Your browser is old and dusty. Try Google Chrome!

Details for ssl0453

ORF ssl0453
Accession NP_441274.1
Symbol nblA2
Category Phycobilisome
Definition phycobilisome degradation protein NblA
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -212 -198 1.37622 0.191
NP_442761.1_5 Forward -169 -150 12.1925 0.0933
NP_440795.1_7 Forward -9 -2 14.6904 0.0123
NP_440795.1_7 Reverse -2 -9 14.6904 0.0123
NP_440795.1_7 Reverse -205 -212 10.2655 0.154
NP_441418.1_6 Reverse -1 -20 -20.5517 0.117
NP_441418.1_6 Forward -301 -282 -29.4015 0.224
NP_441480.1_8 Reverse -197 -216 21.0423 0.173
NP_440897.1_6 Reverse -1 -20 4.32522 0.14
NP_441453.1_4 Reverse -1 -9 16.539 0.00633
NP_441453.1_4 Forward -10 -2 7.8859 0.0536
NP_442151.1_6 Reverse -204 -218 7.86607 0.188
NP_441818.1_1 Reverse -2 -13 16.971 0.0111
NP_441818.1_9 Reverse -192 -211 -2.75381 0.209
NP_443002.1_5 Forward -218 -200 9.94979 0.27
NP_442173.1_1 Forward -9 -1 15.4574 0.00633
NP_442173.1_1 Reverse -2 -10 14.1791 0.0165
NP_001035873.1_6 Reverse -178 -197 19.764 0.281
NP_442752.1_4 Reverse -1 -8 13.8055 0.0199
NP_442752.1_4 Reverse -104 -111 9.47889 0.109
NP_443027.1_4 Forward -12 -2 8.33817 0.207
NP_439997.1_5 Forward -38 -19 12.8489 0.293
NP_440784.1_7 Forward -9 -2 15.9687 0.0123
NP_440784.1_7 Reverse -2 -9 15.9687 0.0123
NP_442909.1_2 Forward -210 -191 15.2408 0.17
NP_441934.1_9 Forward -221 -202 12.7825 0.256
NP_440061.1_9 Forward -119 -105 6.48882 0.244
NP_442062.1_8 Reverse -1 -11 16.9913 0.00317
NP_440761.1_4 Forward -306 -287 -13.7669 0.257
NP_441802.1_1 Reverse -11 -30 6.98095 0.257
NP_440304.1_4 Forward -12 -2 9.12481 0.0626
NP_440304.1_4 Reverse -290 -300 5.68323 0.196
NP_440304.1_4 Forward -287 -277 4.69992 0.252
NP_442242.1_4 Forward -9 -2 14.3954 0.0124
NP_442242.1_4 Reverse -2 -9 14.3954 0.0124
NP_440044.1_8 Reverse -2 -21 2.85105 0.143
NP_442207.1_5 Forward -198 -179 13.4708 0.212
NP_440011.1_1 Reverse -89 -108 12.0942 0.265
NP_441619.1_8 Reverse -198 -212 8.75042 0.237
NP_441208.1_9 Reverse -274 -288 8.65272 0.219
NP_441594.1_6 Reverse -283 -302 5.211 0.209
NP_442196.1_4 Forward -285 -266 19.6656 0.0856
NP_442375.1_5 Forward -210 -196 12.192 0.289
NP_441925.1_4 Forward -114 -95 -13.6693 0.258
NP_441083.1_5 Reverse -1 -11 9.61647 0.0243
NP_441738.1_2 Forward -8 -1 15.28 0.0102
NP_441738.1_2 Reverse -3 -10 11.5435 0.084
NP_440209.1_1 Reverse -1 -9 18.1123 0.00295
NP_440209.1_1 Forward -10 -2 8.47588 0.0457
NP_442136.1_1 Forward -341 -322 8.94757 0.226
NP_442889.1_1 Reverse -176 -195 -14.0619 0.271
NP_442889.1_8 Reverse -23 -37 4.42388 0.267
NP_440056.1_5 Forward -224 -205 18.6823 0.231
NP_442570.1_3 Reverse -179 -198 -5.99873 0.253
NP_441716.1_1 Reverse -1 -15 10.816 0.0936
NP_441624.1_9 Reverse -194 -212 17.6204 0.104
NP_440906.1_5 Forward -9 -2 15.8704 0.0124
NP_440906.1_5 Reverse -2 -9 15.8704 0.0124
NP_440747.1_10 Forward -13 -1 -11.7607 0.142
NP_442145.1_4 Forward -351 -332 15.4215 0.0898
