Your browser is old and dusty. Try Google Chrome!

Details for ssl0461

ORF ssl0461
Accession NP_441265.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -102 -116 3.14618 0.168
NP_441061.1_2 Reverse -111 -125 -0.0987402 0.221
NP_440557.1_1 Forward -206 -187 8.65258 0.127
NP_440795.1_4 Reverse -168 -187 16.7149 0.246
NP_440795.1_7 Forward -206 -199 14.6904 0.0123
NP_440795.1_7 Reverse -199 -206 14.6904 0.0123
NP_440795.1_7 Forward -118 -111 14.6904 0.0123
NP_440795.1_7 Reverse -111 -118 14.6904 0.0123
NP_441418.1_6 Forward -119 -100 -19.4701 0.0888
NP_441418.1_6 Reverse -110 -129 -20.2567 0.108
NP_441418.1_6 Forward -207 -188 -20.8467 0.129
NP_441418.1_6 Reverse -198 -217 -21.1417 0.139
NP_441418.1_6 Forward -289 -270 -29.1065 0.216
NP_442291.1_5 Reverse -197 -213 8.71166 0.0558
NP_442291.1_5 Forward -208 -192 -0.236458 0.18
NP_441453.1_1 Reverse -103 -121 5.42659 0.246
NP_441453.1_4 Reverse -110 -118 16.6374 0.00633
NP_441453.1_4 Reverse -198 -206 16.539 0.00633
NP_441453.1_4 Forward -207 -199 16.539 0.00633
NP_441453.1_4 Forward -119 -111 16.539 0.00633
NP_442151.1_6 Forward -207 -193 17.8958 0.00866
NP_442151.1_6 Forward -119 -105 7.57108 0.194
NP_440561.1_4 Forward -209 -190 11.6543 0.285
NP_441818.1_1 Reverse -199 -210 9.79292 0.232
NP_441818.1_1 Forward -206 -195 9.59626 0.232
NP_441818.1_1 Forward -118 -107 8.90795 0.271
NP_440226.1_1 Reverse -110 -129 14.0608 0.0329
NP_440226.1_1 Reverse -198 -217 11.1109 0.0569
NP_440226.1_1 Forward -207 -188 10.2259 0.0646
NP_442173.1_1 Forward -118 -110 17.3257 0.00633
NP_442173.1_1 Forward -206 -198 15.4574 0.00633
NP_442173.1_1 Reverse -199 -207 15.4574 0.00633
NP_442173.1_1 Reverse -111 -119 15.4574 0.00633
NP_442752.1_4 Forward -207 -200 13.8055 0.0199
NP_442752.1_4 Reverse -198 -205 13.8055 0.0199
NP_442752.1_4 Forward -119 -112 13.8055 0.0199
NP_443027.1_4 Reverse -196 -206 16.2046 0.0437
NP_443027.1_4 Forward -209 -199 11.0914 0.107
NP_443027.1_4 Reverse -108 -118 7.94484 0.223
NP_443027.1_4 Forward -261 -251 5.87989 0.294
NP_441812.1_3 Forward -208 -194 12.0943 0.21
NP_442975.1_10 Reverse -194 -208 21.6317 0.000774
NP_442975.1_10 Reverse -106 -120 1.86729 0.29
NP_440784.1_7 Forward -206 -199 15.9687 0.0123
NP_440784.1_7 Reverse -199 -206 15.9687 0.0123
NP_440784.1_7 Forward -118 -111 15.9687 0.0123
NP_440784.1_7 Reverse -111 -118 15.9687 0.0123
NP_442909.1_7 Reverse -111 -125 9.93039 0.14
NP_441250.1_3 Reverse -117 -136 7.66927 0.199
NP_440061.1_9 Reverse -196 -210 18.0918 0.0109
NP_440061.1_9 Forward -121 -107 15.3386 0.0468
NP_440061.1_9 Reverse -266 -280 10.717 0.123
NP_440878.1_9 Reverse -258 -277 -3.04881 0.286
NP_442062.1_8 Reverse -198 -208 17.3846 0.00193
NP_442062.1_8 Forward -119 -109 17.3846 0.00193
NP_442062.1_8 Reverse -110 -120 14.9263 0.0108
NP_442062.1_8 Forward -207 -197 10.3048 0.0493
NP_441900.1_2 Reverse -261 -279 -0.866561 0.27
NP_440304.1_4 Reverse -196 -206 19.9412 0.00364
NP_440304.1_4 Reverse -108 -118 8.23984 0.0845
NP_440304.1_4 Forward -209 -199 1.84832 0.299
NP_440304.1_4 Forward -121 -111 1.84832 0.299
NP_442242.1_4 Forward -206 -199 14.3954 0.0124
NP_442242.1_4 Reverse -199 -206 14.3954 0.0124
NP_442242.1_4 Forward -118 -111 14.3954 0.0124
NP_442242.1_4 Reverse -111 -118 14.3954 0.0124
NP_439918.1_2 Reverse -381 -400 6.78429 0.154
NP_441619.1_8 Forward -125 -111 15.3386 0.0847
NP_441208.1_9 Forward -210 -196 7.57108 0.221
NP_441546.1_1 Forward -66 -53 16.0472 0.278
NP_442110.1_7 Forward -207 -193 20.7474 0.013
NP_441083.1_5 Reverse -198 -208 20.3345 0.00053
NP_441083.1_5 Forward -207 -197 11.2881 0.0159
NP_441083.1_5 Reverse -110 -120 11.0914 0.0166
NP_441083.1_5 Forward -119 -109 9.51814 0.026
NP_442827.1_8 Forward -127 -108 -2.26292 0.272
NP_441434.1_7 Reverse -112 -126 2.85119 0.268
NP_441738.1_2 Forward -205 -198 15.28 0.0102
NP_441738.1_2 Reverse -200 -207 15.28 0.0102
NP_441738.1_2 Reverse -112 -119 15.28 0.0102
NP_441738.1_2 Forward -117 -110 11.5435 0.084
NP_441558.1_5 Reverse -108 -127 11.3075 0.0828
NP_441558.1_5 Reverse -196 -215 11.0125 0.0879
NP_441558.1_5 Forward -209 -190 3.93269 0.294
NP_440209.1_1 Reverse -198 -206 18.1123 0.00295
NP_440209.1_1 Forward -207 -199 18.1123 0.00295
NP_440209.1_1 Forward -119 -111 18.1123 0.00295
NP_440209.1_1 Reverse -110 -118 8.57422 0.0425
NP_442889.1_8 Reverse -195 -209 10.0287 0.0916
NP_442889.1_8 Reverse -107 -121 9.83206 0.0943
NP_442889.1_8 Reverse -182 -196 2.8506 0.299
NP_441713.1_1 Forward -213 -194 -15.1435 0.26
NP_441713.1_8 Forward -222 -204 11.5239 0.244
NP_441713.1_8 Forward -211 -193 9.45892 0.268
NP_440178.1_7 Forward -208 -189 -5.21209 0.0614
NP_440178.1_7 Forward -104 -85 -21.1417 0.213
NP_442570.1_3 Forward -209 -190 -8.35868 0.285
NP_442570.1_8 Reverse -93 -111 13.8838 0.15
NP_441025.1_10 Reverse -39 -55 13.3332 0.233
NP_441716.1_1 Reverse -198 -212 17.6008 0.0261
NP_441327.1_1 Forward -141 -122 10.941 0.184
NP_441327.1_1 Forward -366 -347 7.28887 0.237
NP_442111.1_4 Forward -208 -194 11.406 0.0509
NP_442111.1_4 Reverse -197 -211 9.83269 0.0575
NP_442111.1_4 Forward -120 -106 2.35953 0.28
NP_440906.1_5 Forward -206 -199 15.8704 0.0124
NP_440906.1_5 Reverse -199 -206 15.8704 0.0124
NP_440906.1_5 Forward -118 -111 15.8704 0.0124
NP_440906.1_5 Reverse -111 -118 15.8704 0.0124
NP_440747.1_10 Forward -210 -198 26.5883 0.000317
NP_440747.1_10 Forward -122 -110 5.05386 0.019
NP_440747.1_10 Reverse -195 -207 -1.92764 0.0192
NP_440747.1_10 Reverse -107 -119 -11.7607 0.142
NP_441130.1_10 Forward -209 -195 4.71948 0.27
NP_442973.1_5 Reverse -189 -208 17.2074 0.0793
NP_441486.1_1 Forward -122 -108 7.07942 0.0344
NP_441486.1_1 Reverse -195 -209 5.30946 0.0379
NP_441486.1_1 Reverse -107 -121 -3.73699 0.181
NP_441486.1_1 Forward -210 -196 -4.52363 0.201
NP_442634.1_4 Forward -209 -195 7.37441 0.0479
NP_442634.1_4 Reverse -196 -210 -1.47537 0.149
NP_441265.1_5 Forward -347 -329 19.0945 0.237
NP_440403.1_4 Forward -227 -208 -10.227 0.297
NP_440842.1_6 Forward -121 -102 15.4366 0.148
NP_440842.1_10 Reverse -107 -121 2.5562 0.274
NP_442848.1_1 Reverse -192 -206 7.07942 0.0791
NP_442848.1_1 Forward -213 -199 6.78443 0.0791
NP_442848.1_1 Forward -125 -111 -0.885388 0.263
NP_443018.1_3 Forward -206 -199 14.8871 0.0123
