 Reverse -106 -124 10.1038 0.163
NP_439970.1_4 Reverse -235 -254 -4.6221 0.293
NP_441047.1_2 Reverse -109 -128 6.4893 0.193
NP_441833.1_4 Forward -357 -350 6.52896 0.0924
NP_441833.1_4 Reverse -350 -357 6.23397 0.163
NP_441329.1_3 Forward -94 -84 18.6666 0.171
NP_442162.1_9 Forward -357 -350 12.9205 0.0282
NP_442162.1_9 Reverse -350 -357 12.9205 0.0282
NP_440671.1_4 Forward -364 -350 13.9626 0.0723
NP_440671.1_4 Reverse -343 -357 5.80112 0.271
NP_442404.1_9 Forward -386 -372 8.94708 0.289
NP_442943.1_1 Forward -325 -310 2.81851 0.291
NP_442140.1_3 Forward -357 -347 8.23984 0.122
NP_442140.1_3 Reverse -115 -125 7.35486 0.142
NP_442140.1_3 Forward -122 -112 3.42162 0.297
NP_440875.1_9 Forward -356 -346 8.37203 0.233
NP_442547.1_2 Forward -212 -193 14.1591 0.156
NP_441813.1_5 Forward -360 -350 12.1731 0.0198
NP_441813.1_5 Reverse -347 -357 8.4365 0.0432
NP_441227.1_8 Reverse -36 -55 19.788 0.159
NP_442254.1_1 Forward -135 -116 -5.11376 0.282
NP_440590.1_4 Forward -122 -109 1.78924 0.111
NP_440590.1_4 Forward -357 -344 -4.7006 0.265
NP_442497.1_10 Reverse -350 -359 8.25953 0.047
NP_442497.1_10 Forward -357 -348 0.589713 0.153
NP_440821.1_4 Forward -360 -350 1.25834 0.139
NP_440821.1_4 Reverse -347 -357 -0.314959 0.251
NP_441239.1_9 Reverse -112 -124 17.4436 0.0146
NP_441239.1_9 Forward -360 -348 8.88877 0.12
NP_441239.1_9 Forward -125 -113 7.11881 0.169
NP_440624.1_5 Reverse -310 -328 6.60692 0.298
NP_441892.1_1 Forward -367 -350 -2.51776 0.223
NP_441892.1_1 Forward -125 -108 -6.05768 0.296
NP_440546.1_4 Reverse -349 -359 15.4756 0.0459
NP_440546.1_4 Forward -123 -113 10.6277 0.109
NP_440546.1_4 Forward -358 -348 8.20381 0.199
NP_440546.1_4 Reverse -114 -124 7.04032 0.264
NP_440462.1_6 Forward -360 -350 4.20827 0.213
NP_441184.1_3 Reverse -106 -125 5.89931 0.249
NP_442611.1_1 Reverse -109 -128 -0.295539 0.266
NP_440868.1_4 Reverse -345 -357 12.232 0.0245
NP_441474.1_1 Forward -368 -349 -3.24622 0.296
NP_442402.1_5 Reverse -157 -176 16.4207 0.169
NP_442923.1_4 Forward -129 -110 1.37609 0.179
NP_442039.1_4 Reverse -350 -357 11.6422 0.0747
NP_442380.1_10 Reverse -360 -378 8.27895 0.263
NP_442837.1_3 Forward -357 -350 6.0373 0.25
NP_442837.1_3 Reverse -350 -357 6.0373 0.25
NP_442053.1_1 Forward -358 -349 7.17789 0.104
NP_440505.1_3 Reverse -347 -357 16.7946 0.00614
NP_440505.1_3 Reverse -264 -274 7.05986 0.165
NP_440207.2_8 Reverse -102 -121 15.7324 0.263
NP_440207.2_9 Forward -237 -223 24.1883 0.0075
NP_440914.1_1 Forward -358 -348 14.373 0.0158
NP_441011.1_8 Reverse -350 -359 12.0944 0.0517
NP_441011.1_8 Reverse -251 -260 8.06287 0.16