NP_442634.1_4 Forward -303 -289 -4.03198 0.179
NP_441265.1_3 Forward -16 -2 -0.688726 0.292
NP_441639.1_3 Reverse -203 -222 3.04771 0.264
NP_441014.1_10 Forward -399 -380 0.195343 0.245
NP_441014.1_10 Forward -34 -15 -2.06626 0.27
NP_442848.1_1 Forward -16 -2 3.44117 0.133
NP_442848.1_5 Forward -213 -195 1.29745 0.276
NP_442848.1_9 Forward -294 -275 2.3594 0.252
NP_443018.1_3 Forward -9 -2 14.8871 0.0123
NP_443018.1_3 Reverse -2 -9 14.8871 0.0123
NP_443018.1_3 Reverse -205 -212 4.36568 0.254
NP_443018.1_3 Forward -212 -205 4.07068 0.299
NP_441634.1_8 Reverse -202 -216 5.50613 0.114
NP_441634.1_8 Forward -176 -162 -1.8687 0.295
NP_440376.1_1 Reverse -1 -10 9.73449 0.0365
NP_440376.1_1 Forward -10 -1 9.63616 0.0385
NP_440376.1_1 Reverse -292 -301 4.0313 0.182
NP_442687.1_7 Forward -286 -276 12.3697 0.0768
NP_442687.1_7 Forward -11 -1 8.92815 0.0994
NP_442191.1_4 Forward -300 -286 10.8961 0.283
NP_441846.1_6 Reverse -339 -358 4.42435 0.205
NP_441846.1_10 Reverse -95 -114 -16.7168 0.256
NP_440667.1_2 Reverse -204 -223 -8.94866 0.297
NP_441274.1_1 Forward -349 -330 32.547 0.0000224
NP_441274.1_2 Forward -160 -141 33.137 0.0000405
NP_441274.1_3 Forward -224 -205 28.9088 0.000312
NP_441274.1_4 Forward -200 -181 28.3188 0.000502
NP_441274.1_5 Forward -247 -228 26.5488 0.00103
NP_441274.1_6 Forward -139 -120 26.6471 0.0017
NP_441274.1_7 Forward -52 -33 22.3206 0.0111
NP_441274.1_8 Forward -177 -163 20.7467 0.3
NP_441274.1_9 Forward -296 -277 25.6638 0.00395
NP_441274.1_10 Forward -275 -256 26.5479 0.0061
NP_440360.1_9 Reverse -311 -330 6.39097 0.278
NP_442658.1_1 Forward -12 -2 12.9592 0.0423
NP_441414.1_9 Reverse -1 -20 -6.39206 0.194
NP_440184.1_1 Reverse -323 -342 13.3078 0.0864
NP_441958.1_5 Forward -11 -1 10.6981 0.0112
NP_440984.1_7 Reverse -102 -116 9.04604 0.131
NP_440984.1_7 Forward -218 -204 5.21113 0.265
NP_442690.1_1 Forward -349 -330 -7.67036 0.177
NP_442690.1_1 Forward -338 -319 -17.3068 0.299
NP_442911.1_2 Forward -20 -1 7.57094 0.0243
NP_442911.1_2 Forward -223 -204 -9.93197 0.267
NP_440153.1_5 Reverse -205 -219 1.47456 0.253
NP_440153.1_8 Forward -213 -200 -1.849 0.228
NP_442002.1_9 Reverse -392 -399 12.2322 0.185
NP_441294.1_7 Forward -217 -203 10.1145 0.207
NP_442438.1_10 Forward -15 -1 3.93283 0.154
NP_442431.1_7 Forward -391 -372 12.0942 0.175
NP_442431.1_10 Reverse -192 -210 0.805796 0.266
NP_441473.1_6 Forward -152 -142 17.4963 0.29
NP_441000.1_6 Reverse -250 -264 -3.83532 0.225
NP_441550.1_8 Forward -12 -2 12.1726 0.0361
NP_441916.1_7 Reverse -1 -11 7.55152 0.0639
NP_440345.1_5 Forward -317 -303 16.0528 0.263
NP_440345.1_5 Forward -331 -317 14.8115 0.276
NP_440345.1_5 Forward -47 -33 14.716 0.276
NP_440465.1_10 Forward -216 -197 -0.885524 0.29
NP_441041.1_4 Reverse -126 -145 -4.52377 0.138
NP_441041.1_4 Forward -301 -282 -7.76869 0.192
NP_441041.1_4 Reverse -198 -217 -7.76869 0.192