NP_443018.1_3 Reverse -199 -206 14.8871 0.0123
NP_443018.1_3 Forward -118 -111 14.8871 0.0123
NP_443018.1_3 Reverse -111 -118 14.8871 0.0123
NP_441634.1_8 Forward -209 -195 4.91614 0.114
NP_441634.1_9 Forward -78 -59 11.2084 0.252
NP_440376.1_1 Forward -207 -198 19.4693 0.000692
NP_440376.1_1 Reverse -198 -207 19.4693 0.000692
NP_440376.1_1 Reverse -110 -119 9.73449 0.0365
NP_440376.1_1 Forward -119 -110 9.63616 0.0385
NP_441857.1_6 Reverse -380 -390 14.4347 0.244
NP_441588.1_4 Reverse -112 -122 15.9097 0.0369
NP_441588.1_4 Forward -205 -195 6.66654 0.185
NP_442687.1_7 Reverse -197 -207 9.02648 0.0994
NP_442687.1_7 Reverse -109 -119 9.02648 0.0994
NP_442687.1_7 Forward -208 -198 8.92815 0.0994
NP_442687.1_7 Forward -120 -110 7.94484 0.121
NP_442191.1_4 Forward -206 -192 13.7079 0.132
NP_441846.1_10 Reverse -287 -306 -16.4218 0.256
NP_442958.1_3 Forward -218 -199 -0.295539 0.267
NP_441763.1_10 Reverse -187 -206 7.4718 0.237
NP_440360.1_10 Reverse -270 -284 4.12949 0.227
NP_440360.1_10 Forward -117 -103 1.86788 0.282
NP_442658.1_1 Reverse -108 -118 16.7941 0.00966
NP_442658.1_1 Reverse -196 -206 13.0576 0.04
NP_442658.1_1 Forward -209 -199 7.94438 0.199
NP_442658.1_1 Forward -121 -111 6.76441 0.214
NP_441855.2_4 Reverse -102 -121 9.61947 0.275
NP_441414.1_9 Reverse -198 -217 2.75272 0.0631
NP_441414.1_9 Reverse -110 -129 -9.047 0.252
NP_440607.1_8 Forward -235 -216 1.0811 0.273
NP_442937.1_5 Forward -294 -275 6.88262 0.268
NP_441958.1_5 Reverse -197 -207 21.2195 0.000805
NP_441958.1_5 Forward -208 -198 12.2714 0.00183
NP_441958.1_5 Forward -120 -110 10.9931 0.00875
NP_441958.1_5 Reverse -109 -119 10.7964 0.0099
NP_441127.1_1 Forward -277 -263 10.6193 0.244
NP_441127.1_1 Forward -280 -266 7.57108 0.3
NP_439905.1_1 Reverse -269 -282 7.49244 0.258
NP_439905.1_1 Forward -118 -105 7.49244 0.258
NP_443001.1_7 Forward -118 -99 3.34271 0.279
NP_440984.1_7 Reverse -105 -119 11.996 0.122
NP_440984.1_7 Forward -124 -110 10.0294 0.126
NP_439990.1_5 Forward -124 -111 7.6891 0.186
NP_439990.1_5 Reverse -193 -206 6.80412 0.221
NP_442690.1_1 Forward -388 -369 -17.2085 0.298
NP_442911.1_2 Forward -217 -198 16.7157 0.0087
NP_442911.1_2 Reverse -188 -207 -4.22878 0.129
NP_442911.1_2 Reverse -100 -119 -10.227 0.273
NP_441580.1_6 Reverse -99 -118 -5.9004 0.235
NP_441580.1_6 Reverse -187 -206 -8.16202 0.254
NP_440153.1_5 Forward -206 -192 11.6026 0.0763
NP_440153.1_5 Reverse -199 -213 8.16106 0.149
NP_440153.1_8 Reverse -268 -281 -1.94734 0.23
NP_442064.1_1 Forward -212 -193 -11.2103 0.259
NP_443055.1_6 Forward -119 -101 10.4414 0.125
NP_440993.1_2 Reverse -193 -209 9.20332 0.123
NP_440827.1_3 Reverse -187 -206 14.1591 0.213
NP_440602.1_9 Forward -240 -221 17.3057 0.11
NP_440138.1_6 Reverse -193 -212 14.5516 0.109
NP_440615.1_2 Reverse -117 -136 5.211 0.296
NP_441099.1_5 Reverse -100 -119 -1.37718 0.107
NP_441099.1_5 Forward -217 -198 -9.34199 0.219
NP_442002.1_9 Reverse -109 -116 11.6422 0.185
NP_442002.1_9 Reverse -39 -46 9.77388 0.258
NP_441294.1_7 Reverse -194 -208 14.242 0.0448
NP_441646.1_1 Forward -214 -195 9.0459 0.137
NP_442438.1_10 Reverse -193 -207 7.17775 0.0987
NP_442438.1_10 Forward -212 -198 3.8345 0.156
NP_442431.1_10 Forward -289 -271 4.83737 0.206
NP_441000.1_6 Reverse -197 -211 -3.34366 0.221
NP_440147.1_4 Forward -121 -108 18.9972 0.00328
NP_440147.1_4 Reverse -196 -209 11.3273 0.0326
NP_440147.1_4 Forward -209 -196 8.08242 0.0561
NP_440147.1_4 Reverse -108 -121 1.9859 0.213
NP_441175.1_7 Reverse -198 -217 11.9958 0.128
NP_441550.1_8 Forward -209 -199 15.1225 0.0132
NP_441550.1_8 Reverse -108 -118 15.0242 0.0132
NP_441550.1_8 Forward -121 -111 14.6309 0.0132
NP_441550.1_8 Reverse -196 -206 13.0576 0.0273
NP_441916.1_7 Forward -207 -197 18.9579 0.00144
NP_441916.1_7 Forward -119 -109 14.828 0.0115
NP_441916.1_7 Reverse -110 -120 10.9931 0.0261
NP_441916.1_7 Reverse -198 -208 10.3048 0.0261
NP_441041.1_4 Forward -207 -188 -3.24547 0.12
NP_441041.1_7 Reverse -107 -119 11.5962 0.0757
NP_441041.1_7 Reverse -195 -207 9.65268 0.108
NP_441041.1_7 Forward -210 -198 7.51478 0.162
NP_442396.1_5 Forward -123 -110 22.1438 0.00421
NP_440703.1_9 Reverse -192 -205 9.45847 0.216
NP_441725.1_4 Forward -62 -48 7.86545 0.217
NP_441725.1_4 Forward -212 -198 3.63724 0.278
NP_441725.1_5 Forward -206 -196 11.1898 0.0247
NP_441725.1_5 Forward -118 -108 9.7148 0.0503
NP_441725.1_5 Reverse -199 -209 2.04498 0.115
NP_441725.1_5 Reverse -111 -121 2.04498 0.115
NP_439966.1_4 Forward -230 -211 8.55425 0.2
NP_439966.1_7 Forward -209 -199 15.3192 0.0152
NP_439966.1_7 Reverse -196 -206 14.8275 0.0177
NP_439966.1_7 Forward -121 -111 7.25606 0.15
NP_439966.1_9 Reverse -108 -117 0.983037 0.253
NP_440202.1_8 Reverse -102 -121 9.80632 0.297
NP_442941.1_3 Forward -206 -196 19.9412 0.00262
NP_442941.1_3 Reverse -199 -209 19.2529 0.00262
NP_442941.1_3 Reverse -111 -121 11.0914 0.0116
NP_442941.1_3 Forward -118 -108 -0.118297 0.249
NP_440289.1_2 Reverse -195 -208 13.3923 0.0132
NP_440289.1_2 Reverse -107 -120 2.47756 0.096
NP_440289.1_2 Forward -210 -197 -3.71729 0.267
NP_440289.1_4 Reverse -106 -125 15.3391 0.126
NP_441678.1_9 Forward -218 -199 -0.688862 0.235
NP_442281.1_1 Reverse -193 -207 16.8135 0.00698
NP_442281.1_1 Reverse -105 -119 9.6354 0.0684
NP_442281.1_1 Forward -212 -198 9.24208 0.0726
NP_442281.1_1 Forward -124 -110 5.1122 0.169
NP_442847.1_4 Reverse -95 -114 10.9142 0.247
NP_442256.1_2 Forward -209 -191 0.609134 0.115
NP_442256.1_2 Reverse -108 -126 -8.83064 0.236
NP_440437.1_1 Reverse -192 -211 -0.688862 0.185
NP_442500.1_9 Reverse -273 -292 13.8641 0.275
NP_442012.1_1 Forward -125 -106 2.26107 0.202
NP_441087.1_5 Reverse -43 -62 7.66846 0.182
NP_441556.1_4 Reverse -277 -296 11.2584 0.248
NP_442982.1_5 Reverse -188 -207 7.47261 0.126
NP_441196.1_2 Reverse -65 -84 6.39097 0.212
NP_441644.1_6 Forward -207 -197 19.0557 0.000803
NP_441644.1_6 Reverse -198 -208 17.3841 0.00127
NP_441644.1_6 Reverse -110 -120 15.0242 0.00766
NP_441644.1_6 Forward -119 -109 6.27276 0.163
NP_440867.1_10 Reverse -101 -120 7.37428 0.251
NP_442215.1_2 Forward -209 -193 7.82668 0.067
NP_442215.1_2 Forward -121 -105 -2.49807 0.198
NP_442247.1_8 Forward -121 -107 21.8291 0.0186
NP_440253.1_2 Reverse -198 -216 1.78911 0.152
NP_440253.1_2 Forward -119 -101 -1.65248 0.245