NP_442533.1_6 Reverse -114 -123 13.5694 0.021
NP_442533.1_6 Forward -123 -114 6.78456 0.103
NP_442533.1_6 Reverse -349 -358 5.40793 0.14
NP_442533.1_6 Forward -358 -349 4.52295 0.179
NP_442232.1_3 Reverse -106 -125 -6.98204 0.194
NP_441482.1_7 Forward -364 -350 8.25939 0.0181
NP_439944.1_9 Reverse -350 -360 6.37155 0.184
NP_441028.1_6 Reverse -294 -304 14.0409 0.158
NP_440116.1_8 Reverse -350 -369 14.9458 0.0206
NP_440115.1_6 Reverse -346 -356 16.008 0.0325
NP_440007.1_9 Forward -120 -106 5.30946 0.26
NP_440007.1_9 Forward -362 -348 1.57289 0.285
NP_441602.1_3 Forward -128 -109 12.2908 0.102
NP_441972.1_5 Forward -388 -369 -9.83364 0.293
NP_441106.1_3 Reverse -85 -104 11.4058 0.217
NP_441825.1_4 Forward -166 -156 13.2547 0.249
NP_442249.1_8 Forward -126 -107 19.8257 0.116
NP_439903.1_6 Reverse -64 -83 -1.18128 0.293
NP_441286.1_1 Reverse -348 -360 5.25052 0.0259
NP_441286.1_1 Forward -153 -141 -1.73098 0.145
NP_442674.1_3 Forward -124 -105 9.7334 0.174
NP_440670.1_8 Reverse -349 -358 8.65285 0.0627
NP_440670.1_8 Forward -358 -349 6.29291 0.124
NP_440886.1_7 Reverse -113 -123 6.46942 0.123
NP_442614.1_2 Reverse -349 -363 9.43936 0.242
NP_441069.1_1 Reverse -359 -376 19.5084 0.0853
NP_441021.1_1 Reverse -102 -121 -9.44032 0.216
NP_440841.1_4 Forward -360 -341 -6.78538 0.215
NP_441626.1_2 Reverse -350 -357 12.2322 0.0511
NP_441626.1_2 Forward -357 -350 5.93897 0.231
NP_441401.1_2 Forward -391 -372 16.3224 0.144
NP_441962.1_4 Reverse -109 -128 -9.83364 0.222
NP_440855.1_5 Forward -125 -106 7.07848 0.285
NP_441836.1_2 Reverse -249 -268 -4.42544 0.255
NP_441993.1_1 Reverse -108 -127 5.26024 0.205
NP_442352.1_1 Reverse -108 -121 13.7085 0.285
NP_441510.2_6 Forward -368 -349 16.3215 0.132
NP_441272.1_4 Reverse -105 -124 6.68596 0.189
NP_440766.1_4 Reverse -345 -359 0.294584 0.291
NP_439988.1_3 Forward -127 -113 5.01447 0.292
NP_442930.1_1 Reverse -337 -347 13.4509 0.239
NP_442930.1_1 Forward -390 -380 10.1076 0.278
NP_442867.1_8 Forward -131 -112 13.4708 0.171
NP_440457.1_1 Reverse -345 -357 2.89058 0.205
NP_440457.1_1 Forward -362 -350 -1.23932 0.3
NP_440987.1_4 Forward -298 -279 5.211 0.22
NP_441984.1_3 Forward -127 -109 7.00065 0.259
NP_441489.1_3 Forward -94 -80 7.93745 0.244
NP_442936.1_10 Reverse -75 -89 8.30683 0.269
NP_440554.1_4 Forward -357 -347 5.97822 0.128
NP_441885.1_5 Reverse -349 -359 7.84651 0.0419
NP_441885.1_5 Forward -358 -348 1.35667 0.11
NP_442341.1_7 Forward -124 -110 8.65272 0.0858
NP_442341.1_7 Reverse -113 -127 2.2612 0.263
NP_442341.1_7 Reverse -348 -362 1.57289 0.286
NP_442341.1_9 Reverse -105 -119 4.62054 0.296
