Your browser is old and dusty. Try Google Chrome!

Details for ssl0563

ORF ssl0563
Accession NP_441966.1
Symbol psaC
Category Photosystem I
Definition photosystem I subunit VII
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -252 -266 13.4709 0.04
NP_441061.1_2 Forward -259 -245 -1.18038 0.252
NP_440557.1_1 Reverse -252 -271 -1.18052 0.27
NP_440795.1_7 Forward -259 -252 14.6904 0.0123
NP_440795.1_7 Reverse -252 -259 14.6904 0.0123
NP_442100.1_1 Reverse -283 -302 6.34979 0.288
NP_441418.1_6 Forward -260 -241 -21.9284 0.163
NP_441418.1_6 Reverse -251 -270 -29.6965 0.234
NP_442657.1_1 Reverse -47 -64 11.9886 0.245
NP_442291.1_5 Reverse -250 -266 6.05672 0.0727
NP_442291.1_5 Forward -261 -245 -4.07137 0.263
NP_442272.1_1 Forward -209 -191 15.5672 0.223
NP_441453.1_4 Reverse -251 -259 16.539 0.00633
NP_441453.1_4 Forward -260 -252 16.539 0.00633
NP_442151.1_6 Reverse -251 -265 21.4357 0.0045
NP_442151.1_6 Forward -395 -381 9.93102 0.137
NP_442151.1_6 Forward -260 -246 8.65272 0.167
NP_441818.1_1 Reverse -252 -263 16.0861 0.0221
NP_441630.1_3 Forward -268 -249 1.57275 0.242
NP_440120.1_4 Forward -385 -371 13.9626 0.29
NP_440996.1_2 Reverse -291 -300 15.241 0.248
NP_442744.1_8 Forward -267 -248 1.0811 0.217
NP_442173.1_1 Forward -259 -251 15.4574 0.00633
NP_442173.1_1 Reverse -252 -260 15.4574 0.00633
NP_442752.1_4 Forward -260 -253 13.8055 0.0199
NP_442752.1_4 Reverse -251 -258 13.8055 0.0199
NP_443027.1_4 Reverse -249 -259 13.943 0.0452
NP_443027.1_4 Forward -262 -252 13.1564 0.0521
NP_441812.1_3 Forward -261 -247 13.2743 0.167
NP_442975.1_10 Reverse -247 -261 12.0937 0.0477
NP_442975.1_10 Forward -264 -250 4.03056 0.249
NP_440784.1_7 Forward -259 -252 15.9687 0.0123
NP_440784.1_7 Reverse -252 -259 15.9687 0.0123
NP_442909.1_7 Forward -323 -309 5.70218 0.27
NP_440061.1_9 Forward -262 -248 5.89884 0.266
NP_440110.1_4 Forward -271 -252 8.65258 0.129
NP_441054.1_2 Forward -180 -161 10.4225 0.284
NP_441054.1_4 Reverse -241 -259 -4.11075 0.297
NP_442062.1_8 Forward -260 -250 19.4496 0.000558
NP_442062.1_8 Reverse -251 -261 17.3846 0.00193
NP_440304.1_4 Forward -262 -252 9.91146 0.051
NP_440304.1_4 Reverse -249 -259 9.91146 0.051
NP_442242.1_4 Forward -259 -252 14.3954 0.0124
NP_442242.1_4 Reverse -252 -259 14.3954 0.0124
NP_440044.1_8 Reverse -252 -271 5.60432 0.0999
NP_441581.1_9 Reverse -203 -222 9.7875 0.261
NP_441208.1_9 Forward -263 -249 13.5693 0.103
NP_441208.1_9 Reverse -335 -349 10.3243 0.19
NP_441594.1_6 Forward -269 -250 12.7825 0.109
NP_440370.1_10 Reverse -242 -261 7.47261 0.257
NP_442110.1_7 Reverse -251 -265 17.5025 0.0233
NP_442110.1_7 Forward -260 -246 0.196253 0.266
NP_440856.1_4 Reverse -15 -34 0.392778 0.167
NP_441083.1_5 Reverse -251 -261 20.3345 0.00053
NP_441083.1_5 Forward -260 -250 11.3864 0.0159
NP_441083.1_5 Forward -11 -1 -0.314959 0.265
NP_442827.1_8 Reverse -243 -262 13.3716 0.0402
NP_442827.1_8 Forward -268 -249 6.68515 0.103
NP_441434.1_7 Forward -258 -244 10.7177 0.158
NP_441738.1_2 Forward -258 -251 15.28 0.0102
NP_441738.1_2 Reverse -253 -260 15.28 0.0102
NP_441558.1_5 Forward -262 -243 22.6156 0.00172
NP_441558.1_5 Reverse -249 -268 15.1424 0.0438
NP_440209.1_1 Reverse -251 -259 18.1123 0.00295
NP_440209.1_1 Forward -260 -252 18.1123 0.00295
NP_442889.1_8 Reverse -248 -262 4.22722 0.27
NP_441770.1_4 Forward -115 -96 -6.1954 0.22
NP_440178.1_7 Forward -261 -242 -21.0434 0.207
NP_442461.1_2 Forward -192 -173 16.5191 0.216
NP_441716.1_1 Reverse -251 -265 3.8345 0.259
NP_441716.1_2 Reverse -339 -358 1.53728 0.251
NP_442111.1_4 Forward -261 -247 9.93102 0.0575
NP_441163.1_1 Reverse -250 -267 7.70792 0.238
NP_441163.1_1 Reverse -243 -260 7.51126 0.242
NP_440906.1_5 Forward -259 -252 15.8704 0.0124
NP_440906.1_5 Reverse -252 -259 15.8704 0.0124
NP_440906.1_5 Forward -400 -393 5.64398 0.292
NP_440747.1_10 Forward -263 -251 7.51213 0.00286
NP_440747.1_10 Reverse -248 -260 -2.02597 0.0196
NP_441130.1_10 Reverse -249 -263 18.9775 0.0122
NP_441130.1_10 Forward -262 -248 17.4042 0.0167
NP_441486.1_1 Reverse -248 -262 4.81781 0.0406
NP_441486.1_1 Forward -263 -249 4.62115 0.0425
NP_442145.1_4 Reverse -285 -304 7.01823 0.216
NP_442145.1_4 Reverse -113 -132 3.867 0.283
NP_442634.1_4 Forward -262 -248 -4.91696 0.223
NP_442634.1_4 Reverse -249 -263 -4.91696 0.223
NP_440470.1_5 Forward -301 -282 5.58586 0.294