NP_440929.1_8 Forward -207 -198 19.2726 0.000701
NP_440929.1_8 Reverse -198 -207 19.2726 0.000701
NP_440929.1_8 Reverse -110 -119 9.93116 0.0249
NP_440929.1_8 Forward -119 -110 9.83282 0.0254
NP_442933.1_10 Forward -207 -198 17.601 0.00325
NP_442933.1_10 Reverse -198 -207 17.601 0.00325
NP_442933.1_10 Forward -119 -110 17.601 0.00325
NP_442933.1_10 Reverse -110 -119 17.601 0.00325
NP_441751.2_8 Reverse -199 -213 15.9292 0.0109
NP_441751.2_8 Forward -206 -192 -3.147 0.134
NP_441751.2_8 Reverse -111 -125 -3.147 0.134
NP_442554.1_8 Forward -206 -196 16.9913 0.0065
NP_442554.1_8 Reverse -199 -209 16.2046 0.0065
NP_442554.1_8 Reverse -111 -121 15.3197 0.00882
NP_442554.1_8 Forward -118 -108 7.35486 0.0931
NP_442554.1_8 Forward -263 -253 2.24165 0.276
NP_442863.1_5 Reverse -99 -118 16.5191 0.169
NP_442075.1_4 Reverse -59 -78 11.8975 0.255
NP_441762.1_7 Reverse -109 -121 10.7571 0.0142
NP_441762.1_7 Forward -120 -108 -4.87757 0.183
NP_441762.1_7 Forward -152 -140 -5.86088 0.246
NP_441762.1_7 Reverse -197 -209 -6.64753 0.284
NP_441762.1_7 Forward -208 -196 -6.94252 0.284
NP_442142.1_4 Forward -210 -197 14.08 0.0317
NP_442142.1_4 Reverse -195 -208 13.5883 0.0348
NP_442292.1_1 Reverse -199 -208 18.486 0.00229
NP_442292.1_1 Reverse -111 -120 18.486 0.00229
NP_442292.1_1 Forward -206 -197 17.5026 0.00435
NP_442292.1_1 Forward -118 -109 0.589713 0.23
NP_440122.1_1 Forward -200 -181 18.4857 0.0149
NP_440919.1_1 Reverse -105 -124 -8.85033 0.296
NP_442476.1_6 Reverse -199 -213 12.7826 0.0457
NP_442476.1_6 Forward -118 -104 12.586 0.0469
NP_442476.1_6 Reverse -111 -125 8.16106 0.105
NP_441711.1_4 Reverse -276 -295 5.11266 0.182
NP_443009.1_5 Forward -120 -109 14.7094 0.02
NP_443009.1_5 Forward -208 -197 14.5128 0.02
NP_443009.1_5 Reverse -197 -208 10.1862 0.0792
NP_443009.1_5 Reverse -109 -120 7.138 0.137
NP_441865.1_3 Forward -385 -367 12.8022 0.279
NP_442408.2_1 Forward -207 -188 -4.13045 0.256
NP_441715.1_4 Reverse -199 -209 17.3846 0.0106
NP_441715.1_4 Forward -206 -196 14.238 0.0295
NP_441715.1_4 Reverse -111 -121 7.94484 0.107
NP_440357.1_3 Reverse -108 -127 0.491109 0.28
NP_440881.1_10 Reverse -199 -212 12.5073 0.249
NP_441298.1_3 Reverse -310 -320 15.8729 0.277
NP_441198.1_8 Reverse -108 -118 14.7362 0.0644
NP_441198.1_8 Reverse -196 -206 13.2713 0.108
NP_440379.1_2 Reverse -92 -111 12.0942 0.205
NP_440464.1_10 Reverse -111 -121 13.0082 0.169
NP_441468.1_1 Forward -206 -199 15.8704 0.0124
NP_441468.1_1 Reverse -199 -206 15.8704 0.0124
NP_441468.1_1 Forward -118 -111 15.8704 0.0124
NP_441468.1_1 Reverse -111 -118 15.8704 0.0124
NP_441020.2_6 Forward -121 -104 11.5436 0.117
NP_441020.2_6 Reverse -108 -125 10.5603 0.141
NP_441020.2_6 Reverse -196 -213 6.52869 0.262
NP_441015.1_10 Forward -282 -263 -10.817 0.288
NP_441673.1_1 Forward -207 -198 20.8459 0.000698
NP_441673.1_1 Reverse -198 -207 20.8459 0.000698
NP_441673.1_1 Reverse -110 -119 11.1111 0.0121
NP_441673.1_1 Forward -119 -110 11.0128 0.018
NP_441339.1_2 Forward -113 -94 16.4207 0.0675
NP_441876.1_9 Forward -55 -45 12.3692 0.267
NP_441826.1_2 Reverse -192 -206 14.4542 0.0196
NP_441826.1_2 Forward -213 -199 9.93102 0.0532
NP_441393.1_2 Forward -231 -212 11.5089 0.272
NP_442811.1_2 Forward -75 -56 -2.65548 0.281
NP_442868.1_6 Forward -209 -199 19.2529 0.00563
NP_442868.1_6 Forward -121 -111 9.81313 0.038
NP_442868.1_6 Reverse -108 -118 7.94484 0.0657
NP_442868.1_6 Reverse -196 -206 1.06167 0.205
NP_442719.1_2 Forward -68 -50 -8.04469 0.241
NP_441056.1_1 Forward -207 -188 -6.98204 0.271
NP_441612.1_2 Reverse -185 -195 13.0027 0.21
NP_441612.1_2 Reverse -198 -208 8.54929 0.21
NP_442559.1_3 Forward -311 -292 16.5191 0.133
NP_442227.1_2 Reverse -267 -286 2.26107 0.235
NP_442361.1_3 Reverse -192 -205 15.9489 0.0811
NP_442427.1_8 Reverse -101 -120 8.75091 0.194
NP_442427.1_8 Reverse -189 -208 7.17762 0.219
NP_442427.1_8 Forward -128 -109 7.07928 0.221
NP_442808.1_1 Reverse -197 -207 8.73102 0.0481
NP_442808.1_1 Forward -208 -198 8.63269 0.0481
NP_440031.1_10 Forward -288 -269 -0.787193 0.29
NP_440145.1_3 Forward -217 -198 1.0811 0.131
NP_442718.1_2 Forward -267 -248 -6.88371 0.295
NP_442050.1_5 Reverse -196 -206 18.0724 0.00365
NP_442050.1_5 Forward -209 -199 14.3359 0.0206
NP_442050.1_5 Reverse -108 -118 14.0409 0.0259
NP_442050.1_5 Forward -121 -111 7.64939 0.243
NP_442342.1_9 Reverse -94 -110 8.31834 0.194
NP_442342.1_9 Forward -209 -193 4.18844 0.251
NP_442789.1_4 Forward -121 -102 -1.57384 0.219
NP_441878.1_6 Reverse -197 -207 10.5014 0.0176
NP_441878.1_6 Reverse -109 -119 10.5014 0.0176
NP_441878.1_6 Forward -208 -198 10.4031 0.0176
NP_441878.1_6 Forward -120 -110 0.57002 0.14
NP_441036.1_8 Reverse -197 -207 15.713 0.00724
NP_441036.1_8 Forward -208 -198 8.33817 0.174
NP_441036.1_8 Reverse -109 -119 8.1415 0.176
NP_440614.1_8 Forward -288 -269 12.0942 0.237
NP_441557.1_5 Forward -207 -198 19.9609 0.000699
NP_441557.1_5 Reverse -198 -207 19.9609 0.000699
NP_441557.1_5 Forward -119 -110 18.6826 0.0015
NP_441557.1_5 Reverse -110 -119 10.5211 0.00695
NP_441590.1_6 Reverse -188 -207 12.7816 0.209
NP_442066.2_9 Forward -123 -110 9.06573 0.181
NP_441308.1_8 Reverse -196 -206 13.353 0.218
NP_440101.1_3 Forward -212 -193 0.58944 0.297
NP_442183.1_1 Forward -207 -193 11.111 0.0757
NP_442183.1_1 Reverse -110 -124 9.93102 0.0903
NP_442183.1_1 Forward -119 -105 4.22782 0.271
NP_442183.1_9 Forward -280 -270 9.41981 0.296
NP_441549.1_9 Forward -211 -193 -4.8974 0.198
NP_441638.1_4 Reverse -378 -397 14.4541 0.212
NP_442347.1_2 Reverse -199 -208 12.4878 0.056
NP_442347.1_2 Reverse -111 -120 12.4878 0.056
NP_442347.1_2 Forward -206 -197 3.34298 0.284
NP_442645.1_2 Forward -215 -196 -3.54046 0.0488
NP_441037.1_4 Reverse -108 -118 9.85159 0.21
NP_441037.1_4 Forward -121 -111 7.9999 0.237
NP_441037.1_4 Reverse -196 -206 7.31769 0.237
NP_441633.1_3 Forward -121 -108 10.5407 0.0286
NP_441633.1_3 Forward -209 -196 3.26421 0.0709
NP_441633.1_3 Forward -153 -140 -5.97891 0.236
NP_440136.1_2 Forward -206 -199 15.9687 0.0123
NP_440136.1_2 Reverse -199 -206 15.9687 0.0123
NP_440136.1_2 Forward -118 -111 15.9687 0.0123
NP_440136.1_2 Reverse -111 -118 15.9687 0.0123
NP_442590.1_10 Forward -207 -188 15.4374 0.113
NP_442998.1_10 Forward -205 -198 15.5754 0.0102