NP_441547.1_2 Forward -21 -3 5.82068 0.215
NP_442004.1_6 Reverse -1 -15 1.96621 0.276
NP_441725.1_5 Reverse -2 -12 19.7446 0.0112
NP_441725.1_5 Reverse -277 -287 0.373358 0.182
NP_439966.1_7 Forward -12 -2 6.56775 0.177
NP_442941.1_3 Reverse -2 -12 1.94665 0.147
NP_440260.1_8 Reverse -179 -197 -5.68405 0.276
NP_441556.1_7 Reverse -276 -295 -1.47628 0.3
NP_440375.1_5 Reverse -202 -221 14.2574 0.286
NP_441644.1_6 Reverse -1 -11 13.2542 0.0212
NP_441644.1_6 Reverse -204 -214 12.2709 0.0356
NP_442215.1_2 Forward -60 -44 -4.46469 0.233
NP_442029.1_1 Forward -297 -278 -5.31042 0.192
NP_442029.1_6 Reverse -277 -296 6.39097 0.238
NP_442029.1_6 Reverse -198 -217 2.75272 0.289
NP_442029.1_10 Forward -399 -380 5.211 0.287
NP_440929.1_8 Forward -10 -1 17.4043 0.00289
NP_440929.1_8 Reverse -1 -10 17.4043 0.00289
NP_442933.1_10 Reverse -1 -10 9.04618 0.063
NP_442933.1_10 Forward -10 -1 8.94785 0.0643
NP_441751.2_8 Reverse -2 -16 -2.65535 0.133
NP_442554.1_8 Reverse -2 -12 11.4848 0.0355
NP_442554.1_8 Reverse -205 -215 5.28991 0.153
NP_442554.1_8 Forward -212 -202 4.69992 0.176
NP_442292.1_1 Reverse -2 -11 8.94785 0.0261
NP_442292.1_1 Forward -212 -203 5.99792 0.125
NP_443009.1_5 Forward -191 -180 3.69644 0.282
NP_441448.1_6 Forward -209 -190 23.4013 0.0305
NP_441198.1_8 Forward -12 -2 11.6111 0.193
NP_441468.1_1 Forward -9 -2 15.8704 0.0124
NP_441468.1_1 Reverse -2 -9 15.8704 0.0124
NP_441468.1_1 Reverse -205 -212 4.46401 0.224
NP_441673.1_1 Reverse -1 -10 11.1111 0.0121
NP_441673.1_1 Forward -10 -1 11.0128 0.018
NP_441673.1_1 Reverse -204 -213 -8.06341 0.254
NP_441876.1_9 Forward -396 -386 10.206 0.299
NP_441826.1_2 Forward -16 -2 -1.08205 0.234
NP_441826.1_5 Forward -114 -95 0.58944 0.3
NP_441764.1_1 Reverse -323 -342 24.8772 0.00582
NP_441764.1_4 Reverse -321 -338 19.2443 0.0453
NP_442868.1_6 Forward -12 -2 0.275027 0.243
NP_442719.1_2 Reverse -267 -285 -4.50479 0.212
NP_442719.1_2 Reverse -162 -180 -8.33968 0.247
NP_442677.1_3 Reverse -67 -86 -7.08038 0.287
NP_442227.1_2 Forward -211 -192 5.211 0.202
NP_440789.1_1 Forward -340 -321 18.8781 0.0644
NP_442808.1_1 Forward -105 -95 3.51951 0.238
NP_442808.1_1 Forward -114 -104 2.92952 0.252
NP_442718.1_1 Forward -285 -266 11.0125 0.146
NP_442050.1_5 Forward -12 -2 15.2208 0.0133
NP_440601.1_8 Forward -392 -373 19.3015 0.111
NP_440558.1_2 Reverse -104 -123 -3.14714 0.234
NP_440162.1_2 Forward -29 -10 6.4893 0.282
NP_440923.1_1 Forward -341 -323 28.7309 0.0000164
NP_441878.1_6 Forward -11 -1 10.4031 0.0176
NP_441878.1_6 Reverse -203 -213 -7.19813 0.21
NP_441036.1_8 Forward -11 -1 7.45319 0.197
NP_441534.1_7 Reverse -61 -80 12.6841 0.233
NP_441557.1_5 Forward -10 -1 17.4043 0.0023
NP_441557.1_5 Reverse -1 -10 10.8161 0.00464
NP_441445.1_1 Forward -294 -275 0.392778 0.275
NP_442066.2_4 Reverse -181 -200 -8.26035 0.294
NP_442183.1_1 Reverse -1 -15 11.0127 0.0775
NP_442183.1_9 Reverse -201 -211 17.2863 0.206