NP_442341.1_9 Reverse -347 -361 4.52221 0.299
NP_441173.1_9 Forward -94 -86 11.8187 0.222
NP_441173.1_9 Reverse -71 -79 10.9338 0.242
NP_441173.1_9 Forward -255 -247 9.75379 0.284
NP_443000.1_7 Reverse -347 -357 10.2065 0.0355
NP_443000.1_7 Forward -261 -251 4.69992 0.176
NP_443059.1_10 Forward -366 -347 1.6703 0.239
NP_440275.1_3 Reverse -347 -357 12.5664 0.0316
NP_441359.1_5 Forward -126 -107 6.88262 0.186
NP_440258.1_3 Reverse -77 -96 -3.24547 0.225
NP_439962.1_4 Forward -131 -112 -2.95047 0.242
NP_439962.1_4 Reverse -106 -125 -6.09707 0.28
NP_442495.1_5 Reverse -103 -122 7.17762 0.291
NP_440149.1_8 Reverse -349 -368 -2.45882 0.171
NP_441105.1_3 Reverse -103 -122 8.65258 0.0474
NP_441105.1_3 Forward -127 -108 -9.34199 0.288
NP_440216.1_1 Forward -358 -344 -4.62196 0.113
NP_440172.1_1 Reverse -349 -359 8.82982 0.0586
NP_440172.1_1 Forward -210 -200 3.22496 0.238
NP_440172.1_1 Forward -358 -348 2.33998 0.279
NP_441852.1_6 Reverse -112 -131 9.93088 0.267
NP_441852.1_7 Reverse -353 -372 17.2074 0.219
NP_442015.1_10 Forward -362 -349 10.2457 0.04
NP_442015.1_10 Reverse -103 -116 1.19926 0.21
NP_441045.1_6 Forward -35 -17 15.063 0.284
NP_441226.1_7 Reverse -350 -357 12.7234 0.0312
NP_441226.1_7 Forward -357 -350 11.5435 0.0757
NP_441111.1_7 Forward -357 -349 8.86921 0.0589
NP_441766.1_2 Reverse -349 -358 8.1612 0.0645
NP_441766.1_2 Forward -358 -349 5.89959 0.103
NP_440416.1_9 Reverse -342 -361 -20.2567 0.283
NP_442116.1_6 Forward -84 -67 12.8481 0.172
NP_441974.1_3 Forward -307 -290 18.9261 0.15
NP_440591.1_9 Reverse -107 -125 9.45892 0.151
NP_442226.1_1 Forward -266 -247 11.3075 0.281
NP_440261.1_5 Forward -357 -344 -4.9956 0.183
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCAGGACAAAAATAATTACCACTGAAGTGCCCCGCATCCAGACCGATCGCCAGGTAATATTTTTGGGTAGAGGTAAATTCTTGAGCATCTTAAGCATAGAGGAAAAGTTTTTCGATATTCCGGCTAGGACTCCCTGGTCAAGGGTTCACCAAATCCAGGGTAGATTCAAGCCTGTCAGTTAAACATAGTGCCGTTCACTCCTCTAGGGTAACGGATTCTTCGGACGAAAGAGCAGGGATTTTGTACTTGCAATTGTCACTAAAATGCCTCATCTCCGGCCATGGGCGCTGCCAAACGGTACTGATTTTTACAAAAAAACTTTTGGAGAACATGTTAAAAGTGTCTGGCTAGCCTTATAAATAAGACAACAACCAGATCATTGCACGAGGAGTACCAGGT

CDS

TTGAAAAAAGTAGAAGCGATTATTCGCCCCTTTAAACTAGACGAAGTCAAAATTGCGCTGGTTAATGCAGGGATCGTTGGTATGACGGTTTCTGAAGTTAGGGGCTTTGGCCGTCAAAAAGGTCAAACAGAGCGTTACCGTGGCTCTGAATACACTGTTGAGTTTCTCCAAAAACTCAAAATTGAGATTGTCGTCGACGAAGGACAGGTTGACATGGTTGTTGACAAGTTGGTATCGGCGGCCCGCACCGGGGAAATCGGTGACGGTAAAATCTTCATCAGCCCGGTGGATTCGGTGGTACGGATTCGGACAGGGGAAAAGGATACCGAAGCTATTTAA

Protein

MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKIEIVVDEGQVDMVVDKLVSAARTGEIGDGKIFISPVDSVVRIRTGEKDTEAI