NP_442998.1_10 Reverse -200 -207 15.5754 0.0102
NP_442998.1_10 Reverse -112 -119 15.5754 0.0102
NP_442998.1_10 Forward -117 -110 5.74231 0.255
NP_440899.1_2 Reverse -99 -118 8.35677 0.2
NP_440299.1_1 Forward -211 -198 16.5383 0.00987
NP_440299.1_1 Forward -123 -110 13.0967 0.0319
NP_440299.1_1 Reverse -106 -119 5.82024 0.162
NP_440299.1_1 Reverse -194 -207 4.93527 0.193
NP_441799.1_1 Forward -211 -197 15.4369 0.0182
NP_441799.1_1 Reverse -106 -120 12.6836 0.0415
NP_441799.1_1 Forward -123 -109 8.45543 0.114
NP_441799.1_1 Reverse -194 -208 4.62054 0.242
NP_440640.1_6 Forward -289 -270 -1.18052 0.299
NP_441007.1_10 Reverse -105 -118 9.95071 0.0804
NP_441007.1_10 Forward -124 -111 8.27909 0.115
NP_441007.1_10 Reverse -193 -206 2.67422 0.183
NP_441007.1_10 Forward -282 -269 0.314277 0.233
NP_441007.1_10 Forward -212 -199 -0.865694 0.295
NP_442334.1_1 Reverse -98 -117 -2.85214 0.186
NP_442333.2_5 Reverse -187 -206 -7.08038 0.227
NP_440256.1_1 Forward -210 -191 20.1573 0.00424
NP_440256.1_1 Reverse -195 -214 -0.688862 0.0954
NP_440256.1_1 Forward -122 -103 -10.0303 0.293
NP_440256.1_1 Reverse -206 -225 -10.3253 0.299
NP_441559.1_8 Forward -212 -198 0.786239 0.161
NP_441559.1_8 Reverse -204 -218 -6.78525 0.279
NP_441559.1_8 Reverse -193 -207 -7.57189 0.295
NP_440915.1_6 Forward -211 -197 16.9125 0.0183
NP_440915.1_6 Reverse -194 -208 4.52282 0.0953
NP_440915.1_6 Reverse -106 -120 3.44117 0.101
NP_441296.1_5 Forward -291 -272 12.5858 0.291
NP_440717.1_1 Reverse -269 -288 13.6675 0.159
NP_442785.1_7 Reverse -207 -221 13.3726 0.228
NP_442785.1_7 Reverse -196 -210 10.9143 0.228
NP_441704.1_8 Forward -130 -111 8.06178 0.213
NP_442967.1_10 Reverse -191 -205 15.999 0.222
NP_442866.1_1 Forward -212 -193 -3.93378 0.222
NP_440748.1_8 Forward -197 -178 16.5191 0.292
NP_441939.1_3 Forward -206 -187 9.83255 0.133
NP_441939.1_3 Reverse -199 -218 5.11266 0.288
NP_441494.1_6 Reverse -105 -118 7.59077 0.254
NP_442993.1_1 Forward -207 -191 -9.28291 0.181
NP_442993.1_1 Reverse -255 -271 -12.1345 0.266
NP_442386.1_9 Forward -208 -199 13.8639 0.0289
NP_442386.1_9 Forward -120 -111 13.8639 0.0289
NP_442386.1_9 Forward -229 -220 7.47246 0.219
NP_442386.1_9 Reverse -109 -118 7.37413 0.219
NP_442386.1_9 Reverse -197 -206 6.39082 0.219
NP_441750.1_1 Forward -286 -267 -7.76869 0.27
NP_441750.1_4 Forward -211 -192 6.78429 0.159
NP_441750.1_7 Forward -277 -267 14.7297 0.254
NP_441340.1_5 Forward -206 -199 15.6737 0.0124
NP_441340.1_5 Reverse -199 -206 15.6737 0.0124
NP_441340.1_5 Forward -118 -111 15.6737 0.0124
NP_441340.1_5 Reverse -111 -118 15.6737 0.0124
NP_442484.1_2 Forward -130 -111 6.19431 0.156
NP_442484.1_2 Reverse -99 -118 0.0977854 0.252
NP_440168.1_9 Forward -121 -102 2.75272 0.231
NP_442240.1_2 Forward -206 -187 -13.2752 0.167
NP_442240.1_2 Reverse -199 -218 -20.0601 0.295
NP_441134.1_10 Reverse -99 -117 17.4237 0.137
NP_440586.1_8 Forward -206 -199 13.2151 0.026
NP_440586.1_8 Forward -118 -111 13.2151 0.026
NP_440586.1_8 Reverse -199 -206 13.2151 0.026
NP_440586.1_8 Reverse -111 -118 13.2151 0.026
NP_440586.1_9 Forward -275 -256 7.17762 0.273
NP_442251.1_6 Forward -206 -199 15.2804 0.0124
NP_442251.1_6 Reverse -199 -206 15.2804 0.0124
NP_442251.1_6 Forward -118 -111 15.2804 0.0124
NP_442251.1_6 Reverse -111 -118 15.2804 0.0124
NP_440684.1_9 Forward -125 -111 12.6843 0.168
NP_441262.1_3 Reverse -198 -205 14.7888 0.0223
NP_441262.1_3 Forward -207 -200 14.7888 0.0223
NP_441262.1_3 Forward -119 -112 14.7888 0.0223
NP_441262.1_3 Reverse -110 -117 13.9038 0.0336
NP_440027.1_8 Forward -210 -191 5.40686 0.279
NP_443051.1_1 Reverse -197 -206 19.5676 0.00335
NP_443051.1_1 Forward -208 -199 10.4228 0.00754
NP_443051.1_1 Forward -120 -111 10.4228 0.00754
NP_443051.1_1 Reverse -109 -118 8.75118 0.027
NP_439996.1_6 Reverse -203 -222 6.26128 0.296
NP_439984.1_3 Forward -214 -200 15.5352 0.149
NP_439937.1_9 Forward -350 -333 -11.5649 0.257
NP_440626.1_1 Reverse -111 -130 9.63507 0.258
NP_440439.1_1 Forward -210 -197 8.86907 0.0488
NP_440439.1_1 Reverse -195 -208 1.88757 0.139
NP_439943.1_4 Reverse -369 -388 4.52268 0.287
NP_440372.1_2 Forward -206 -199 16.3621 0.0124
NP_440372.1_2 Reverse -199 -206 16.3621 0.0124
NP_440372.1_2 Forward -118 -111 16.3621 0.0124
NP_440372.1_2 Reverse -111 -118 16.3621 0.0124
NP_440171.1_3 Reverse -46 -65 2.85105 0.285
NP_441181.1_10 Forward -239 -220 15.5357 0.228
NP_440819.1_5 Forward -220 -212 7.98423 0.228
NP_439977.1_5 Forward -213 -194 6.39097 0.133
NP_441572.1_7 Reverse -192 -211 13.9625 0.0298
NP_440267.1_2 Forward -212 -198 11.2087 0.125
NP_440267.1_2 Reverse -193 -207 8.75042 0.162
NP_442887.1_5 Forward -133 -114 -14.2585 0.294
NP_442384.1_10 Reverse -198 -211 19.8821 0.00338
NP_442384.1_10 Reverse -110 -123 15.3589 0.0103
NP_442384.1_10 Forward -207 -194 8.08242 0.0692
NP_442384.1_10 Forward -119 -106 0.510939 0.289
NP_441877.1_9 Forward -381 -364 1.90713 0.292
NP_442235.1_3 Forward -123 -104 16.5191 0.0516
NP_442790.1_4 Forward -216 -197 -15.7335 0.297
NP_442262.1_10 Forward -206 -199 14.1988 0.0123
NP_442262.1_10 Reverse -199 -206 14.1988 0.0123
NP_442262.1_10 Forward -118 -111 14.1988 0.0123
NP_442262.1_10 Reverse -111 -118 14.1988 0.0123
NP_442262.1_10 Forward -263 -256 8.49558 0.226
NP_441689.1_5 Reverse -196 -206 17.8758 0.0158
NP_441689.1_5 Forward -209 -199 5.78111 0.197
NP_441689.1_5 Forward -121 -111 5.78111 0.197
NP_441689.1_5 Forward -266 -256 5.58445 0.23
NP_440344.1_10 Reverse -191 -208 -4.77938 0.1
NP_440344.1_10 Reverse -103 -120 -11.8592 0.231
NP_440282.1_10 Reverse -276 -295 -6.98204 0.251
NP_440531.1_6 Reverse -102 -121 5.11266 0.118
NP_440531.1_6 Forward -285 -266 -4.42544 0.28
NP_442123.1_3 Forward -119 -100 20.7473 0.0407
NP_441060.1_1 Reverse -247 -266 11.7915 0.294
NP_442910.1_1 Forward -126 -107 -6.68705 0.254
NP_440189.1_2 Forward -272 -253 1.37609 0.268
NP_440562.1_3 Forward -118 -101 10.8552 0.15
NP_441965.1_10 Reverse -107 -123 12.8416 0.105
NP_441965.1_10 Reverse -195 -211 9.39998 0.123
NP_440297.1_9 Forward -206 -196 9.22315 0.0917
NP_440297.1_9 Forward -118 -108 0.963343 0.282
NP_440297.1_9 Reverse -199 -209 -0.118297 0.282
NP_440297.1_9 Reverse -111 -121 -0.118297 0.282
NP_441896.1_3 Reverse -101 -120 -0.983855 0.252