NP_442166.1_7 Forward -300 -286 9.5377 0.19
NP_441574.1_1 Reverse -204 -223 -6.68705 0.277
NP_441549.1_9 Reverse -200 -218 -10.1089 0.269
NP_440861.1_2 Reverse -40 -59 12.4199 0.27
NP_442170.1_5 Reverse -1 -20 -1.37718 0.254
NP_442645.1_2 Reverse -180 -199 -18.6834 0.278
NP_441037.1_4 Forward -12 -2 8.58464 0.237
NP_442594.1_8 Reverse -192 -211 5.01433 0.254
NP_441633.1_3 Forward -37 -24 0.510939 0.122
NP_441633.1_3 Forward -262 -249 -2.43899 0.177
NP_440136.1_2 Forward -9 -2 15.9687 0.0123
NP_440136.1_2 Reverse -2 -9 15.9687 0.0123
NP_441728.2_4 Reverse -319 -338 12.6523 0.271
NP_442998.1_10 Forward -8 -1 15.5754 0.0102
NP_442998.1_10 Reverse -3 -10 5.84064 0.235
NP_440299.1_1 Forward -14 -1 11.5234 0.0484
NP_440299.1_6 Forward -181 -162 5.40766 0.281
NP_440640.1_8 Forward -107 -88 15.0441 0.239
NP_441007.1_10 Reverse -199 -212 6.90245 0.153
NP_441435.1_6 Forward -212 -193 3.73603 0.259
NP_440256.1_1 Reverse -191 -210 -10.227 0.297
NP_441957.1_7 Reverse -172 -191 15.3391 0.232
NP_440709.1_1 Forward -342 -323 11.0117 0.055
NP_440709.1_2 Forward -337 -323 23.5 0.000895
NP_441559.1_8 Reverse -177 -191 -6.09693 0.274
NP_441559.1_8 Reverse -287 -301 -6.88358 0.281
NP_442158.1_4 Forward -21 -11 10.7964 0.283
NP_441179.1_5 Forward -220 -201 13.5691 0.262
NP_440164.1_2 Reverse -319 -338 11.5042 0.102
NP_441464.1_8 Reverse -1 -15 8.94771 0.192
NP_440702.1_2 Reverse -192 -211 -7.27704 0.269
NP_440702.1_2 Forward -303 -284 -8.06369 0.286
NP_440026.1_1 Forward -132 -113 11.2092 0.262
NP_442150.1_8 Forward -67 -48 16.0415 0.265
NP_440306.1_8 Reverse -270 -289 -1.67294 0.236
NP_442386.1_9 Forward -11 -2 5.11253 0.266
NP_442386.1_10 Reverse -97 -110 5.42749 0.262
NP_441340.1_5 Forward -9 -2 15.6737 0.0124
NP_441340.1_5 Reverse -2 -9 15.6737 0.0124
NP_441340.1_5 Forward -212 -205 3.97235 0.274
NP_442240.1_1 Reverse -186 -205 6.58682 0.256
NP_441160.1_5 Reverse -193 -212 -4.81876 0.288
NP_440586.1_8 Forward -9 -2 13.2151 0.026
NP_440586.1_8 Reverse -2 -9 13.2151 0.026
NP_442251.1_6 Forward -9 -2 15.2804 0.0124
NP_442251.1_6 Reverse -2 -9 15.2804 0.0124
NP_440684.1_9 Reverse -198 -212 10.6193 0.194
NP_441262.1_3 Forward -10 -3 14.8871 0.0223
NP_441262.1_3 Reverse -1 -8 14.7888 0.0223
NP_441262.1_3 Reverse -251 -258 5.15232 0.265
NP_440027.1_3 Reverse -99 -117 1.78836 0.295
NP_443051.1_1 Forward -11 -2 16.0277 0.00754
NP_441232.1_10 Reverse -98 -117 4.62101 0.193
NP_441167.1_1 Reverse -36 -55 4.03102 0.27
NP_442239.1_8 Reverse -194 -213 9.3409 0.249
NP_440372.1_2 Forward -9 -2 16.3621 0.0124
NP_440372.1_2 Reverse -2 -9 16.3621 0.0124
NP_441789.1_7 Forward -114 -95 -0.984623 0.251
NP_441572.1_7 Forward -395 -376 0.58944 0.164
NP_440267.1_2 Forward -15 -1 6.58715 0.228
NP_442384.1_10 Reverse -1 -14 8.86907 0.0606
NP_441018.1_3 Reverse -187 -206 9.7334 0.291
NP_442262.1_10 Forward -9 -2 14.1988 0.0123
NP_442262.1_10 Reverse -2 -9 14.1988 0.0123
NP_442262.1_10 Reverse -252 -259 9.38056 0.202