NP_440403.1_4 Reverse -242 -261 -4.42544 0.212
NP_440403.1_10 Forward -269 -250 0.884433 0.293
NP_442848.1_1 Forward -266 -252 6.3911 0.0791
NP_442848.1_1 Reverse -245 -259 -1.8687 0.263
NP_442848.1_9 Forward -266 -247 2.55606 0.25
NP_443018.1_3 Forward -259 -252 14.8871 0.0123
NP_443018.1_3 Reverse -252 -259 14.8871 0.0123
NP_441634.1_8 Forward -262 -248 15.7325 0.0248
NP_441634.1_8 Reverse -246 -260 -4.03198 0.295
NP_441634.1_8 Reverse -249 -263 -4.22864 0.295
NP_440376.1_1 Forward -260 -251 19.4693 0.000692
NP_440376.1_1 Reverse -251 -260 19.4693 0.000692
NP_440376.1_1 Forward -394 -385 1.08137 0.258
NP_441588.1_4 Reverse -253 -263 8.63316 0.14
NP_442687.1_7 Reverse -250 -260 15.8113 0.0125
NP_442687.1_7 Forward -261 -251 8.92815 0.0994
NP_441077.1_6 Forward -309 -293 7.81502 0.224
NP_441077.1_6 Reverse -280 -296 4.92282 0.255
NP_442485.1_3 Forward -277 -258 -2.55715 0.262
NP_442958.1_3 Forward -271 -252 20.1573 0.0172
NP_442958.1_3 Reverse -240 -259 19.174 0.0172
NP_440642.1_10 Reverse -377 -391 6.19383 0.237
NP_441422.1_7 Reverse -249 -266 -2.3211 0.21
NP_441422.1_7 Forward -262 -245 -5.56602 0.247
NP_441763.1_10 Reverse -240 -259 9.04509 0.198
NP_442658.1_1 Reverse -249 -259 18.7607 0.00222
NP_442658.1_1 Forward -262 -252 9.616 0.147
NP_442205.1_9 Reverse -245 -261 3.69678 0.176
NP_440656.1_2 Reverse -292 -311 -0.295539 0.258
NP_441414.1_9 Forward -260 -241 -2.75381 0.122
NP_440720.1_1 Reverse -304 -323 11.6025 0.124
NP_440720.1_1 Forward -271 -252 2.16274 0.263
NP_439959.1_3 Forward -272 -253 11.0125 0.229
NP_442937.1_5 Forward -265 -246 8.06259 0.234
NP_441958.1_5 Forward -261 -251 12.2714 0.00183
NP_441958.1_5 Reverse -250 -260 12.2714 0.00183
NP_442836.1_5 Forward -266 -247 7.07928 0.171
NP_442816.1_7 Forward -221 -202 6.06331 0.242
NP_439905.1_1 Forward -259 -246 21.2588 0.00648
NP_440984.1_7 Reverse -246 -260 22.6157 0.000733
NP_440984.1_7 Forward -265 -251 10.3243 0.126
NP_439990.1_5 Forward -265 -252 11.7207 0.128
NP_442690.1_1 Forward -302 -283 4.71934 0.0763
NP_442911.1_2 Forward -270 -251 -0.885524 0.0793
NP_442911.1_2 Reverse -241 -260 -4.81876 0.142
NP_440153.1_5 Forward -259 -245 14.2576 0.0551
NP_440153.1_5 Reverse -252 -266 11.2093 0.0763
NP_441591.1_10 Forward -262 -243 10.0292 0.196
NP_442536.1_4 Reverse -64 -82 22.6353 0.0212
NP_442536.1_4 Forward -82 -64 10.4422 0.237
NP_440993.1_2 Forward -265 -249 14.5132 0.0631
NP_440993.1_2 Reverse -246 -262 3.30346 0.259
NP_441099.1_5 Forward -270 -251 -2.26216 0.12
NP_442002.1_9 Reverse -250 -257 10.7572 0.185
NP_441294.1_7 Reverse -247 -261 10.5945 0.181
NP_441646.1_1 Reverse -244 -263 5.11266 0.184
NP_441646.1_1 Forward -267 -248 -0.688862 0.271
NP_442438.1_10 Forward -265 -251 15.7325 0.0253
NP_442438.1_10 Reverse -246 -260 12.9793 0.0368
NP_440879.1_6 Reverse -246 -265 5.211 0.167
NP_442885.1_5 Reverse -253 -272 14.0599 0.276
NP_441000.1_6 Forward -261 -247 -4.13031 0.227
NP_441000.1_6 Reverse -250 -264 -4.91696 0.254
NP_442771.1_1 Reverse -249 -267 -6.27403 0.168
NP_440147.1_4 Reverse -249 -262 12.8023 0.0326
NP_440147.1_4 Forward -262 -249 10.2457 0.0355
NP_441550.1_8 Forward -262 -252 16.7941 0.00906
NP_441550.1_8 Reverse -249 -259 10.501 0.066
NP_441916.1_7 Forward -260 -250 18.4663 0.00144
NP_441916.1_7 Reverse -251 -261 10.3048 0.0261
NP_441916.1_10 Forward -268 -249 8.75091 0.165
NP_441041.1_4 Forward -266 -247 -12.5869 0.269
NP_441041.1_7 Forward -263 -251 12.4708 0.0611
NP_441041.1_7 Reverse -248 -260 10.2357 0.1
NP_442396.1_5 Forward -35 -22 8.67241 0.151
NP_441725.1_5 Forward -259 -249 9.02648 0.0553
NP_441725.1_5 Reverse -252 -262 9.02648 0.0553
NP_439966.1_7 Reverse -249 -259 17.4824 0.00636
NP_439966.1_7 Forward -262 -252 14.8275 0.0177
NP_439966.1_9 Reverse -249 -258 10.7178 0.0863
NP_439966.1_9 Forward -262 -253 0.884706 0.253
NP_442941.1_3 Reverse -252 -262 10.9931 0.0116
NP_442941.1_3 Forward -259 -249 2.53664 0.14
NP_440289.1_2 Reverse -248 -261 10.2457 0.0272
NP_440289.1_2 Forward -263 -250 4.93583 0.0636
NP_442281.1_1 Forward -265 -251 14.8469 0.0155
NP_442281.1_1 Reverse -246 -260 8.55376 0.0798
NP_441334.1_7 Reverse -249 -268 -20.8467 0.281
NP_440437.1_1 Forward -266 -247 7.7676 0.0622
NP_442012.1_1 Reverse -245 -264 3.6377 0.179
NP_441457.1_7 Reverse -249 -268 -0.787193 0.293