NP_441896.1_5 Reverse -381 -388 15.3787 0.268
NP_441103.1_2 Reverse -187 -205 6.80322 0.293
NP_442067.1_4 Reverse -99 -118 3.53937 0.282
NP_440999.1_9 Reverse -194 -208 4.42448 0.116
NP_440999.1_9 Reverse -106 -120 2.35953 0.151
NP_440999.1_9 Forward -211 -197 -1.96703 0.254
NP_440888.1_2 Forward -207 -193 18.8785 0.00178
NP_440888.1_2 Reverse -198 -212 14.3553 0.0187
NP_440888.1_2 Forward -294 -280 6.39049 0.236
NP_440888.1_2 Forward -119 -105 5.40719 0.28
NP_440888.1_2 Reverse -110 -124 5.21053 0.288
NP_440600.1_4 Forward -127 -109 -0.374176 0.151
NP_440600.1_4 Reverse -102 -120 -2.43913 0.197
NP_442147.1_7 Forward -279 -260 13.6675 0.223
NP_439969.1_3 Reverse -193 -212 -0.787193 0.271
NP_441543.1_2 Reverse -199 -208 16.9127 0.00359
NP_441543.1_2 Reverse -111 -120 16.9127 0.00359
NP_441543.1_2 Forward -206 -197 15.9293 0.00518
NP_441543.1_2 Forward -118 -109 6.29291 0.153
NP_442845.1_2 Forward -125 -111 5.99778 0.219
NP_442845.1_2 Reverse -192 -206 5.1128 0.243
NP_440208.1_1 Reverse -57 -76 -9.63698 0.257
NP_441551.1_5 Forward -211 -195 14.6108 0.104
NP_441918.1_7 Reverse -197 -216 2.45773 0.265
NP_441918.1_7 Reverse -109 -128 -2.65548 0.297
NP_441469.1_8 Reverse -197 -206 6.5879 0.227
NP_441469.1_8 Forward -208 -199 6.48957 0.227
NP_441469.1_8 Forward -120 -111 6.48957 0.227
NP_441469.1_8 Reverse -109 -118 5.3096 0.277
NP_443064.1_6 Reverse -198 -208 12.5669 0.0796
NP_443064.1_6 Forward -207 -197 10.8217 0.13
NP_443064.1_6 Forward -119 -109 10.2399 0.166
NP_443064.1_6 Reverse -110 -120 9.75513 0.199
NP_443064.1_6 Reverse -285 -295 9.3673 0.226
NP_442337.1_8 Forward -84 -65 -0.688862 0.278
NP_442337.1_8 Forward -80 -61 -2.0655 0.293
NP_442578.1_7 Forward -206 -199 14.5921 0.026
NP_442578.1_7 Forward -118 -111 14.5921 0.026
NP_442578.1_7 Reverse -199 -206 14.5921 0.026
NP_442578.1_7 Reverse -111 -118 14.5921 0.026
NP_440710.1_1 Reverse -190 -208 -4.50408 0.21
NP_440071.1_1 Reverse -270 -287 14.886 0.223
NP_440071.1_1 Reverse -273 -290 8.88789 0.274
NP_441462.1_2 Forward -207 -197 20.2362 0.000805
NP_441462.1_2 Forward -119 -109 19.1546 0.00206
NP_441462.1_2 Reverse -198 -208 11.5831 0.00406
NP_441462.1_2 Reverse -110 -120 1.84832 0.081
NP_443062.1_1 Forward -207 -189 7.47334 0.175
NP_443062.1_1 Reverse -198 -216 4.93815 0.244
NP_443062.1_6 Forward -127 -108 12.0942 0.0996
NP_443062.1_6 Forward -215 -196 7.27595 0.171
NP_441410.1_3 Forward -216 -197 6.78429 0.23
NP_440911.1_6 Reverse -185 -199 25.5656 0.0204
NP_442204.1_1 Reverse -194 -205 9.89177 0.0736
NP_442204.1_1 Forward -211 -200 1.82863 0.266
NP_442204.1_6 Forward -286 -267 15.5357 0.1
NP_440516.1_8 Forward -207 -198 16.9127 0.00442
NP_440516.1_8 Reverse -198 -207 16.9127 0.00442
NP_440516.1_8 Forward -119 -110 9.4395 0.0183
NP_440516.1_8 Reverse -110 -119 7.17789 0.0754
NP_442428.1_5 Forward -206 -199 15.8704 0.0124
NP_442428.1_5 Reverse -199 -206 15.8704 0.0124
NP_442428.1_5 Forward -118 -111 15.8704 0.0124
NP_442428.1_5 Reverse -111 -118 15.8704 0.0124
NP_442428.1_8 Forward -287 -268 -2.26216 0.289
NP_442120.1_10 Forward -100 -81 -11.1119 0.262
NP_442120.1_10 Reverse -286 -305 -15.3402 0.294
NP_442823.1_9 Forward -80 -61 13.711 0.277
NP_440673.1_2 Reverse -100 -119 14.3892 0.0986
NP_440673.1_3 Forward -117 -110 14.0021 0.0426
NP_440673.1_3 Forward -205 -198 12.4288 0.0426
NP_440673.1_3 Reverse -200 -207 12.4288 0.0426
NP_440673.1_3 Reverse -112 -119 12.4288 0.0426
NP_440673.1_7 Reverse -99 -118 9.3409 0.115
NP_440673.1_7 Reverse -187 -206 0.196116 0.272
NP_440077.1_2 Reverse -203 -221 18.8979 0.175
NP_441052.1_2 Reverse -198 -208 19.9412 0.00106
NP_441052.1_2 Reverse -110 -120 11.4848 0.0285
NP_441052.1_2 Forward -207 -197 10.4031 0.0285
NP_441052.1_2 Forward -119 -109 0.57002 0.256
NP_442219.1_9 Reverse -199 -208 17.7976 0.00718
NP_442219.1_9 Reverse -111 -120 17.7976 0.00718
NP_442219.1_9 Forward -118 -109 8.94785 0.0681
NP_442219.1_9 Forward -206 -197 8.25953 0.0681
NP_440436.1_4 Reverse -199 -208 17.2072 0.00233
NP_440436.1_4 Reverse -111 -120 17.2072 0.00233
NP_440436.1_4 Forward -118 -109 14.6506 0.0111
NP_440436.1_4 Forward -206 -197 9.24241 0.0871
NP_441884.1_8 Forward -288 -269 -8.35868 0.262
NP_441884.1_9 Reverse -107 -126 -16.9135 0.138
NP_441884.1_9 Forward -122 -103 -22.2233 0.277
NP_440041.1_6 Forward -68 -49 12.6833 0.285
NP_441719.1_4 Forward -206 -199 16.3621 0.0124
NP_441719.1_4 Reverse -199 -206 16.3621 0.0124
NP_441719.1_4 Forward -118 -111 16.3621 0.0124
NP_441719.1_4 Reverse -111 -118 16.3621 0.0124
NP_441733.1_10 Forward -122 -109 6.60746 0.179
NP_441733.1_10 Reverse -107 -120 5.42749 0.217
NP_441004.1_1 Forward -289 -270 -14.1602 0.265
NP_441004.1_1 Forward -286 -267 -17.3068 0.29
NP_442813.1_2 Forward -104 -85 2.55606 0.25
NP_442366.1_3 Forward -208 -190 4.24738 0.1
NP_442366.1_5 Forward -122 -112 15.4175 0.0374
NP_441115.1_4 Forward -208 -190 7.98318 0.266
NP_442206.1_10 Reverse -198 -213 4.01147 0.179
NP_442854.1_6 Reverse -198 -217 11.6025 0.178
NP_443054.1_2 Forward -209 -195 0.982901 0.251
NP_441851.1_7 Forward -297 -278 5.30933 0.292
NP_441851.1_10 Forward -120 -110 16.9913 0.00552
NP_441851.1_10 Forward -208 -198 15.8113 0.00552
NP_441851.1_10 Reverse -197 -207 8.53483 0.114
NP_441851.1_10 Reverse -109 -119 8.23984 0.12
NP_442622.1_1 Forward -120 -101 -11.8986 0.257
NP_441668.1_4 Forward -129 -110 7.37428 0.151
NP_441668.1_4 Forward -217 -198 1.27776 0.218
NP_442515.1_1 Forward -120 -106 16.1259 0.0227
NP_442515.1_1 Reverse -109 -123 3.53951 0.117
NP_442515.1_1 Forward -208 -194 -5.01529 0.298
NP_441396.1_5 Forward -282 -273 8.25953 0.224
NP_440463.1_7 Forward -30 -16 14.5526 0.296
NP_442709.1_3 Forward -214 -195 5.30933 0.208
NP_440940.1_7 Forward -217 -199 6.60656 0.224
NP_441349.1_10 Forward -217 -198 2.94938 0.0715
NP_441409.1_6 Reverse -192 -211 -8.35868 0.167
NP_441394.1_1 Forward -290 -276 16.0275 0.271
NP_441394.1_2 Reverse -276 -295 14.5524 0.265
NP_440432.1_9 Forward -118 -103 15.6145 0.0125
NP_440432.1_9 Forward -206 -191 3.81481 0.0824
NP_440432.1_9 Reverse -111 -126 -1.98672 0.167
NP_440432.1_9 Reverse -199 -214 -4.64166 0.216
NP_442843.1_1 Reverse -111 -130 -2.0655 0.202
NP_442843.1_1 Forward -276 -257 -7.08038 0.245
NP_439960.1_10 Forward -287 -269 -2.0458 0.248