NP_440282.1_10 Forward -223 -204 -7.17871 0.251
NP_442123.1_3 Reverse -1 -20 10.4225 0.291
NP_440487.1_1 Forward -207 -188 -7.08038 0.277
NP_441965.1_3 Forward -20 -1 -0.39387 0.259
NP_440297.1_9 Reverse -2 -12 19.3512 0.0359
NP_440297.1_9 Reverse -277 -287 4.79825 0.22
NP_440297.1_9 Forward -185 -175 0.0783647 0.282
NP_440297.1_9 Reverse -222 -232 -0.118297 0.282
NP_441896.1_1 Forward -340 -321 17.2065 0.0563
NP_440999.1_9 Forward -217 -203 -0.787057 0.217
NP_440237.1_5 Forward -354 -340 13.372 0.197
NP_441949.1_5 Reverse -321 -340 16.7536 0.115
NP_440575.1_1 Reverse -61 -80 -3.44288 0.294
NP_442077.1_9 Forward -353 -334 -6.39206 0.289
NP_441543.1_2 Forward -212 -203 5.11294 0.209
NP_442845.1_2 Reverse -198 -212 5.99778 0.219
NP_441469.1_8 Forward -11 -2 13.7661 0.0719
NP_442337.1_8 Forward -296 -277 -1.67217 0.288
NP_442337.1_8 Reverse -187 -206 -2.0655 0.293
NP_442578.1_7 Forward -9 -2 14.5921 0.026
NP_442578.1_7 Reverse -2 -9 14.5921 0.026
NP_442578.1_7 Reverse -27 -34 9.97054 0.112
NP_440071.1_1 Forward -214 -197 19.9992 0.149
NP_440071.1_1 Forward -204 -187 10.4612 0.253
NP_441462.1_2 Reverse -1 -11 11.2881 0.00441
NP_441462.1_2 Reverse -292 -302 -0.806614 0.254
NP_443062.1_6 Reverse -190 -209 0.491109 0.294
NP_441560.1_8 Reverse -271 -290 12.2918 0.255
NP_442487.1_5 Forward -302 -283 4.81688 0.234
NP_440516.1_8 Reverse -1 -10 9.53783 0.0136
NP_440516.1_8 Forward -10 -1 7.07956 0.0867
NP_442428.1_5 Forward -9 -2 15.8704 0.0124
NP_442428.1_5 Reverse -2 -9 15.8704 0.0124
NP_442428.1_5 Reverse -205 -212 4.759 0.223
NP_442120.1_10 Reverse -204 -223 -1.57384 0.171
NP_440673.1_3 Forward -8 -1 12.4288 0.0426
NP_440673.1_3 Reverse -3 -10 5.34899 0.298
NP_441052.1_2 Reverse -1 -11 0.668351 0.256
NP_440436.1_4 Reverse -2 -11 6.78414 0.147
NP_440436.1_4 Forward -212 -203 4.7192 0.244
NP_440041.1_2 Forward -303 -284 -4.22878 0.293
NP_441719.1_4 Forward -9 -2 16.3621 0.0124
NP_441719.1_4 Reverse -2 -9 16.3621 0.0124
NP_441719.1_4 Reverse -252 -259 3.77569 0.285
NP_440658.1_5 Forward -217 -198 11.9958 0.265
NP_441851.1_10 Forward -11 -1 15.9097 0.00552
NP_441851.1_10 Reverse -203 -213 4.69992 0.254
NP_441668.1_4 Reverse -194 -213 1.76941 0.211
NP_441668.1_4 Reverse -16 -35 -1.08219 0.267
NP_442515.1_1 Forward -286 -272 -2.26202 0.271
NP_441982.1_6 Reverse -12 -21 12.7718 0.274
NP_442689.1_8 Forward -335 -318 -4.58271 0.267
NP_442689.1_8 Forward -50 -33 -6.15601 0.28
NP_442689.1_8 Forward -344 -327 -7.82764 0.292
NP_441349.1_10 Reverse -194 -213 0.58944 0.0878
NP_441349.1_10 Forward -20 -1 -6.29373 0.226
NP_442024.1_8 Reverse -307 -317 15.418 0.254
NP_440432.1_9 Forward -34 -19 -4.15 0.198
NP_442843.1_1 Reverse -189 -208 -6.58872 0.245
NP_440474.1_8 Reverse -205 -219 14.4536 0.0624
NP_440474.1_8 Reverse -2 -16 6.58715 0.222
NP_440431.1_4 Reverse -326 -345 -8.45146 0.275
NP_442450.1_5 Forward -12 -2 10.5014 0.115