NP_441556.1_10 Reverse -246 -260 15.2833 0.145
NP_440498.1_1 Reverse -242 -260 10.3439 0.0786
NP_441644.1_6 Reverse -251 -261 17.3841 0.00127
NP_441644.1_6 Forward -260 -250 10.1076 0.0628
NP_441644.1_6 Forward -11 -1 3.51951 0.277
NP_442215.1_2 Reverse -249 -265 14.6115 0.0197
NP_442215.1_2 Forward -238 -222 -3.38305 0.214
NP_442215.1_2 Forward -262 -246 -5.15301 0.246
NP_440253.1_2 Reverse -251 -269 5.23069 0.0955
NP_440253.1_2 Forward -260 -242 -2.93078 0.28
NP_440929.1_8 Forward -260 -251 19.2726 0.000701
NP_440929.1_8 Reverse -251 -260 19.2726 0.000701
NP_442933.1_1 Forward -220 -201 7.20922 0.253
NP_442933.1_10 Forward -260 -251 17.601 0.00325
NP_442933.1_10 Reverse -251 -260 17.601 0.00325
NP_440382.1_2 Reverse -40 -59 5.99684 0.264
NP_441751.2_8 Reverse -252 -266 5.30946 0.0448
NP_442554.1_4 Forward -87 -68 6.68596 0.291
NP_442554.1_8 Reverse -252 -262 18.0729 0.00543
NP_442554.1_8 Forward -259 -249 16.008 0.0065
NP_441762.1_7 Forward -261 -249 12.4287 0.0142
NP_441762.1_7 Reverse -250 -262 11.8387 0.0142
NP_442142.1_4 Forward -263 -250 14.7683 0.0302
NP_442142.1_4 Reverse -248 -261 6.0169 0.175
NP_442292.1_1 Reverse -252 -261 18.486 0.00229
NP_442292.1_1 Forward -259 -250 9.63616 0.0183
NP_442292.1_5 Reverse -247 -266 3.53937 0.257
NP_442476.1_1 Reverse -280 -299 12.7478 0.225
NP_442476.1_6 Forward -259 -245 23.2057 0.00688
NP_441711.1_4 Forward -269 -250 3.6377 0.238
NP_443009.1_5 Forward -261 -250 18.3477 0.00265
NP_441865.1_3 Forward -342 -324 14.5721 0.235
NP_441715.1_4 Forward -259 -249 9.32148 0.097
NP_441715.1_4 Reverse -252 -262 7.84651 0.107
NP_441198.1_5 Reverse -253 -266 17.1282 0.206
NP_440379.1_5 Reverse -254 -273 -11.2103 0.291
NP_440464.1_9 Reverse -1 -20 19.0757 0.0641
NP_441468.1_1 Forward -259 -252 15.8704 0.0124
NP_441468.1_1 Reverse -252 -259 15.8704 0.0124
NP_441020.2_6 Forward -262 -245 7.90532 0.215
NP_441015.1_10 Reverse -246 -265 -4.13045 0.199
NP_441015.1_10 Forward -265 -246 -4.32711 0.202
NP_441673.1_1 Forward -260 -251 20.8459 0.000698
NP_441673.1_1 Reverse -251 -260 20.8459 0.000698
NP_441731.1_3 Forward -332 -313 0.392778 0.243
NP_441826.1_2 Forward -266 -252 25.369 0.000802
NP_441826.1_2 Reverse -245 -259 10.4227 0.0475
NP_441637.1_9 Forward -117 -99 -0.275845 0.292
NP_442490.1_9 Forward -272 -253 1.86774 0.165
NP_441764.1_8 Forward -311 -301 12.1721 0.284
NP_442868.1_6 Forward -262 -252 17.4829 0.012
NP_442868.1_6 Reverse -249 -259 8.53483 0.0555
NP_442719.1_2 Reverse -365 -383 -9.12632 0.259
NP_441612.1_2 Reverse -251 -261 8.54929 0.21
NP_442808.1_1 Reverse -250 -260 18.4657 0.00201
NP_442808.1_1 Forward -261 -251 8.63269 0.0481
NP_441101.1_4 Forward -302 -283 7.47261 0.254
NP_442820.1_10 Forward -266 -248 12.8022 0.152
NP_442542.1_2 Reverse -249 -262 11.819 0.114
NP_442542.1_2 Forward -268 -255 5.32916 0.272
NP_442542.1_9 Reverse -244 -258 9.93039 0.125
NP_442542.1_9 Forward -267 -253 8.25877 0.166
NP_442542.1_10 Forward -259 -245 20.0591 0.153
NP_442050.1_5 Forward -262 -252 15.6142 0.01
NP_442050.1_5 Reverse -249 -259 8.23937 0.234
NP_442342.1_9 Reverse -249 -265 2.51681 0.286
NP_441878.1_6 Forward -261 -251 10.4031 0.0176
NP_441878.1_6 Reverse -250 -260 10.4031 0.0176
NP_441036.1_8 Reverse -250 -260 17.7779 0.000554
NP_441036.1_8 Forward -261 -251 8.33817 0.174
NP_441557.1_5 Forward -260 -251 19.9609 0.000699
NP_441557.1_5 Reverse -251 -260 19.9609 0.000699
NP_442066.2_4 Reverse -251 -270 -6.1954 0.247
NP_442066.2_9 Reverse -247 -260 10.934 0.154
NP_442066.2_9 Forward -264 -251 8.08242 0.193
NP_442419.1_2 Forward -265 -246 -5.21209 0.295
NP_441308.1_8 Reverse -249 -259 9.22315 0.226
NP_440101.1_3 Reverse -246 -265 16.8141 0.0483
NP_442183.1_1 Forward -260 -246 10.816 0.0784
NP_442183.1_1 Reverse -251 -265 8.55439 0.113
NP_440676.1_3 Forward -182 -163 9.83255 0.252
NP_442397.1_9 Reverse -251 -270 6.78429 0.246
NP_440356.1_2 Reverse -307 -326 1.37609 0.263
NP_440086.1_2 Forward -237 -218 7.86512 0.29
NP_441549.1_9 Reverse -247 -265 -7.06068 0.206
NP_441549.1_9 Forward -264 -246 -9.61729 0.256
NP_442347.1_2 Reverse -252 -261 12.4878 0.056
NP_442347.1_2 Forward -259 -250 11.1111 0.056
NP_441037.1_4 Reverse -249 -259 16.2838 0.0168
NP_441037.1_4 Forward -262 -252 9.55921 0.21
NP_441633.1_3 Forward -262 -249 11.1307 0.0286
NP_441633.1_3 Reverse -249 -262 6.01747 0.0481