NP_440396.1_10 Reverse -111 -127 10.5792 0.228
NP_440431.1_3 Reverse -356 -375 -11.2103 0.284
NP_440431.1_3 Reverse -109 -128 -12.0953 0.296
NP_442450.1_5 Reverse -196 -206 9.41981 0.115
NP_442450.1_5 Forward -121 -111 7.55152 0.13
NP_440483.1_2 Reverse -105 -124 11.7992 0.286
NP_441570.1_1 Forward -207 -189 -0.0791831 0.0433
NP_441570.1_1 Reverse -198 -216 -7.65067 0.0925
NP_441078.1_4 Forward -207 -198 19.6659 0.0007
NP_441078.1_4 Reverse -198 -207 19.6659 0.0007
NP_441078.1_4 Reverse -110 -119 9.93116 0.0203
NP_441078.1_4 Forward -119 -110 9.83282 0.0226
NP_442729.1_8 Reverse -106 -119 16.7355 0.059
NP_440526.1_3 Reverse -199 -210 8.02298 0.126
NP_440526.1_3 Forward -118 -107 2.12315 0.267
NP_440526.1_3 Forward -206 -195 1.82816 0.267
NP_440526.1_3 Reverse -111 -122 1.04151 0.267
NP_441432.1_8 Reverse -197 -206 16.8143 0.00595
NP_441432.1_8 Forward -208 -199 16.8143 0.00595
NP_441432.1_8 Forward -120 -111 16.8143 0.00595
NP_441333.1_1 Forward -170 -160 13.4965 0.217
NP_442320.1_8 Reverse -192 -206 4.42448 0.0504
NP_442320.1_8 Reverse -104 -118 -3.54032 0.124
NP_442320.1_8 Forward -125 -111 -4.81863 0.188
NP_441732.1_2 Reverse -194 -210 2.8118 0.0159
NP_442447.1_1 Reverse -53 -72 4.03102 0.281
NP_440760.1_1 Forward -119 -100 -13.3736 0.102
NP_440760.1_1 Reverse -110 -129 -15.4385 0.147
NP_440760.1_1 Forward -207 -188 -22.2233 0.252
NP_440760.1_1 Reverse -198 -217 -22.3217 0.253
NP_440199.1_10 Reverse -195 -205 14.238 0.0861
NP_442146.1_8 Reverse -77 -96 15.0441 0.269
NP_441057.1_3 Forward -57 -38 -13.1769 0.269
NP_442353.1_4 Reverse -192 -211 1.27698 0.251
NP_440913.1_1 Forward -209 -191 18.8987 0.0951
NP_440913.1_1 Forward -121 -103 3.85406 0.288
NP_442727.1_1 Forward -287 -273 15.1426 0.22
NP_441072.1_2 Forward -218 -199 5.70265 0.296
NP_442489.1_7 Forward -207 -198 20.1576 0.000695
NP_442489.1_7 Reverse -198 -207 20.1576 0.000695
NP_442489.1_7 Reverse -110 -119 10.4228 0.0151
NP_442489.1_7 Forward -119 -110 10.3245 0.0193
NP_442079.1_7 Forward -118 -99 12.1925 0.0873
NP_440559.1_1 Forward -118 -109 17.4043 0.00658
NP_440559.1_1 Reverse -199 -208 17.4043 0.00658
NP_440559.1_1 Reverse -111 -120 17.4043 0.00658
NP_440559.1_1 Forward -206 -197 8.65285 0.0586
NP_441659.2_8 Forward -207 -197 20.9245 0.000805
NP_441659.2_8 Reverse -198 -208 18.1713 0.00133
NP_441659.2_8 Reverse -110 -120 15.9097 0.00467
NP_441659.2_8 Forward -119 -109 9.7148 0.0271
NP_441659.2_8 Reverse -268 -278 0.471689 0.264
NP_442913.1_10 Reverse -189 -208 10.6192 0.0421
NP_441040.1_2 Forward -78 -59 -4.32711 0.164
NP_439956.1_7 Forward -224 -205 2.16274 0.276
NP_440779.1_5 Forward -119 -102 -13.8258 0.229
NP_442346.1_5 Forward -208 -198 16.6963 0.00248
NP_442346.1_5 Reverse -197 -207 16.303 0.00248
NP_442346.1_5 Forward -120 -110 16.2046 0.00277
NP_442346.1_5 Reverse -109 -119 15.8113 0.0045
NP_440545.1_3 Forward -211 -194 6.13536 0.0568
NP_440545.1_3 Reverse -194 -211 -3.00942 0.197
NP_441856.1_7 Forward -286 -267 15.3391 0.192
NP_440025.1_1 Forward -211 -192 5.50599 0.293
NP_441710.1_9 Forward -214 -195 13.0766 0.177
NP_440010.1_6 Reverse -99 -118 4.22769 0.236
NP_442603.1_7 Forward -119 -105 14.4536 0.0655
NP_442603.1_7 Reverse -198 -212 6.88214 0.226
NP_441585.1_5 Reverse -43 -62 -1.37794 0.298
NP_441888.1_7 Forward -212 -198 3.53951 0.225
NP_440449.1_6 Reverse -190 -208 4.36531 0.297
NP_440170.1_6 Reverse -204 -223 12.2908 0.283
NP_441833.1_4 Forward -206 -199 15.9687 0.0124
NP_441833.1_4 Reverse -199 -206 15.9687 0.0124
NP_441833.1_4 Forward -118 -111 15.9687 0.0124
NP_441833.1_4 Reverse -111 -118 15.9687 0.0124
NP_441329.1_6 Reverse -327 -346 1.76618 0.231
NP_442162.1_9 Forward -206 -199 16.2637 0.0124
NP_442162.1_9 Reverse -199 -206 16.2637 0.0124
NP_442162.1_9 Forward -118 -111 16.2637 0.0124
NP_442162.1_9 Reverse -111 -118 16.2637 0.0124
NP_440671.1_4 Reverse -192 -206 15.4376 0.0442
NP_440671.1_4 Forward -213 -199 7.76774 0.208
NP_442199.1_7 Reverse -361 -380 8.06178 0.15
NP_442140.1_3 Forward -118 -108 14.533 0.0486
NP_442140.1_3 Reverse -111 -121 12.2714 0.0632
NP_442140.1_3 Reverse -199 -209 10.3048 0.0902
NP_442140.1_3 Reverse -15 -25 5.19158 0.221
NP_440875.1_9 Reverse -200 -210 8.37203 0.233
NP_440875.1_9 Forward -205 -195 7.59334 0.255
NP_440875.1_9 Reverse -252 -262 7.20399 0.277
NP_441813.1_5 Forward -209 -199 18.1713 0.00743
NP_441813.1_5 Reverse -196 -206 15.9097 0.01
NP_441813.1_5 Forward -121 -111 8.63316 0.0367
NP_441813.1_5 Reverse -108 -118 8.1415 0.0478
NP_440594.1_8 Forward -118 -105 12.7034 0.152
NP_440152.1_3 Forward -239 -220 21.1406 0.0339
NP_441259.1_3 Reverse -273 -292 10.2259 0.251
NP_440590.1_4 Forward -206 -193 4.05085 0.0642
NP_440590.1_4 Reverse -111 -124 0.805932 0.143
NP_440590.1_4 Reverse -199 -212 -4.11062 0.258
NP_440567.1_1 Forward -118 -104 15.3392 0.0177
NP_440567.1_1 Forward -206 -192 5.30946 0.104
NP_440567.1_1 Reverse -111 -125 2.35953 0.176
NP_440567.1_1 Reverse -199 -213 0.589577 0.24
NP_442497.1_10 Forward -118 -109 17.9943 0.00813
NP_442497.1_10 Forward -206 -197 17.601 0.00813
NP_442497.1_10 Reverse -199 -208 10.4228 0.0087
NP_442497.1_10 Reverse -111 -120 10.4228 0.0087
NP_440821.1_4 Reverse -196 -206 11.0914 0.0146
NP_440821.1_4 Reverse -108 -118 10.7964 0.0146
NP_440821.1_4 Forward -209 -199 9.41981 0.0286
NP_440821.1_4 Forward -121 -111 9.41981 0.0286
NP_441239.1_9 Reverse -108 -120 12.9203 0.0402
NP_441239.1_9 Reverse -196 -208 12.1337 0.0494
NP_441239.1_9 Forward -209 -197 5.25052 0.223
NP_441892.1_1 Reverse -189 -206 1.61214 0.15
NP_441892.1_1 Reverse -61 -78 -1.63279 0.21
NP_440665.1_1 Forward -292 -273 -15.3402 0.267
NP_440665.1_1 Forward -307 -288 -16.8151 0.293
NP_442044.1_9 Forward -207 -188 10.9142 0.146
NP_442193.1_8 Reverse -195 -214 13.9616 0.211
NP_441508.1_4 Forward -219 -205 13.1895 0.297
NP_441698.1_2 Reverse -361 -380 15.0528 0.291
NP_441017.1_6 Reverse -194 -208 16.1252 0.0771
NP_442629.1_3 Forward -291 -272 1.0811 0.284
NP_441541.1_1 Forward -380 -362 -4.77261 0.285
NP_440212.1_9 Forward -328 -309 10.1721 0.14
NP_440354.1_7 Reverse -104 -122 8.86894 0.232
NP_442138.1_10 Forward -57 -38 -6.78538 0.286
NP_440551.1_5 Reverse -186 -205 9.93088 0.198
NP_440546.1_2 Forward -47 -28 14.0608 0.219
NP_440546.1_4 Forward -119 -109 14.5061 0.0459