NP_442168.1_5 Forward -217 -198 0.0977854 0.258
NP_441031.1_1 Reverse -328 -347 6.91914 0.259
NP_441003.1_9 Forward -398 -379 4.52268 0.277
NP_441570.1_1 Forward -301 -283 -2.43913 0.0656
NP_441570.1_1 Reverse -1 -19 -7.06068 0.0841
NP_441078.1_4 Reverse -1 -10 9.93116 0.0203
NP_441078.1_4 Forward -10 -1 9.83282 0.0226
NP_441078.1_4 Reverse -204 -213 -1.77023 0.266
NP_442388.1_2 Forward -50 -31 21.0414 0.0567
NP_440539.1_9 Forward -115 -96 -4.81876 0.286
NP_441528.1_2 Reverse -194 -213 8.55343 0.275
NP_440707.1_9 Forward -185 -166 1.17943 0.292
NP_442443.1_1 Reverse -111 -130 -6.49039 0.294
NP_441432.1_8 Reverse -203 -212 4.81794 0.196
NP_440497.1_2 Reverse -196 -215 3.53937 0.295
NP_440629.1_1 Reverse -324 -342 16.3421 0.0502
NP_440131.1_2 Forward -219 -200 10.3242 0.279
NP_441057.1_4 Reverse -194 -212 9.75391 0.141
NP_443011.1_4 Reverse -188 -207 6.58763 0.277
NP_441023.1_1 Forward -113 -95 11.5239 0.238
NP_442400.1_10 Reverse -330 -343 9.61097 0.271
NP_440713.1_4 Reverse -282 -301 1.27776 0.289
NP_442489.1_7 Reverse -1 -10 10.4228 0.0151
NP_442489.1_7 Forward -10 -1 10.3245 0.0193
NP_442489.1_7 Reverse -204 -213 -1.27858 0.185
NP_442489.1_7 Reverse -292 -301 -1.6719 0.235
NP_440559.1_1 Reverse -2 -11 16.421 0.01
NP_441659.2_8 Reverse -1 -11 16.008 0.0042
NP_441659.2_8 Forward -213 -203 3.61828 0.154
NP_440860.1_8 Reverse -268 -287 14.5524 0.296
NP_441022.1_1 Reverse -32 -41 12.6973 0.232
NP_441022.1_1 Reverse -338 -347 10.8747 0.284
NP_442913.1_10 Forward -222 -203 -1.7705 0.176
NP_442913.1_10 Forward -44 -25 -2.16383 0.182
NP_442008.1_2 Reverse -180 -199 10.9142 0.133
NP_441800.1_7 Forward -212 -194 1.69077 0.204
NP_441800.1_7 Forward -218 -200 -2.43913 0.263
NP_440779.1_5 Reverse -1 -18 -6.35267 0.177
NP_440779.1_5 Forward -260 -243 -6.64766 0.197
NP_442346.1_5 Forward -11 -1 8.53483 0.133
NP_442346.1_5 Reverse -203 -213 5.19158 0.256
NP_440545.1_3 Forward -217 -200 0.628827 0.135
NP_440545.1_3 Reverse -200 -217 -5.56602 0.253
NP_441856.1_3 Forward -288 -269 0.196116 0.216
NP_441629.1_3 Forward -220 -201 -0.39464 0.244
NP_440250.1_4 Forward -348 -329 5.40686 0.253
NP_440010.1_10 Reverse -110 -129 1.76941 0.293
NP_442311.1_5 Forward -129 -110 0.786102 0.27
NP_441833.1_4 Forward -9 -2 15.9687 0.0124
NP_441833.1_4 Reverse -2 -9 15.9687 0.0124
NP_441329.1_1 Forward -386 -367 4.82192 0.281
NP_441895.1_10 Reverse -36 -55 -18.9784 0.282
NP_442162.1_9 Forward -9 -2 16.2637 0.0124
NP_442162.1_9 Reverse -2 -9 16.2637 0.0124
NP_440772.1_7 Reverse -192 -211 17.699 0.168
NP_442140.1_3 Reverse -2 -12 6.66654 0.159
NP_441813.1_5 Forward -12 -2 15.3197 0.0113
NP_441813.1_5 Forward -262 -252 -0.806614 0.285
NP_441813.1_7 Forward -207 -193 13.9619 0.197
NP_440567.1_1 Reverse -2 -16 8.45605 0.0577
NP_442497.1_10 Reverse -2 -11 17.9943 0.00813
NP_440821.1_4 Forward -12 -2 19.2529 0.00399
NP_440821.1_4 Reverse -249 -259 -0.314959 0.251
NP_441239.1_9 Forward -215 -203 5.93884 0.202