NP_440136.1_2 Forward -259 -252 15.9687 0.0123
NP_440136.1_2 Reverse -252 -259 15.9687 0.0123
NP_442590.1_10 Reverse -245 -264 14.1591 0.125
NP_442998.1_10 Forward -258 -251 15.5754 0.0102
NP_442998.1_10 Reverse -253 -260 15.5754 0.0102
NP_440731.1_2 Forward -272 -253 4.916 0.293
NP_440299.1_1 Forward -264 -251 13.5883 0.0298
NP_440299.1_1 Reverse -247 -260 7.59019 0.109
NP_441799.1_1 Reverse -247 -261 15.0436 0.0206
NP_441799.1_1 Forward -264 -250 6.29216 0.176
NP_441007.1_10 Reverse -246 -259 11.7207 0.0599
NP_441007.1_10 Forward -265 -252 10.4424 0.0656
NP_442334.1_2 Forward -270 -253 -13.0392 0.297
NP_442201.1_10 Forward -271 -252 -12.4886 0.268
NP_440256.1_1 Forward -263 -244 -5.99873 0.198
NP_441559.1_8 Forward -337 -323 -5.90027 0.271
NP_441559.1_8 Reverse -246 -260 -7.08024 0.283
NP_440915.1_6 Forward -264 -250 14.0609 0.0187
NP_440915.1_6 Reverse -247 -261 -2.16369 0.26
NP_441866.1_4 Forward -45 -32 13.5367 0.273
NP_442866.1_1 Reverse -246 -265 5.99764 0.122
NP_442866.1_1 Forward -177 -158 -8.85033 0.285
NP_440306.1_5 Reverse -201 -220 -1.96717 0.298
NP_441939.1_3 Reverse -252 -271 14.5524 0.0756
NP_441939.1_3 Forward -259 -240 14.0608 0.0807
NP_441494.1_6 Reverse -246 -259 7.98409 0.242
NP_442993.1_1 Reverse -251 -267 -6.62797 0.146
NP_442993.1_1 Forward -260 -244 -9.18458 0.179
NP_442386.1_9 Reverse -250 -259 15.7322 0.0144
NP_442386.1_9 Forward -261 -252 13.8639 0.0289
NP_441340.1_5 Forward -259 -252 15.6737 0.0124
NP_441340.1_5 Reverse -252 -259 15.6737 0.0124
NP_441340.1_9 Reverse -289 -299 17.7031 0.194
NP_441340.1_9 Reverse -279 -289 14.8109 0.194
NP_441506.1_1 Reverse -283 -302 13.537 0.23
NP_442240.1_1 Forward -268 -249 5.30853 0.264
NP_442240.1_2 Forward -259 -240 -6.88371 0.122
NP_440586.1_2 Forward -400 -381 15.7324 0.182
NP_440586.1_8 Forward -259 -252 13.2151 0.026
NP_440586.1_8 Reverse -252 -259 13.2151 0.026
NP_442251.1_6 Forward -259 -252 15.2804 0.0124
NP_442251.1_6 Reverse -252 -259 15.2804 0.0124
NP_441262.1_3 Reverse -251 -258 14.7888 0.0223
NP_441262.1_3 Forward -260 -253 14.7888 0.0223
NP_440027.1_3 Forward -267 -249 2.18168 0.292
NP_440027.1_8 Reverse -254 -273 3.9319 0.294
NP_443051.1_1 Reverse -250 -259 10.4228 0.00754
NP_443051.1_1 Forward -261 -252 10.4228 0.00754
NP_439937.1_9 Forward -261 -244 -15.8914 0.287
NP_441595.1_5 Forward -267 -249 9.26226 0.217
NP_441167.1_1 Forward -134 -115 7.66927 0.22
NP_440408.1_7 Forward -322 -303 10.3242 0.247
NP_440439.1_1 Reverse -248 -261 11.9173 0.0288
NP_440439.1_1 Forward -263 -250 1.39592 0.156
NP_440372.1_2 Forward -259 -252 16.3621 0.0124
NP_440372.1_2 Reverse -252 -259 16.3621 0.0124
NP_440574.1_3 Reverse -246 -265 2.0644 0.173
NP_440819.1_5 Reverse -320 -328 15.8507 0.185
NP_440819.1_5 Reverse -98 -106 7.68924 0.266
NP_440316.1_10 Forward -267 -257 6.27322 0.264
NP_441803.1_2 Reverse -246 -265 13.9625 0.0463
NP_441803.1_2 Forward -265 -246 4.42435 0.178
NP_439977.1_5 Reverse -245 -264 5.80098 0.144
NP_441572.1_7 Forward -266 -247 1.37609 0.151
NP_442384.1_10 Forward -260 -247 9.36073 0.054
NP_442384.1_10 Reverse -251 -264 3.95252 0.172
NP_442114.1_4 Forward -260 -249 12.1534 0.107
NP_440699.1_3 Forward -138 -121 13.6085 0.216
NP_442235.1_3 Forward -264 -245 11.7992 0.0924
NP_441018.1_7 Forward -176 -157 9.73422 0.218
NP_442262.1_10 Forward -259 -252 14.1988 0.0123
NP_442262.1_10 Reverse -252 -259 14.1988 0.0123
NP_441689.1_5 Forward -262 -252 5.87944 0.197
NP_442244.1_3 Reverse -254 -273 4.03102 0.265
NP_440344.1_10 Forward -267 -250 -8.0243 0.121
NP_441060.1_4 Reverse -209 -227 5.62401 0.242
NP_440562.1_3 Reverse -252 -269 25.5066 0.00562
NP_440562.1_3 Forward -259 -242 10.1669 0.15
NP_441965.1_3 Forward -270 -251 5.01433 0.159
NP_441965.1_10 Forward -263 -247 7.63002 0.144
NP_440297.1_9 Forward -259 -249 -0.216628 0.282
NP_440297.1_9 Reverse -252 -262 -0.216628 0.282
NP_441592.1_4 Reverse -251 -270 -2.16383 0.261
NP_441896.1_3 Reverse -242 -261 10.8159 0.0833
NP_441896.1_3 Forward -269 -250 -0.4922 0.241
NP_440894.1_10 Reverse -246 -265 17.7974 0.0562
NP_440999.1_9 Reverse -247 -261 18.6825 0.0156
NP_440999.1_9 Forward -264 -250 4.81781 0.115
NP_440999.1_9 Forward -261 -247 -1.18038 0.229
NP_440888.1_2 Reverse -251 -265 21.8284 0.000484
NP_440888.1_2 Forward -260 -246 17.0102 0.00497
NP_440888.1_2 Reverse -22 -36 6.29216 0.241