NP_440546.1_4 Forward -207 -197 13.5365 0.0459
NP_440546.1_4 Reverse -110 -120 10.8217 0.104
NP_440546.1_4 Reverse -198 -208 10.046 0.109
NP_442041.1_2 Reverse -101 -119 9.36059 0.283
NP_442041.1_5 Forward -270 -251 -1.18052 0.278
NP_440462.1_6 Reverse -196 -206 16.893 0.00853
NP_440462.1_6 Reverse -108 -118 9.7148 0.0429
NP_440462.1_6 Forward -209 -199 9.61647 0.0429
NP_440462.1_6 Forward -121 -111 1.35667 0.294
NP_440868.1_4 Forward -211 -199 15.0836 0.0164
NP_440868.1_4 Forward -123 -111 8.10212 0.0602
NP_440868.1_4 Reverse -194 -206 -0.846001 0.282
NP_441204.1_1 Reverse -39 -58 4.916 0.296
NP_442479.1_9 Reverse -207 -226 -9.44032 0.266
NP_441868.1_2 Forward -81 -62 15.4374 0.158
NP_442402.1_4 Forward -65 -46 -2.36125 0.198
NP_442402.1_4 Reverse -253 -272 -10.2277 0.298
NP_442402.1_10 Forward -345 -335 10.8943 0.275
NP_441084.1_6 Reverse -108 -122 15.4524 0.0869
NP_441084.1_6 Forward -387 -373 12.3498 0.164
NP_441084.1_6 Reverse -328 -342 9.53803 0.278
NP_442039.1_3 Forward -312 -293 17.2074 0.167
NP_442039.1_4 Forward -206 -199 15.1821 0.0124
NP_442039.1_4 Reverse -199 -206 15.1821 0.0124
NP_442039.1_4 Forward -118 -111 15.1821 0.0124
NP_442039.1_4 Reverse -111 -118 15.1821 0.0124
NP_441811.1_1 Forward -120 -101 5.60432 0.28
NP_441811.1_8 Reverse -244 -258 8.84938 0.228
NP_441811.1_8 Reverse -104 -118 5.60446 0.294
NP_442679.1_1 Reverse -72 -91 4.916 0.147
NP_441926.1_3 Forward -207 -191 6.05672 0.17
NP_440825.1_7 Reverse -111 -121 12.9096 0.152
NP_440825.1_7 Forward -118 -108 11.4458 0.239
NP_442696.1_2 Forward -120 -102 16.2438 0.105
NP_442696.1_6 Reverse -70 -89 -13.8652 0.291
NP_442837.1_3 Forward -206 -199 15.7721 0.0124
NP_442837.1_3 Reverse -199 -206 15.7721 0.0124
NP_442837.1_3 Forward -118 -111 15.7721 0.0124
NP_442837.1_3 Reverse -111 -118 15.7721 0.0124
NP_440160.1_3 Reverse -271 -290 9.83173 0.242
NP_440160.1_10 Reverse -57 -76 16.3224 0.244
NP_439994.1_3 Forward -208 -189 10.5847 0.215
NP_442053.1_1 Forward -207 -198 18.3876 0.0007
NP_442053.1_1 Reverse -198 -207 18.3876 0.0007
NP_442053.1_1 Forward -119 -110 9.24284 0.068
NP_442053.1_1 Reverse -110 -119 8.94785 0.07
NP_440505.1_3 Forward -209 -199 18.3679 0.00213
NP_440505.1_3 Reverse -196 -206 15.123 0.014
NP_440505.1_3 Forward -121 -111 9.22315 0.122
NP_441701.1_8 Reverse -97 -115 4.6407 0.271
NP_441959.1_10 Forward -229 -211 11.621 0.228
NP_441252.1_6 Reverse -302 -309 14.3954 0.168
NP_441203.1_1 Forward -206 -187 -3.83545 0.073
NP_441203.1_1 Reverse -199 -218 -20.5517 0.297
NP_442255.1_10 Reverse -62 -81 17.404 0.235
NP_442844.1_5 Forward -93 -74 1.76863 0.263
NP_441408.2_7 Reverse -183 -202 6.29264 0.172
NP_442174.1_9 Forward -392 -373 8.06259 0.234
NP_440914.1_1 Reverse -198 -208 17.5935 0.000537
NP_440914.1_1 Forward -207 -197 16.3248 0.00196
NP_440914.1_1 Reverse -110 -120 16.3248 0.00196
NP_440914.1_1 Reverse -192 -202 6.85846 0.263
NP_441011.1_8 Forward -206 -197 16.6177 0.00602
NP_441011.1_8 Forward -118 -109 15.6344 0.00738
NP_441011.1_8 Reverse -199 -208 8.25953 0.144
NP_441011.1_8 Reverse -111 -120 8.25953 0.144
NP_442533.1_6 Forward -207 -198 17.2076 0.00137
NP_442533.1_6 Reverse -198 -207 17.2076 0.00137
NP_442533.1_6 Forward -119 -110 15.1427 0.00675
NP_442533.1_6 Reverse -110 -119 7.47288 0.0898
NP_442541.1_10 Forward -63 -49 2.16228 0.265
NP_443016.1_1 Forward -125 -106 -2.26216 0.225
NP_441482.1_7 Reverse -192 -206 8.35772 0.0173
NP_441482.1_7 Forward -213 -199 6.6861 0.0269
NP_441482.1_7 Forward -125 -111 -3.147 0.11
NP_439944.1_9 Forward -206 -196 17.6796 0.00347
NP_439944.1_9 Forward -118 -108 15.8113 0.0144
NP_439944.1_9 Reverse -199 -209 10.5014 0.0887
NP_439944.1_9 Reverse -111 -121 10.5014 0.0887
NP_441028.1_6 Forward -344 -334 14.9258 0.158
NP_441028.1_6 Reverse -175 -185 4.7978 0.277
NP_441028.1_6 Forward -56 -46 3.8145 0.281
NP_440116.1_8 Forward -118 -99 0.196116 0.101
NP_440116.1_8 Forward -206 -187 -9.14533 0.268
NP_441527.1_5 Reverse -196 -215 15.9007 0.255
NP_440115.1_6 Forward -210 -200 16.008 0.0325
NP_440115.1_6 Reverse -107 -117 8.73149 0.128
NP_440007.1_9 Reverse -194 -208 12.291 0.163
NP_440007.1_9 Forward -211 -197 5.80112 0.245
NP_439965.1_7 Forward -290 -271 11.4877 0.294
NP_441347.1_5 Forward -213 -199 8.65209 0.284
NP_441059.1_2 Reverse -40 -59 -5.21209 0.249
NP_441059.1_10 Reverse -81 -94 11.819 0.254
NP_443045.1_2 Reverse -104 -123 15.5357 0.223
NP_441602.1_3 Forward -124 -105 -3.93378 0.256
NP_441106.1_1 Reverse -197 -206 18.486 0.0028
NP_441106.1_1 Forward -208 -199 9.63616 0.0311
NP_441106.1_1 Forward -120 -111 9.63616 0.0311
NP_441106.1_1 Reverse -109 -118 8.84951 0.0431
NP_439903.1_6 Reverse -107 -126 4.91521 0.188
NP_439903.1_6 Forward -210 -191 3.63691 0.207
NP_439903.1_6 Reverse -195 -214 -0.197979 0.277
NP_441286.1_1 Forward -120 -108 14.9853 0.00418
NP_441286.1_1 Forward -208 -196 14.3953 0.00424
NP_441286.1_1 Reverse -197 -209 3.48056 0.0467
NP_441286.1_1 Reverse -109 -121 -5.66422 0.213
NP_440670.1_6 Forward -70 -51 12.0942 0.292
NP_440670.1_8 Forward -207 -198 18.3876 0.000699
NP_440670.1_8 Reverse -198 -207 18.3876 0.000699
NP_440670.1_8 Forward -119 -110 8.94785 0.0606
NP_440670.1_8 Reverse -110 -119 8.84951 0.0606
NP_441479.1_9 Reverse -26 -44 12.9988 0.293
NP_440886.1_7 Reverse -197 -207 8.04271 0.0805
NP_440886.1_7 Forward -208 -198 7.94438 0.0805
NP_440886.1_7 Reverse -267 -277 6.37109 0.13
NP_440886.1_7 Reverse -273 -283 4.99446 0.205
NP_442614.1_2 Forward -119 -105 9.14437 0.242
NP_442614.1_2 Reverse -198 -212 7.9644 0.257
NP_442382.1_7 Reverse -185 -204 4.81767 0.252
NP_442382.1_8 Forward -292 -273 15.4932 0.292
NP_442072.1_9 Forward -208 -190 4.6407 0.0208
NP_442072.1_9 Reverse -197 -215 -12.8622 0.0926
NP_440907.2_8 Forward -118 -108 16.5975 0.0115
NP_440907.2_8 Forward -206 -196 9.51767 0.103
NP_440907.2_8 Reverse -111 -121 7.64939 0.117
NP_442264.1_2 Reverse -124 -141 6.52869 0.254
NP_442264.1_5 Reverse -381 -395 13.9626 0.232
NP_439967.1_7 Forward -219 -201 9.65558 0.243
NP_441021.1_1 Reverse -199 -218 -6.09707 0.177
NP_440326.1_5 Forward -209 -196 16.1456 0.179
NP_441463.1_6 Reverse -196 -210 10.088 0.242
NP_442842.1_4 Forward -206 -187 0.982764 0.299
NP_442842.1_6 Reverse -80 -99 20.1573 0.0279
NP_441626.1_2 Forward -206 -199 15.7721 0.0124