NP_440604.1_6 Reverse -1 -20 6.88262 0.107
NP_441508.1_1 Reverse -324 -343 16.3242 0.101
NP_441508.1_1 Forward -348 -329 11.9992 0.236
NP_442643.1_1 Forward -307 -288 -11.7019 0.231
NP_442138.1_10 Forward -301 -282 -4.52377 0.256
NP_441230.1_5 Reverse -150 -169 0.884433 0.258
NP_440868.1_4 Forward -14 -2 1.02229 0.193
NP_441474.1_1 Forward -114 -95 4.81688 0.218
NP_440696.1_6 Reverse -193 -212 11.3075 0.207
NP_440696.1_9 Reverse -180 -199 14.0599 0.296
NP_442039.1_4 Forward -9 -2 15.1821 0.0124
NP_442039.1_4 Reverse -2 -9 15.1821 0.0124
NP_442837.1_3 Forward -9 -2 15.7721 0.0124
NP_442837.1_3 Reverse -2 -9 15.7721 0.0124
NP_440160.1_1 Reverse -319 -338 9.385 0.266
NP_440160.1_3 Forward -210 -191 12.1917 0.209
NP_442053.1_1 Reverse -1 -10 9.34117 0.0666
NP_442053.1_1 Forward -10 -1 8.84951 0.072
NP_441959.1_8 Forward -333 -320 9.48054 0.286
NP_441252.1_6 Forward -385 -378 14.3954 0.168
NP_442532.1_7 Reverse -204 -218 2.35953 0.245
NP_440914.1_1 Reverse -1 -11 6.27291 0.288
NP_441011.1_8 Reverse -2 -11 6.68623 0.184
NP_442533.1_1 Forward -304 -285 -16.2252 0.263
NP_442533.1_6 Reverse -1 -10 7.86621 0.0862
NP_442533.1_6 Forward -10 -1 7.37455 0.0898
NP_442533.1_6 Reverse -204 -213 4.22796 0.186
NP_441482.1_7 Forward -16 -2 -11.3085 0.254
NP_439944.1_9 Reverse -2 -12 15.123 0.0244
NP_442203.1_3 Forward -76 -57 7.08711 0.257
NP_441028.1_6 Forward -397 -387 13.5492 0.158
NP_441028.1_6 Reverse -281 -291 3.8145 0.281
NP_441527.1_4 Forward -84 -65 -5.39572 0.201
NP_441527.1_4 Reverse -327 -346 -7.11457 0.23
NP_440115.1_6 Reverse -390 -400 5.38824 0.25
NP_441961.1_4 Reverse -207 -226 2.45773 0.295
NP_441602.1_3 Reverse -176 -195 1.27776 0.215
NP_441106.1_3 Forward -342 -323 18.584 0.0578
NP_441106.1_9 Forward -348 -338 15.6147 0.286
NP_442588.1_1 Forward -120 -101 6.78429 0.259
NP_441286.1_1 Forward -36 -24 -6.2542 0.254
NP_440670.1_8 Reverse -1 -10 16.3227 0.00291
NP_440670.1_8 Forward -10 -1 15.1427 0.00768
NP_440886.1_7 Forward -208 -198 4.01116 0.255
NP_442614.1_2 Reverse -1 -15 9.43936 0.242
NP_442213.1_5 Reverse -187 -206 1.37609 0.25
NP_439899.1_1 Reverse -320 -338 6.91275 0.205
NP_442800.1_7 Reverse -193 -212 2.94938 0.279
NP_440907.2_8 Reverse -2 -12 7.94438 0.117
NP_442264.1_2 Reverse -272 -289 7.41366 0.24
NP_440841.1_4 Reverse -241 -260 -7.37537 0.229
NP_441463.1_2 Forward -345 -327 3.92672 0.197
NP_441463.1_3 Forward -20 -1 1.76941 0.124
NP_441463.1_3 Forward -223 -204 -10.6203 0.299
NP_441626.1_2 Forward -9 -2 15.7721 0.0124
NP_441626.1_2 Reverse -2 -9 15.7721 0.0124
NP_442365.1_5 Forward -212 -193 9.43923 0.207
NP_440387.1_1 Reverse -1 -17 -2.20308 0.147
NP_441431.1_2 Forward -216 -202 5.80051 0.288
NP_441993.1_1 Reverse -100 -119 2.72635 0.254
NP_442805.1_1 Forward -348 -331 8.10198 0.22
NP_440114.1_10 Reverse -1 -15 12.9793 0.0681
NP_441425.1_3 Reverse -19 -29 16.7946 0.273
NP_442087.1_7 Forward -358 -339 2.85027 0.186