NP_440491.1_1 Reverse -248 -267 19.9763 0.0243
NP_442033.1_10 Reverse -249 -268 -3.73712 0.171
NP_442033.1_10 Forward -262 -243 -12.3902 0.269
NP_441543.1_2 Forward -259 -250 18.486 0.00236
NP_441543.1_2 Reverse -252 -261 16.9127 0.00359
NP_441543.1_2 Reverse -108 -117 4.52295 0.234
NP_442845.1_2 Forward -266 -252 14.5526 0.0796
NP_441551.1_5 Reverse -247 -263 8.02265 0.241
NP_441469.1_8 Reverse -250 -259 16.126 0.00797
NP_441469.1_8 Forward -261 -252 6.48957 0.227
NP_441469.1_8 Reverse -308 -317 5.11294 0.289
NP_443064.1_6 Reverse -251 -261 12.5669 0.0796
NP_442337.1_8 Reverse -378 -397 2.16274 0.218
NP_442337.1_8 Forward -218 -199 -1.27885 0.28
NP_442578.1_7 Forward -259 -252 14.5921 0.026
NP_442578.1_7 Reverse -252 -259 14.5921 0.026
NP_440148.1_1 Reverse -282 -301 -2.75381 0.219
NP_441462.1_2 Forward -260 -250 11.5831 0.00406
NP_441462.1_2 Reverse -251 -261 11.5831 0.00406
NP_441462.1_2 Reverse -2 -12 -1.10161 0.281
NP_441621.1_7 Reverse -249 -263 6.48943 0.068
NP_441621.1_7 Forward -262 -248 6.3911 0.068
NP_440889.1_2 Reverse -309 -328 14.7491 0.124
NP_442204.1_5 Reverse -241 -260 16.4207 0.0377
NP_442204.1_5 Forward -270 -251 7.27595 0.132
NP_441351.1_8 Reverse -249 -268 7.37428 0.192
NP_442780.1_1 Reverse -288 -307 12.7825 0.149
NP_440516.1_8 Forward -260 -251 16.9127 0.00442
NP_440516.1_8 Reverse -251 -260 16.9127 0.00442
NP_440516.1_8 Forward -11 -2 3.83464 0.124
NP_442080.1_7 Reverse -381 -400 0.58944 0.229
NP_442428.1_4 Reverse -250 -269 12.5858 0.131
NP_442428.1_5 Forward -259 -252 15.8704 0.0124
NP_442428.1_5 Reverse -252 -259 15.8704 0.0124
NP_440778.1_1 Reverse -277 -296 16.1886 0.215
NP_440673.1_3 Forward -258 -251 12.4288 0.0426
NP_440673.1_3 Reverse -253 -260 12.4288 0.0426
NP_440673.1_7 Forward -271 -252 3.14605 0.215
NP_441052.1_2 Reverse -251 -261 19.9412 0.00106
NP_441052.1_2 Forward -260 -250 10.5014 0.0285
NP_442219.1_8 Reverse -247 -266 19.4732 0.0434
NP_442219.1_9 Reverse -252 -261 17.7976 0.00718
NP_442219.1_9 Forward -259 -250 8.35786 0.0681
NP_440436.1_4 Forward -259 -250 18.1905 0.00233
NP_440436.1_4 Reverse -252 -261 17.2072 0.00233
NP_441884.1_9 Reverse -248 -267 -3.73712 0.0594
NP_441884.1_9 Forward -263 -244 -4.42544 0.0594
NP_440222.1_6 Forward -36 -23 16.5389 0.176
NP_440314.1_9 Reverse -252 -271 -8.16202 0.245
NP_441719.1_4 Forward -259 -252 16.3621 0.0124
NP_441719.1_4 Reverse -252 -259 16.3621 0.0124
NP_441733.1_10 Forward -263 -250 19.6855 0.0151
NP_441004.1_1 Forward -266 -247 -11.5053 0.24
NP_442366.1_3 Reverse -250 -268 4.9357 0.0899
NP_439949.1_10 Forward -304 -285 16.6708 0.178
NP_442873.1_2 Forward -264 -245 14.7483 0.193
NP_441115.1_4 Reverse -250 -268 19.6845 0.00795
NP_441115.1_4 Forward -261 -243 10.3431 0.181
NP_440328.1_4 Forward -266 -247 8.94757 0.106
NP_443054.1_2 Reverse -249 -263 3.44117 0.24
NP_443054.1_2 Forward -262 -248 3.04785 0.24
NP_442430.1_6 Reverse -277 -296 12.1925 0.271
NP_441966.1_1 Forward -82 -63 22.9106 0.022
NP_441966.1_2 Forward -130 -111 28.1457 0.000398
NP_441851.1_10 Reverse -250 -260 16.008 0.00552
NP_441851.1_10 Forward -261 -251 15.8113 0.00552
NP_442011.1_1 Forward -261 -242 -0.885524 0.268
NP_442515.1_1 Forward -261 -247 13.6676 0.0278
NP_442515.1_1 Reverse -250 -264 -4.4253 0.298
NP_440593.1_3 Forward -265 -246 6.58763 0.112
NP_440338.1_4 Reverse -111 -130 4.91521 0.298
NP_442689.1_8 Forward -298 -281 -3.79607 0.252
NP_442689.1_8 Forward -195 -178 -5.95935 0.279
NP_441349.1_10 Forward -270 -251 0.58944 0.0878
NP_440389.1_5 Reverse -244 -263 19.3566 0.104
NP_439960.1_10 Forward -267 -249 -2.73412 0.258
NP_440474.1_1 Reverse -69 -88 18.9765 0.0984
NP_440474.1_8 Forward -259 -245 7.47213 0.204
NP_440396.1_10 Forward -259 -243 9.4976 0.28
NP_441477.1_10 Forward -267 -249 7.78729 0.181
NP_441124.1_5 Reverse -289 -299 10.8118 0.283
NP_441124.1_5 Forward -129 -119 10.5254 0.286
NP_442450.1_3 Reverse -272 -290 5.03327 0.286
NP_440588.1_2 Forward -269 -250 -0.197208 0.15
NP_441031.1_1 Reverse -282 -301 3.83414 0.293
NP_441078.1_4 Forward -260 -251 19.6659 0.0007
NP_441078.1_4 Reverse -251 -260 19.6659 0.0007
NP_441078.1_4 Reverse -2 -11 -1.37691 0.254
NP_442729.1_8 Reverse -247 -260 9.75405 0.125
NP_442729.1_8 Forward -264 -251 8.77074 0.125
NP_442348.1_2 Forward -333 -324 7.47288 0.28
NP_440526.1_3 Reverse -252 -263 20.0193 0.0113