NP_441626.1_2 Reverse -199 -206 15.7721 0.0124
NP_441626.1_2 Forward -118 -111 15.7721 0.0124
NP_441626.1_2 Reverse -111 -118 15.7721 0.0124
NP_442365.1_7 Reverse -194 -213 0.687771 0.177
NP_442238.1_3 Reverse -287 -306 4.916 0.263
NP_442794.1_1 Forward -211 -199 10.2654 0.0721
NP_442794.1_1 Forward -123 -111 9.28209 0.0795
NP_442615.1_1 Reverse -101 -119 0.609134 0.0999
NP_442615.1_1 Forward -128 -110 -4.8974 0.197
NP_442467.1_10 Reverse -268 -287 18.9773 0.233
NP_441962.1_4 Reverse -105 -124 -4.6221 0.158
NP_440387.1_1 Reverse -198 -214 12.6449 0.0112
NP_440387.1_1 Forward -207 -191 6.25339 0.0282
NP_440387.1_1 Reverse -110 -126 2.12349 0.0871
NP_441431.1_2 Reverse -107 -121 10.6187 0.158
NP_441836.1_2 Reverse -104 -123 -4.13045 0.254
NP_441993.1_1 Forward -207 -188 3.11618 0.241
NP_441993.1_1 Reverse -192 -211 3.11618 0.241
NP_441174.1_4 Reverse -334 -344 17.9746 0.184
NP_440814.1_4 Forward -128 -109 -9.83364 0.221
NP_440114.1_10 Forward -207 -193 10.9143 0.13
NP_440114.1_10 Forward -119 -105 10.4227 0.148
NP_442698.1_10 Forward -281 -262 -1.08219 0.297
NP_442323.1_7 Forward -212 -193 5.50519 0.203
NP_440293.1_3 Forward -127 -108 -5.50708 0.279
NP_440766.1_4 Reverse -194 -208 7.27608 0.0952
NP_441237.1_9 Reverse -111 -121 14.828 0.0242
NP_442930.1_1 Reverse -368 -378 13.1559 0.239
NP_439910.1_2 Reverse -190 -207 -13.7275 0.162
NP_440457.1_1 Forward -211 -199 10.1671 0.092
NP_440457.1_1 Reverse -194 -206 7.11881 0.105
NP_441981.1_8 Forward -129 -115 14.1593 0.261
NP_441984.1_3 Reverse -181 -199 7.09898 0.256
NP_440473.1_3 Forward -306 -287 14.3558 0.287
NP_442509.1_9 Reverse -198 -208 8.14104 0.192
NP_442509.1_9 Forward -207 -197 8.04271 0.192
NP_442509.1_9 Forward -119 -109 8.04271 0.192
NP_441489.1_3 Reverse -361 -375 12.3301 0.198
NP_440554.1_4 Forward -206 -196 16.1063 0.0189
NP_440554.1_4 Reverse -199 -209 8.92815 0.0646
NP_440554.1_4 Forward -118 -108 8.33817 0.0773
NP_442862.1_3 Forward -84 -67 9.47861 0.219
NP_441885.1_5 Reverse -198 -208 20.9245 0.000538
NP_441885.1_5 Forward -207 -197 11.3864 0.00668
NP_441885.1_5 Reverse -110 -120 11.1898 0.00775
NP_441885.1_5 Forward -119 -109 10.1081 0.0145
NP_442310.1_8 Forward -275 -256 19.3707 0.0725
NP_442341.1_7 Forward -208 -194 10.521 0.0625
NP_442341.1_7 Forward -120 -106 4.81781 0.177
NP_442341.1_7 Reverse -109 -123 1.67122 0.282
NP_442341.1_9 Reverse -196 -210 9.93039 0.142
NP_442341.1_9 Forward -209 -195 8.25877 0.174
NP_441173.1_9 Forward -311 -303 12.1137 0.21
NP_441173.1_9 Reverse -362 -370 12.1137 0.21
NP_441173.1_9 Forward -343 -335 12.0154 0.214
NP_443000.1_7 Forward -209 -199 19.9412 0.00223
NP_443000.1_7 Reverse -196 -206 17.4829 0.00719
NP_443000.1_7 Forward -121 -111 10.3048 0.0345
NP_443000.1_7 Reverse -108 -118 1.455 0.247
NP_441842.1_10 Reverse -103 -117 11.3077 0.134
NP_440275.1_3 Forward -209 -199 15.123 0.0182
NP_440275.1_3 Reverse -108 -118 10.9931 0.0397
NP_440275.1_3 Reverse -196 -206 9.12481 0.055
NP_440275.1_3 Forward -121 -111 8.04317 0.0602
NP_440091.1_1 Forward -211 -199 1.41561 0.197
NP_440091.1_1 Reverse -194 -206 1.41561 0.197
NP_442354.1_2 Forward -31 -12 2.16274 0.299
NP_443010.1_10 Reverse -195 -212 11.0813 0.117
NP_442451.1_2 Forward -127 -108 -6.88371 0.232
NP_439962.1_4 Reverse -102 -121 -7.4737 0.289
NP_439962.1_4 Reverse -93 -112 -8.65367 0.298
NP_440880.1_2 Reverse -308 -327 18.8592 0.124
NP_440149.1_8 Reverse -110 -129 5.70265 0.0745
NP_440149.1_8 Forward -207 -188 -1.27885 0.157
NP_440149.1_8 Forward -119 -100 -2.0655 0.164
NP_441105.1_3 Forward -212 -193 -8.85033 0.279
NP_441105.1_3 Forward -300 -281 -9.24366 0.286
NP_440216.1_1 Reverse -198 -212 8.55439 0.00592
NP_440216.1_1 Forward -207 -193 7.9644 0.00737
NP_440216.1_1 Forward -119 -105 -2.55701 0.0521
NP_440216.1_1 Forward -218 -204 -12.3901 0.264
NP_440172.1_1 Forward -119 -109 18.5646 0.00421
NP_440172.1_1 Forward -207 -197 17.5813 0.00421
NP_440172.1_1 Reverse -198 -208 15.0247 0.00945
NP_440172.1_1 Reverse -110 -120 5.28991 0.146
NP_442015.1_10 Forward -211 -198 11.4257 0.0372
NP_442015.1_10 Reverse -194 -207 2.67422 0.187
NP_441226.1_7 Forward -206 -199 14.4934 0.0123
NP_441226.1_7 Reverse -199 -206 14.4934 0.0123
NP_441226.1_7 Forward -118 -111 14.4934 0.0123
NP_441226.1_7 Reverse -111 -118 14.4934 0.0123
NP_440198.1_3 Reverse -259 -278 13.0766 0.297
NP_441111.1_7 Forward -206 -198 18.7023 0.00294
NP_441111.1_7 Reverse -199 -207 18.7023 0.00294
NP_441111.1_7 Reverse -111 -119 18.7023 0.00294
NP_441111.1_7 Forward -118 -110 8.86921 0.0589
NP_442379.1_10 Forward -214 -197 8.20031 0.102
NP_442379.1_10 Reverse -191 -208 -2.12444 0.224
NP_441766.1_2 Forward -119 -110 17.896 0.00297
NP_441766.1_2 Forward -207 -198 17.5026 0.00297
NP_441766.1_2 Reverse -198 -207 17.5026 0.00297
NP_441766.1_2 Reverse -110 -119 9.4395 0.0285
NP_442417.1_5 Forward -207 -193 9.04604 0.138
NP_442417.1_5 Reverse -70 -84 5.1128 0.275
NP_440416.1_9 Reverse -191 -210 -15.5368 0.193
NP_443052.1_9 Reverse -270 -289 -0.197208 0.207
NP_442116.1_6 Reverse -368 -385 9.88781 0.227
NP_442116.1_6 Forward -375 -358 7.21404 0.262
NP_442154.1_1 Forward -285 -267 -13.6489 0.217
NP_442154.1_1 Forward -288 -270 -17.6804 0.262
NP_440261.1_5 Forward -118 -105 8.37742 0.0263
NP_440261.1_5 Reverse -199 -212 -2.73398 0.0924
NP_440261.1_5 Reverse -111 -124 -10.3055 0.201
NP_440261.1_5 Forward -206 -193 -10.6005 0.201
NP_440988.1_10 Reverse -196 -210 5.4797 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCTACGTCAAACCCAAACCATTGTTAATATTTTGGAAAATGATCTATTAACTTCCATTTCTCCCCATAGTTTGTATAAGCAATTAATTATTTTGCCCAACCACATTGCTGTGCCCCTCTTGGTGGCGGTGGGAGAAACAGATGGCATCATTGACACCAGTTTATTTAATGGTTGGCAACGCTGGAAAAAGCCTGGCGATCGCCTTTGGTTATGTCCTGAAGGAAAATACTTTTTTCAGTTTGAGCATCCAGAGATAACCGCATTTCAACTACAACAATTTTGGCGATCGCTCCAAGGGCAGGAAGCCTCTTCTTCCACTTCTTTGCTGGCTTAGGTTGGCCCAGTTTAGCCCCGGTTTGCTCTATTCTCTTGGTTGCAACCAACGCAGAGACTATAAAAT

CDS

GTGAGTTGCCGACGGTTGTCAACTTCAGGAGTATTGTCCATGTCCGTCCAAAACCTGAGCAAACAAGATGTAGCTGCACTCACTGCCGAGGATGTGGCCCAATTGGCCCAACGGCTGGAAAACGATGATTACACCGATGCTTTTGAAGGGCTGAGGGATTGGCATCTCCTACGGGCGATCGCCTTTCAGCGGGAAGACTTGGCGGAACCCTATCTTTACCTGCTGGATAATGAGACCTATGACGAAGCTTAA

Protein

MSCRRLSTSGVLSMSVQNLSKQDVAALTAEDVAQLAQRLENDDYTDAFEGLRDWHLLRAIAFQREDLAEPYLYLLDNETYDEA