NP_440766.1_5 Forward -78 -66 6.70087 0.294
NP_439988.1_7 Reverse -3 -17 12.2903 0.292
NP_439988.1_7 Forward -138 -124 11.9953 0.292
NP_440278.1_2 Reverse -308 -327 14.3558 0.156
NP_439910.1_2 Forward -309 -292 -22.5773 0.267
NP_442867.1_8 Forward -205 -186 9.24257 0.227
NP_440457.1_1 Forward -14 -2 18.4269 0.0403
NP_440798.1_6 Reverse -2 -15 4.14919 0.147
NP_440798.1_6 Reverse -205 -218 0.510939 0.259
NP_441984.1_4 Reverse -198 -212 12.1926 0.289
NP_440473.1_9 Reverse -193 -212 -5.40875 0.216
NP_442509.1_9 Reverse -1 -11 13.6475 0.0475
NP_440554.1_4 Reverse -2 -12 8.23984 0.0804
NP_440554.1_4 Reverse -252 -262 4.79825 0.175
NP_441885.1_5 Reverse -1 -11 2.24165 0.0822
NP_441275.1_1 Forward -341 -323 29.7151 0.00037
NP_441275.1_6 Forward -290 -277 20.5705 0.156
NP_441428.1_7 Forward -337 -318 12.0942 0.123
NP_442703.1_9 Reverse -325 -343 11.3272 0.244
NP_441756.1_5 Forward -117 -98 3.44104 0.199
NP_440552.1_8 Forward -338 -321 9.69683 0.292
NP_441842.1_10 Forward -17 -3 8.25939 0.23
NP_440275.1_3 Forward -12 -2 10.1081 0.0449
NP_440275.1_3 Forward -215 -205 7.94484 0.0641
NP_440091.1_1 Forward -14 -2 8.10212 0.0696
NP_440679.1_5 Forward -210 -191 6.09597 0.292
NP_439962.1_4 Forward -117 -98 -7.96535 0.292
NP_440804.1_4 Forward -73 -64 16.716 0.145
NP_441875.1_7 Forward -384 -374 16.2046 0.227
NP_441105.1_3 Forward -224 -205 -5.99873 0.227
NP_440216.1_1 Reverse -1 -15 -1.8687 0.0412
NP_440216.1_1 Forward -164 -150 -5.70361 0.135
NP_440172.1_1 Reverse -1 -11 9.7148 0.0586
NP_440172.1_1 Reverse -292 -302 2.14332 0.283
NP_442015.1_10 Forward -14 -1 12.704 0.0365
NP_441226.1_7 Forward -9 -2 14.4934 0.0123
NP_441226.1_7 Reverse -2 -9 14.4934 0.0123
NP_441111.1_7 Forward -9 -1 18.7023 0.00294
NP_441111.1_7 Reverse -2 -10 8.96754 0.0463
NP_441111.1_7 Forward -212 -204 -0.668896 0.274
NP_441766.1_2 Forward -10 -1 16.2243 0.0047
NP_441766.1_2 Reverse -1 -10 9.14451 0.0337
NP_443052.1_8 Forward -20 -1 -0.787193 0.0736
NP_442116.1_6 Forward -333 -316 7.50051 0.254
NP_442154.1_1 Reverse -196 -214 -6.86402 0.141
NP_442226.1_8 Reverse -69 -79 15.8113 0.167
NP_440261.1_5 Reverse -2 -15 -12.1738 0.272
NP_440261.1_7 Forward -390 -371 -5.70374 0.241
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTTGCCCCCCGTTTTGGGCAAGCTTGTATAAGCAGATACTGTTAATTGGGTCAACTTTTTGTTACATTTATTTACAATTGATTGTTTACAATTGAAAGGTAGTCGCCTTGGAGGGCAACAGCTATGAAACCTGAATCCTTCGATCTCACCATTGAACAAATGTTTGAGTTCCGTCGCATGCAGGATGCCACCGCCAACATCAGCCAGGAGCAAGCCCTGGAACTTTTGGTCCAAGCCTCTCGACTGTTGATGATTAAATCCAACGTCATCCGGGACTTAATGCGCCAGGCTCCCCTGGAGCCCCTAGGTTAAGCACAGGCAGGCAAAAAAATTAGCTTGCTGTCTTAGCCATTAGTTACAATTTTTGACCGCCCCATTTTTTCAGGAGTGCGATCGCC

CDS

ATGATCAACAACGAAGCCTTTAACCTATCCTTAGAGCAGAAATTTCAACTGCAGTGTTTGCAACAGGAATATCAAGAACTAGACCGGGAGCAGACCGTTAACTATTTACTAGAAACCATGCAACAAATCATGGTGCGGGATAACCTGATCCGGGATTTGATGAAAAATTCACTCCTCCCCTAG

Protein

MINNEAFNLSLEQKFQLQCLQQEYQELDREQTVNYLLETMQQIMVRDNLIRDLMKNSLLP