NP_440526.1_3 Forward -259 -248 2.41814 0.267
NP_441432.1_8 Forward -261 -252 16.8143 0.00595
NP_441432.1_8 Reverse -250 -259 8.25953 0.0755
NP_441432.1_8 Reverse -1 -10 3.04799 0.268
NP_441432.1_9 Forward -114 -101 13.6401 0.165
NP_441432.1_9 Forward -296 -283 11.8949 0.221
NP_442320.1_8 Forward -266 -252 13.5693 0.0144
NP_442320.1_8 Reverse -245 -259 -2.45868 0.0894
NP_442344.1_7 Forward -259 -240 -6.88371 0.172
NP_441732.1_2 Forward -264 -248 -5.15301 0.0476
NP_441732.1_2 Reverse -247 -263 -6.62797 0.0495
NP_440629.1_4 Forward -69 -50 11.2092 0.225
NP_440629.1_4 Reverse -269 -288 8.35759 0.271
NP_442797.1_7 Reverse -250 -268 6.11567 0.21
NP_440199.1_10 Forward -263 -253 7.35486 0.231
NP_441057.1_4 Forward -111 -93 -3.81576 0.299
NP_439935.1_10 Reverse -230 -244 17.4866 0.276
NP_442400.1_1 Reverse -248 -267 -5.9004 0.299
NP_442400.1_10 Forward -75 -62 12.0938 0.221
NP_442489.1_7 Forward -260 -251 20.1576 0.000695
NP_442489.1_7 Reverse -251 -260 20.1576 0.000695
NP_440559.1_1 Reverse -252 -261 17.4043 0.00658
NP_440559.1_1 Forward -259 -250 8.75118 0.0586
NP_441659.2_8 Reverse -251 -261 18.1713 0.00133
NP_441659.2_8 Forward -260 -250 11.9764 0.0147
NP_441659.2_8 Forward -11 -1 1.94665 0.22
NP_442913.1_10 Reverse -242 -261 1.86774 0.133
NP_442913.1_10 Forward -269 -250 -5.70374 0.276
NP_441968.1_1 Reverse -159 -167 15.162 0.257
NP_440708.1_6 Reverse -375 -394 -3.54046 0.223
NP_440335.1_9 Reverse -280 -298 11.4255 0.276
NP_440315.1_7 Reverse -284 -303 19.1627 0.146
NP_441185.1_6 Forward -200 -181 2.16274 0.208
NP_442346.1_5 Forward -261 -251 16.6963 0.00248
NP_442346.1_5 Reverse -250 -260 9.02648 0.118
NP_440545.1_3 Forward -264 -247 15.2801 0.0134
NP_440545.1_3 Reverse -247 -264 -5.36936 0.247
NP_440831.1_3 Reverse -248 -267 5.02806 0.29
NP_441126.1_6 Reverse -286 -300 14.3258 0.267
NP_440459.1_2 Reverse -249 -266 12.4285 0.149
NP_440459.1_2 Forward -397 -380 9.18362 0.233
NP_442603.1_7 Reverse -251 -265 13.1753 0.0923
NP_442603.1_7 Forward -260 -246 10.0287 0.134
NP_442603.1_7 Reverse -386 -400 7.27547 0.211
NP_442828.1_5 Reverse -286 -305 16.7149 0.149
NP_440449.1_6 Reverse -243 -261 8.25583 0.203
NP_440449.1_6 Forward -268 -250 7.96405 0.206
NP_441948.1_4 Reverse -302 -320 -4.60241 0.235
NP_441833.1_4 Forward -259 -252 15.9687 0.0124
NP_441833.1_4 Reverse -252 -259 15.9687 0.0124
NP_441329.1_3 Forward -105 -95 12.8822 0.273
NP_441329.1_6 Reverse -45 -64 5.58586 0.191
NP_441329.1_6 Reverse -281 -300 3.00757 0.217
NP_442162.1_9 Forward -259 -252 16.2637 0.0124
NP_442162.1_9 Reverse -252 -259 16.2637 0.0124
NP_440671.1_2 Reverse -254 -268 14.0609 0.28
NP_440671.1_4 Forward -266 -252 8.84938 0.188
NP_443026.1_5 Forward -116 -97 -1.37718 0.283
NP_440224.1_1 Forward -271 -252 1.86774 0.132
NP_440772.1_8 Forward -266 -247 14.4541 0.253
NP_442140.1_3 Forward -259 -249 17.4829 0.0159
NP_442140.1_3 Reverse -252 -262 13.5497 0.0542
NP_441609.1_1 Forward -289 -270 0.58944 0.21
NP_440875.1_9 Forward -258 -248 15.2829 0.0295
NP_440875.1_9 Reverse -253 -263 8.66404 0.233
NP_441813.1_5 Reverse -249 -259 10.0098 0.0208
NP_441813.1_5 Forward -262 -252 8.73149 0.0367
NP_442028.1_1 Reverse -296 -309 9.51548 0.251
NP_440590.1_4 Reverse -252 -265 21.0621 0.00401
NP_440590.1_4 Forward -259 -246 12.3107 0.0148
NP_440567.1_1 Reverse -252 -266 15.0442 0.0181
NP_440567.1_1 Forward -259 -245 11.2093 0.0294
NP_442497.1_10 Forward -259 -250 10.4228 0.0087
NP_442497.1_10 Reverse -252 -261 10.4228 0.0087
NP_440821.1_4 Reverse -249 -259 18.7612 0.00422
NP_440821.1_4 Forward -262 -252 17.9746 0.00497
NP_441239.1_9 Reverse -249 -261 16.0669 0.0175
NP_441239.1_9 Forward -262 -250 9.67541 0.0987
NP_441239.1_9 Reverse -256 -268 7.70879 0.15
NP_442325.1_8 Forward -313 -294 13.4409 0.29
NP_441541.1_5 Reverse -293 -312 14.1591 0.265
NP_440833.1_6 Forward -78 -64 7.47213 0.278
NP_440949.1_7 Reverse -243 -262 9.24175 0.264
NP_440546.1_4 Forward -260 -250 11.8882 0.0679
NP_440546.1_4 Reverse -251 -261 10.046 0.109
NP_440546.1_6 Reverse -241 -260 8.65258 0.255
NP_440654.1_9 Reverse -37 -56 15.4374 0.202
NP_440462.1_6 Reverse -249 -259 17.9746 0.00578
NP_440462.1_6 Forward -262 -252 10.3048 0.0396
NP_440868.1_4 Reverse -247 -259 21.5735 0.00629
NP_440868.1_4 Forward -264 -252 0.432302 0.212
NP_441497.1_6 Forward -361 -342 13.5691 0.262
NP_441582.1_5 Forward -262 -243 12.7816 0.133
NP_441848.1_4 Reverse -284 -300 10.6064 0.25
NP_441848.1_4 Forward -64 -48 7.26419 0.292
NP_441848.1_7 Forward -244 -225 -4.52452 0.294
NP_440653.1_10 Reverse -252 -271 1.86774 0.293
NP_440696.1_3 Reverse -247 -265 -2.83245 0.279
NP_442039.1_4 Forward -259 -252 15.1821 0.0124
NP_442039.1_4 Reverse -252 -259 15.1821 0.0124
NP_440753.1_5 Reverse -363 -382 11.2092 0.184
NP_442380.1_10 Reverse -247 -265 9.0656 0.262
NP_442837.1_3 Forward -259 -252 15.7721 0.0124
NP_442837.1_3 Reverse -252 -259 15.7721 0.0124
NP_439994.1_3 Reverse -250 -269 9.21897 0.253
NP_442053.1_1 Forward -260 -251 18.3876 0.0007
NP_442053.1_1 Reverse -251 -260 18.3876 0.0007
NP_440505.1_3 Forward -262 -252 16.598 0.00683
NP_440505.1_3 Reverse -249 -259 14.1397 0.0235
NP_441203.1_1 Reverse -252 -271 -9.63698 0.137
NP_442532.1_7 Forward -260 -246 6.58777 0.171
NP_440914.1_1 Reverse -251 -261 17.5935 0.000537
NP_440914.1_1 Forward -260 -250 8.6151 0.186
NP_441011.1_8 Forward -259 -250 16.9127 0.00602
NP_441011.1_8 Reverse -252 -261 8.25953 0.144
NP_441011.1_8 Forward -115 -106 5.99792 0.208
NP_442533.1_1 Forward -398 -379 -10.7186 0.235
NP_442533.1_6 Forward -260 -251 17.2076 0.00137
NP_442533.1_6 Reverse -251 -260 17.2076 0.00137
NP_440263.1_9 Reverse -258 -277 10.6192 0.197
NP_439944.1_9 Reverse -252 -262 19.1546 0.00329
NP_439944.1_9 Forward -259 -249 10.4031 0.0887
NP_441028.1_6 Reverse -376 -386 8.14104 0.217
NP_442202.1_4 Forward -262 -248 19.3314 0.104
NP_440116.1_8 Reverse -252 -271 -0.590531 0.111
NP_441527.1_4 Reverse -281 -300 6.73176 0.0961
NP_441527.1_4 Reverse -188 -207 -10.0748 0.264
NP_441527.1_4 Reverse -280 -299 -10.6478 0.272
NP_441527.1_4 Reverse -202 -221 -11.1252 0.278
NP_441527.1_4 Reverse -33 -52 -11.4117 0.282
NP_440115.1_6 Forward -263 -253 9.81313 0.115
NP_440115.1_6 Reverse -248 -258 9.61647 0.115
NP_440007.1_9 Reverse -189 -203 0.589577 0.294
NP_440608.1_6 Forward -259 -240 4.32522 0.27
NP_441602.1_3 Reverse -246 -265 10.2259 0.116
NP_441602.1_3 Forward -265 -246 0.786102 0.217
NP_441602.1_3 Forward -277 -258 -2.16383 0.233
NP_441972.1_5 Reverse -252 -271 0.687771 0.146
NP_441106.1_1 Reverse -250 -259 18.191 0.0028
NP_441106.1_1 Forward -261 -252 9.63616 0.0311
NP_439903.1_6 Reverse -370 -389 6.29183 0.17
NP_441286.1_1 Forward -261 -249 14.7886 0.00418
NP_441286.1_1 Reverse -250 -262 12.1337 0.0104
NP_441286.1_1 Forward -325 -313 -6.74586 0.278
NP_440670.1_8 Forward -260 -251 18.3876 0.000699
NP_440670.1_8 Reverse -251 -260 18.3876 0.000699
NP_440670.1_8 Reverse -2 -11 6.39124 0.121
NP_441479.1_4 Reverse -240 -259 19.8623 0.0267
NP_442463.1_10 Forward -330 -312 9.36059 0.279
NP_440103.1_3 Forward -47 -37 16.1606 0.286
NP_440886.1_7 Reverse -250 -260 17.7774 0.0011
NP_440886.1_7 Forward -261 -251 7.94438 0.0805
NP_442614.1_2 Forward -260 -246 7.66941 0.268
NP_442072.1_9 Reverse -250 -268 6.80398 0.0115
NP_442072.1_9 Forward -261 -243 -4.01242 0.0399
NP_442213.1_7 Forward -40 -21 20.059 0.263
NP_441753.1_10 Forward -20 -1 0.58944 0.289
NP_441753.1_10 Reverse -242 -261 0.491109 0.291
NP_440907.2_8 Forward -259 -249 17.4824 0.00685
NP_440907.2_8 Reverse -252 -262 10.8943 0.0969
NP_442264.1_2 Reverse -241 -258 5.9387 0.267
NP_441021.1_1 Reverse -252 -271 13.3725 0.0264
NP_441021.1_8 Forward -265 -247 4.24738 0.223
NP_441463.1_6 Forward -262 -248 6.12603 0.283
NP_441626.1_2 Forward -259 -252 15.7721 0.0124
NP_441626.1_2 Reverse -252 -259 15.7721 0.0124
NP_442794.1_1 Forward -264 -252 3.48056 0.286
NP_442615.1_1 Reverse -242 -260 9.16393 0.0264
NP_442615.1_1 Forward -269 -251 9.0656 0.0266
NP_441962.1_4 Forward -265 -246 4.52268 0.0974
NP_441962.1_4 Reverse -310 -329 -2.45882 0.133
NP_441962.1_4 Reverse -246 -265 -11.1119 0.238
NP_440387.1_1 Forward -260 -244 13.3332 0.00865
NP_440387.1_1 Reverse -251 -267 8.12167 0.0282
NP_440855.1_9 Forward -202 -183 16.8132 0.248
NP_441431.1_2 Reverse -248 -262 16.5185 0.0356
NP_441431.1_2 Reverse -312 -326 7.3738 0.244
NP_441431.1_2 Forward -263 -249 5.89884 0.284
NP_441836.1_2 Reverse -245 -264 0.786102 0.197
NP_441993.1_1 Forward -266 -247 3.89583 0.227
NP_441993.1_1 Reverse -251 -270 0.679741 0.294
NP_440114.1_10 Forward -260 -246 12.8809 0.0698
NP_440114.1_10 Reverse -2 -16 10.3243 0.148
NP_440935.1_6 Forward -305 -288 5.87715 0.282
NP_440287.1_6 Forward -262 -243 8.16093 0.151
NP_441272.1_4 Forward -269 -250 6.4893 0.189
NP_441272.1_8 Forward -158 -140 9.75391 0.296
NP_440766.1_4 Forward -264 -250 17.6992 0.0255
NP_441237.1_9 Reverse -252 -262 14.9263 0.0242
NP_441979.1_5 Forward -266 -247 -12.1936 0.228
NP_440457.1_1 Forward -264 -252 5.34885 0.141
NP_440457.1_1 Reverse -247 -259 0.137309 0.25
NP_440798.1_6 Forward -259 -246 13.3923 0.0445
NP_441984.1_3 Reverse -247 -265 17.0304 0.0928
NP_442509.1_9 Forward -260 -250 16.2041 0.00739
NP_442509.1_9 Reverse -251 -261 8.14104 0.192
NP_441496.1_1 Forward -336 -322 13.8579 0.271
NP_442514.1_5 Forward -324 -305 -8.16275 0.285
NP_440554.1_4 Forward -259 -249 13.943 0.0218
NP_440554.1_4 Reverse -252 -262 6.37155 0.123
NP_441885.1_5 Reverse -251 -261 20.9245 0.000538
NP_441885.1_5 Forward -260 -250 11.4848 0.00668
NP_442341.1_7 Reverse -250 -264 20.3541 0.00702
NP_442341.1_7 Forward -261 -247 17.8958 0.0111
NP_441173.1_9 Reverse -73 -81 12.0154 0.214
NP_442534.1_7 Forward -268 -249 6.58763 0.272
NP_440409.1_1 Reverse -243 -262 2.3594 0.18
NP_440409.1_1 Forward -268 -249 -2.55715 0.248
NP_440750.1_5 Reverse -283 -297 4.91614 0.294
NP_443000.1_7 Forward -262 -252 10.4031 0.0345
NP_443000.1_7 Reverse -249 -259 2.04498 0.226
NP_440507.2_3 Forward -269 -250 10.1267 0.208
NP_440727.1_8 Forward -307 -293 13.667 0.286
NP_441842.1_1 Forward -258 -245 12.8017 0.185
NP_441842.1_10 Reverse -244 -258 8.35772 0.225
NP_441842.1_10 Forward -267 -253 6.88276 0.271
NP_440275.1_3 Reverse -249 -259 17.9746 0.0082
NP_440275.1_3 Forward -262 -252 17.6796 0.0102
NP_440091.1_1 Forward -264 -252 10.7571 0.0429
NP_440091.1_1 Reverse -247 -259 10.1671 0.0498
NP_443010.1_10 Reverse -248 -265 10.115 0.125
NP_441359.1_5 Reverse -248 -267 8.94757 0.159
NP_442451.1_2 Reverse -243 -262 1.76941 0.143
NP_442451.1_2 Forward -268 -249 -3.73712 0.198
NP_441122.1_1 Forward -271 -256 5.48643 0.28
NP_439962.1_8 Forward -277 -258 7.66927 0.21
NP_440175.1_4 Forward -275 -256 -13.4719 0.247
NP_442495.1_2 Reverse -254 -273 10.5209 0.266
NP_440149.1_8 Forward -260 -241 -6.49039 0.253
NP_440149.1_10 Reverse -251 -270 -11.5053 0.285
NP_441105.1_3 Forward -271 -252 -2.65548 0.165
NP_440216.1_1 Forward -260 -246 8.55439 0.00592
NP_440216.1_1 Reverse -251 -265 0.0979218 0.0284
NP_440216.1_9 Forward -387 -378 8.65285 0.286
NP_440216.1_9 Forward -386 -377 7.27622 0.286
NP_440216.1_9 Reverse -210 -219 6.78456 0.289
NP_440216.1_9 Reverse -158 -167 5.80125 0.289
NP_440172.1_1 Reverse -251 -261 15.0247 0.00945
NP_440172.1_1 Forward -260 -250 8.73149 0.0586
NP_440167.1_3 Forward -270 -251 11.1109 0.231
NP_442015.1_10 Forward -264 -251 3.65753 0.178
NP_442015.1_10 Reverse -247 -260 3.06754 0.185
NP_441226.1_7 Forward -259 -252 14.4934 0.0123
NP_441226.1_7 Reverse -252 -259 14.4934 0.0123
NP_441226.1_7 Forward -323 -316 7.1186 0.218
NP_441111.1_7 Forward -259 -251 18.7023 0.00294
NP_441111.1_7 Reverse -252 -260 18.7023 0.00294
NP_442379.1_10 Forward -267 -250 0.727158 0.223
NP_441766.1_2 Forward -260 -251 17.5026 0.00297
NP_441766.1_2 Reverse -251 -260 17.5026 0.00297
NP_440416.1_9 Reverse -256 -275 -16.4218 0.215
NP_440416.1_9 Forward -267 -248 -17.0118 0.229
NP_443052.1_8 Reverse -241 -260 1.27776 0.061
NP_443052.1_8 Forward -270 -251 -11.8003 0.237
NP_442403.1_1 Forward -114 -95 16.7149 0.145
NP_440591.1_9 Forward -267 -249 14.7688 0.0839
NP_442046.1_2 Forward -305 -292 16.0076 0.211
NP_440261.1_5 Forward -259 -246 16.2439 0.0122
NP_440261.1_5 Reverse -252 -265 -1.06236 0.0655
NP_440988.1_10 Forward -262 -248 10.514 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATGATCGTGGTCAGCCAGGGAAAAGTGTTCATACTACCCAGATAGTCTTTACAGACAATAATCTAGCAGGGATTTTTCCGGTCGGGCCCGCAGAAAAGATTAATTTTTCCTAACTTTTTCTAAGTTGCGGGTAGGCCAGTGGCGATCGCCGCCAGTCTAACTTTTGTTCACACCCAGGTTTTTTTCTATGGTTTAGATTCGCTTTACCTTTGCTTTAAGCTCTGTTGAAGCGGTTTTTCTTGGTTACAAGCTCAAAGTCACTCTAAAGATGTAACAGAATTTGAAGTTATGGCGTTTTTTCCGAAAGGAAATTCAGGTGTGGGGTAAACTAGCCCATAATCCTGACAATATTATTTTTTTCGACTTTACGGAGAACCCTCGGTTAAGGAGCCGATAGTCA

CDS

ATGTCCCATAGTGTAAAAATTTACGATACCTGTATTGGTTGTACCCAATGCGTCCGGGCTTGCCCCCTCGATGTTCTAGAAATGGTGCCCTGGGATGGTTGTAAAGCCGCTCAGATCGCCTCCTCCCCTAGAACCGAGGATTGTGTTGGCTGCAAACGTTGTGAGACCGCCTGTCCCACAGACTTTTTAAGTATCCGAGTTTATTTGGGTGCCGAAACCACCCGCAGTATGGGTTTAGCTTACTAA

Protein

MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY