Your browser is old and dusty. Try Google Chrome!

Details for ssl0452

ORF ssl0452
Accession NP_441275.1
Symbol nblA1
Category Phycobilisome
Definition phycobilisome degradation protein NblA
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -265 -279 -0.000409212 0.219
NP_440795.1_7 Forward -272 -265 14.6904 0.0123
NP_440795.1_7 Reverse -265 -272 14.6904 0.0123
NP_441418.1_6 Reverse -264 -283 0.58944 0.00871
NP_441418.1_6 Forward -26 -7 -29.4015 0.224
NP_441418.1_6 Forward -273 -254 -29.9915 0.249
NP_440815.1_5 Forward -273 -254 3.6377 0.286
NP_442291.1_5 Forward -274 -258 -0.826444 0.189
NP_440897.1_6 Reverse -264 -283 0.392004 0.18
NP_441453.1_1 Forward -280 -262 13.3914 0.0938
NP_441453.1_4 Reverse -264 -272 16.539 0.00633
NP_441453.1_4 Forward -273 -265 16.539 0.00633
NP_441453.1_7 Forward -139 -132 14.1988 0.175
NP_442151.1_6 Forward -273 -259 10.6193 0.119
NP_442151.1_6 Reverse -264 -278 9.83269 0.139
NP_440226.1_1 Forward -273 -254 11.5042 0.0529
NP_440226.1_1 Reverse -291 -310 2.26107 0.271
NP_440259.1_4 Forward -235 -221 9.0215 0.281
NP_440120.1_4 Reverse -134 -148 15.3392 0.273
NP_442623.1_3 Reverse -265 -284 -9.83364 0.154
NP_440150.1_6 Reverse -261 -280 3.14605 0.254
NP_442655.1_1 Forward -278 -259 -0.885524 0.255
NP_442655.1_10 Reverse -261 -280 -18.5851 0.272
NP_442173.1_1 Forward -272 -264 15.4574 0.00633
NP_442173.1_1 Reverse -265 -273 15.4574 0.00633
NP_442752.1_4 Forward -273 -266 13.8055 0.0199
NP_442752.1_4 Reverse -264 -271 13.8055 0.0199
NP_443027.1_4 Forward -275 -265 5.87989 0.294
NP_442975.1_10 Forward -277 -263 11.7987 0.0482
NP_440784.1_7 Forward -272 -265 15.9687 0.0123
NP_440784.1_7 Reverse -265 -272 15.9687 0.0123
NP_440061.1_9 Forward -275 -261 9.93039 0.134
NP_441476.1_5 Forward -278 -259 -6.49039 0.274
NP_440878.1_9 Forward -283 -264 11.6025 0.0939
NP_440878.1_9 Reverse -254 -273 6.4893 0.174
NP_442062.1_8 Reverse -264 -274 19.4496 0.000558
NP_442062.1_8 Forward -273 -263 17.3846 0.00193
NP_440761.1_4 Forward -31 -12 -13.7669 0.257
NP_441859.1_3 Reverse -263 -282 2.35861 0.262
NP_440304.1_4 Reverse -15 -25 5.68323 0.196
NP_440304.1_4 Forward -12 -2 4.69992 0.252
NP_440304.1_4 Forward -275 -265 1.84832 0.299
NP_440304.1_4 Reverse -262 -272 1.84832 0.299
NP_442242.1_4 Forward -272 -265 14.3954 0.0124
NP_442242.1_4 Reverse -265 -272 14.3954 0.0124
NP_441208.1_9 Reverse -261 -275 7.37441 0.222
NP_441594.1_6 Reverse -8 -27 5.211 0.209
NP_442110.1_7 Forward -273 -259 0.786239 0.248
NP_440856.1_4 Reverse -257 -276 -1.7705 0.203
NP_440856.1_7 Reverse -261 -280 -4.13045 0.211
NP_441083.1_5 Forward -273 -263 20.3345 0.00053
NP_441083.1_5 Reverse -264 -274 11.3864 0.0159
NP_441738.1_2 Forward -271 -264 15.28 0.0102
NP_441738.1_2 Reverse -266 -273 15.28 0.0102
NP_440209.1_1 Reverse -264 -272 18.1123 0.00295
NP_440209.1_1 Forward -273 -265 18.1123 0.00295
NP_442136.1_1 Forward -66 -47 8.94757 0.226
NP_442889.1_8 Forward -276 -262 12.9786 0.0599
NP_441713.1_1 Forward -279 -260 -6.29373 0.118
NP_441713.1_1 Reverse -258 -277 -16.1268 0.277
NP_441716.1_1 Forward -273 -259 4.32615 0.256
NP_441716.1_1 Reverse -264 -278 3.93283 0.259
NP_442111.1_4 Reverse -263 -277 19.6658 0.00373
NP_441163.1_1 Forward -281 -264 5.83964 0.267
NP_440906.1_5 Forward -272 -265 15.8704 0.0124
NP_440906.1_5 Reverse -265 -272 15.8704 0.0124
NP_441209.1_4 Forward -224 -205 10.9134 0.279
NP_440747.1_10 Reverse -261 -273 24.7201 0.00036
NP_440747.1_10 Forward -276 -264 15.1819 0.00196
NP_440747.1_10 Forward -318 -306 -11.7607 0.142
NP_441847.1_3 Reverse -139 -157 23.5203 0.0149
NP_441486.1_1 Forward -276 -262 14.1593 0.00654
NP_441486.1_1 Reverse -261 -275 13.8643 0.00743
NP_442145.1_4 Forward -76 -57 15.4215 0.0898
NP_442145.1_4 Forward -379 -360 6.44528 0.216
NP_442145.1_4 Forward -395 -376 4.24897 0.283
NP_442634.1_4 Forward -28 -14 -4.03198 0.179
NP_441265.1_3 Forward -279 -265 4.32615 0.181
NP_441265.1_3 Reverse -258 -272 3.14618 0.181
NP_440403.1_4 Reverse -169 -188 -7.86702 0.248
NP_440842.1_3 Reverse -271 -290 14.1591 0.126
NP_441014.1_10 Forward -124 -105 0.195343 0.245
NP_443018.1_3 Forward -272 -265 14.8871 0.0123
NP_443018.1_3 Reverse -265 -272 14.8871 0.0123
NP_441634.1_8 Reverse -262 -276 -3.04867 0.295
NP_440376.1_1 Forward -273 -264 19.4693 0.000692
NP_440376.1_1 Reverse -264 -273 19.4693 0.000692
NP_440376.1_1 Reverse -17 -26 4.0313 0.182
NP_440376.1_1 Reverse -178 -187 2.94966 0.213
NP_440376.1_1 Forward -315 -306 -1.27858 0.297
NP_441588.1_4 Forward -271 -261 9.02648 0.14
NP_441588.1_4 Reverse -266 -276 7.35486 0.178
NP_442687.1_7 Forward -274 -264 15.8113 0.0125
NP_442687.1_7 Forward -11 -1 12.3697 0.0768
NP_442687.1_7 Reverse -263 -273 8.92815 0.0994
NP_442191.1_4 Reverse -265 -279 11.7688 0.244
NP_442191.1_4 Forward -25 -11 10.8961 0.283
NP_441846.1_6 Reverse -64 -83 4.42435 0.205
NP_441846.1_10 Reverse -267 -286 -22.5183 0.261
NP_441846.1_10 Reverse -264 -283 -22.8133 0.266
NP_442530.1_2 Forward -374 -364 11.0914 0.284
NP_440642.1_10 Forward -141 -127 11.307 0.149
NP_441950.1_7 Forward -132 -113 -8.85033 0.287
NP_441274.1_1 Forward -74 -55 32.547 0.0000224
NP_441274.1_9 Forward -21 -2 25.6638 0.00395
NP_442296.1_9 Forward -272 -253 -0.688862 0.197
NP_440360.1_9 Reverse -36 -55 6.39097 0.278
NP_442658.1_1 Forward -275 -265 15.9091 0.00966
NP_442658.1_1 Reverse -262 -272 6.76441 0.214
NP_441855.2_4 Forward -281 -262 18.6817 0.0307
NP_442782.1_7 Reverse -256 -275 5.60432 0.193
NP_441414.1_6 Reverse -162 -181 -4.72043 0.262
NP_441414.1_9 Forward -273 -254 -3.54046 0.138
NP_441414.1_9 Forward -315 -296 -4.91709 0.164
NP_441414.1_9 Reverse -264 -283 -10.3253 0.28
NP_440184.1_1 Reverse -48 -67 13.3078 0.0864
NP_442321.1_4 Reverse -242 -261 -7.17871 0.284
NP_441958.1_5 Forward -274 -264 12.2714 0.00183
NP_441958.1_5 Reverse -263 -273 12.2714 0.00183
NP_440203.1_5 Forward -270 -260 10.5993 0.218
NP_440984.1_7 Reverse -259 -273 9.43936 0.127
NP_439990.1_5 Forward -278 -265 11.3273 0.128
NP_442690.1_1 Forward -74 -55 -7.67036 0.177
NP_442690.1_1 Reverse -362 -381 -16.4218 0.289
NP_442690.1_1 Forward -63 -44 -17.3068 0.299
NP_442911.1_2 Reverse -254 -273 6.19431 0.03
NP_442911.1_2 Forward -283 -264 0.196116 0.069
NP_442064.1_1 Forward -278 -259 -13.3736 0.285
NP_440062.1_6 Reverse -263 -282 2.75272 0.258
NP_441099.1_5 Forward -283 -264 -0.983855 0.101
NP_442002.1_9 Reverse -117 -124 12.2322 0.185
NP_442002.1_9 Forward -274 -267 10.7572 0.185
NP_441654.1_6 Reverse -140 -158 13.3709 0.296
NP_441294.1_7 Forward -277 -263 10.8824 0.167
NP_442438.1_10 Reverse -259 -273 11.996 0.0412
NP_442438.1_10 Forward -278 -264 2.85119 0.168
NP_442431.1_7 Forward -116 -97 12.0942 0.175
NP_442885.1_1 Forward -287 -268 8.35759 0.282
NP_441000.1_6 Forward -274 -260 -4.91696 0.254
NP_440147.1_4 Forward -275 -262 12.704 0.0326
NP_440147.1_4 Reverse -262 -275 10.1474 0.0355
NP_440147.1_4 Reverse -304 -317 6.60746 0.0881
NP_441550.1_8 Reverse -262 -272 14.6309 0.0132
NP_441550.1_8 Forward -275 -265 8.3377 0.124
NP_441916.1_7 Reverse -264 -274 18.4663 0.00144
NP_441916.1_7 Forward -273 -263 10.3048 0.0261
NP_440345.1_5 Forward -42 -28 16.0528 0.263
NP_440345.1_5 Forward -56 -42 14.8115 0.276
NP_441041.1_1 Reverse -267 -286 6.58763 0.267
NP_441041.1_4 Reverse -264 -283 8.75091 0.0331
NP_441041.1_4 Forward -26 -7 -7.76869 0.192
NP_441041.1_4 Forward -266 -247 -13.9635 0.299
NP_441041.1_7 Forward -276 -264 15.6777 0.0222
NP_441041.1_7 Reverse -261 -273 8.58373 0.133
NP_442396.1_5 Reverse -260 -273 10.639 0.106
NP_440569.1_7 Forward -204 -185 11.7992 0.286
NP_441568.1_6 Reverse -348 -366 10.8881 0.295
NP_442004.1_6 Forward -273 -259 5.40779 0.191
NP_441725.1_5 Forward -272 -262 2.04498 0.115
NP_441725.1_5 Reverse -265 -275 2.04498 0.115
NP_441725.1_5 Reverse -2 -12 0.373358 0.182
NP_439966.1_7 Forward -275 -265 9.91099 0.0968
NP_439966.1_7 Reverse -262 -272 7.25606 0.15
NP_439966.1_9 Forward -275 -266 0.884706 0.253
NP_442941.1_3 Forward -272 -262 11.0914 0.0116
NP_442941.1_3 Reverse -265 -275 2.63497 0.14
NP_440289.1_2 Forward -276 -263 3.06754 0.0811
NP_442281.1_1 Forward -278 -264 12.3887 0.0379
NP_442281.1_1 Reverse -259 -273 9.6354 0.0684
NP_442012.1_1 Reverse -258 -277 18.1907 0.0354
NP_442012.1_1 Reverse -174 -193 -0.983855 0.272
NP_442288.1_3 Reverse -251 -268 6.92201 0.257
NP_441556.1_7 Reverse -1 -20 -1.47628 0.3
NP_441556.1_10 Forward -278 -264 12.4606 0.195
NP_441556.1_10 Reverse -258 -272 10.3192 0.27
NP_441644.1_6 Forward -273 -263 17.3841 0.00127
NP_441644.1_6 Reverse -264 -274 10.1076 0.0628
NP_442215.1_2 Forward -275 -259 22.773 0.00266
NP_442215.1_2 Reverse -262 -278 8.61333 0.0631
NP_442029.1_1 Forward -22 -3 -5.31042 0.192
NP_442029.1_6 Reverse -259 -278 15.3391 0.0999
NP_442029.1_6 Reverse -2 -21 6.39097 0.238
NP_442029.1_10 Forward -124 -105 5.211 0.287
NP_440253.1_2 Forward -373 -355 0.117479 0.196
NP_440929.1_8 Forward -273 -264 19.2726 0.000701
NP_440929.1_8 Reverse -264 -273 19.2726 0.000701
NP_442933.1_10 Forward -273 -264 17.601 0.00325
NP_442933.1_10 Reverse -264 -273 17.601 0.00325
NP_441751.2_8 Forward -272 -258 -0.0987402 0.125
NP_442554.1_8 Forward -272 -262 15.3197 0.00882
NP_442554.1_8 Reverse -265 -275 13.2547 0.0187
NP_442970.1_3 Reverse -363 -381 12.7721 0.225
NP_441762.1_7 Reverse -263 -275 10.1671 0.0142
NP_441762.1_7 Forward -274 -262 9.57708 0.0142
NP_442142.1_4 Reverse -261 -274 14.7683 0.0302
NP_442142.1_4 Forward -276 -263 13.8833 0.0324
NP_442292.1_1 Forward -272 -263 18.486 0.00229
NP_442292.1_1 Reverse -265 -274 9.63616 0.0183
NP_440919.1_7 Reverse -172 -190 4.9689 0.287
NP_442476.1_6 Forward -272 -258 10.3243 0.0704
NP_440895.1_7 Reverse -259 -277 12.8022 0.108
NP_443009.1_5 Reverse -263 -274 18.3477 0.00265
NP_441715.1_4 Reverse -265 -275 9.41981 0.097
NP_441715.1_4 Forward -272 -262 7.94484 0.107
NP_440464.1_10 Forward -272 -262 13.0082 0.169
NP_441468.1_1 Forward -272 -265 15.8704 0.0124
NP_441468.1_1 Reverse -265 -272 15.8704 0.0124
NP_441020.2_6 Reverse -262 -279 9.47861 0.17
NP_441020.2_6 Reverse -271 -288 8.10198 0.209
NP_441015.1_10 Reverse -274 -293 2.26107 0.151
NP_441015.1_10 Forward -278 -259 -7.17871 0.264
NP_441673.1_1 Forward -273 -264 20.8459 0.000698
NP_441673.1_1 Reverse -264 -273 20.8459 0.000698
NP_441876.1_9 Forward -121 -111 10.206 0.299
NP_441826.1_2 Reverse -258 -272 5.40779 0.0975
NP_441826.1_2 Forward -279 -265 -4.62196 0.298
NP_441330.1_1 Reverse -259 -278 -4.42544 0.0974
NP_441393.1_5 Forward -143 -124 17.5024 0.214
NP_441764.1_1 Reverse -48 -67 24.8772 0.00582
NP_441764.1_4 Reverse -46 -63 19.2443 0.0453
NP_442868.1_6 Reverse -262 -272 9.81313 0.038
NP_442868.1_6 Forward -275 -265 0.865012 0.205
NP_441612.1_2 Forward -273 -263 8.54929 0.21
NP_442227.1_2 Forward -289 -270 -2.55715 0.276
NP_442361.1_3 Forward -279 -266 8.67241 0.285
NP_440789.1_1 Forward -65 -46 18.8781 0.0644
NP_440789.1_8 Reverse -116 -135 15.5357 0.197
NP_442808.1_1 Forward -274 -264 18.4657 0.00201
NP_442808.1_1 Reverse -263 -273 8.63269 0.0481
NP_442808.1_1 Reverse -177 -187 2.73286 0.256
NP_442050.1_5 Reverse -262 -272 7.64939 0.243
NP_440601.1_8 Forward -117 -98 19.3015 0.111
NP_440601.1_10 Reverse -204 -223 9.14423 0.29
NP_440923.1_1 Forward -66 -48 28.7309 0.0000164
NP_441878.1_6 Forward -274 -264 10.4031 0.0176
NP_441878.1_6 Reverse -263 -273 10.4031 0.0176
NP_441036.1_8 Forward -274 -264 17.7779 0.000554
NP_441036.1_8 Reverse -263 -273 8.33817 0.174
NP_441557.1_5 Forward -273 -264 19.9609 0.000699
NP_441557.1_5 Reverse -264 -273 19.9609 0.000699
NP_441445.1_1 Reverse -255 -274 7.7676 0.126
NP_441445.1_1 Forward -282 -263 2.16274 0.24
NP_441445.1_1 Forward -324 -305 0.392778 0.275
NP_440101.1_3 Reverse -259 -278 2.45773 0.256
NP_441458.1_10 Forward -282 -263 7.17762 0.196
NP_440676.1_3 Forward -242 -223 9.0459 0.252
NP_442166.1_7 Reverse -265 -279 16.3225 0.141
NP_442166.1_7 Forward -25 -11 9.5377 0.19
NP_441819.1_4 Forward -370 -351 8.65258 0.228
NP_442347.1_2 Forward -272 -263 12.4878 0.056
NP_442347.1_2 Reverse -265 -274 11.1111 0.056
NP_442645.1_2 Reverse -256 -275 -3.54046 0.0488
NP_441037.1_4 Forward -275 -265 14.7245 0.028
NP_441037.1_4 Reverse -262 -272 7.9999 0.237
NP_441633.1_3 Reverse -262 -275 8.57408 0.0377
NP_441633.1_3 Forward -275 -262 3.46087 0.0699
NP_440136.1_2 Forward -272 -265 15.9687 0.0123
NP_440136.1_2 Reverse -265 -272 15.9687 0.0123
NP_441728.2_4 Reverse -44 -63 12.6523 0.271
NP_442998.1_5 Reverse -116 -126 7.94484 0.278
NP_442998.1_10 Forward -271 -264 15.5754 0.0102
NP_442998.1_10 Reverse -266 -273 15.5754 0.0102
NP_440299.1_1 Forward -277 -264 20.1765 0.00128
NP_440299.1_1 Reverse -260 -273 18.6032 0.00369
NP_441799.1_1 Reverse -260 -274 19.2718 0.00667
NP_441799.1_1 Forward -277 -263 7.57046 0.138
NP_441007.1_10 Reverse -259 -272 -0.570702 0.287
NP_440256.1_1 Reverse -261 -280 1.57275 0.0733
NP_440256.1_1 Forward -276 -257 -9.83364 0.289
NP_442526.1_5 Reverse -371 -389 13.883 0.275
NP_440709.1_1 Forward -67 -48 11.0117 0.055
NP_440709.1_2 Forward -62 -48 23.5 0.000895
NP_441559.1_8 Forward -278 -264 11.8976 0.0574
NP_441559.1_8 Reverse -12 -26 -6.88358 0.281
NP_441559.1_8 Forward -182 -168 -7.47356 0.294
NP_440915.1_3 Reverse -271 -290 13.0775 0.214
NP_440915.1_6 Forward -277 -263 5.60446 0.088
NP_440915.1_6 Reverse -260 -274 0.982901 0.148
NP_442158.1_4 Forward -142 -132 13.7464 0.212
NP_440164.1_2 Reverse -44 -63 11.5042 0.102
NP_441704.1_8 Forward -284 -265 8.75009 0.202
NP_440702.1_2 Forward -28 -9 -8.06369 0.286
NP_442150.1_8 Forward -167 -148 18.0273 0.215
NP_440677.1_1 Forward -282 -263 16.5191 0.1
NP_440677.1_1 Forward -257 -238 11.3075 0.163
NP_442386.1_9 Forward -274 -265 15.7322 0.0144
NP_442386.1_9 Reverse -263 -272 13.8639 0.0289
NP_441340.1_5 Forward -272 -265 15.6737 0.0124
NP_441340.1_5 Reverse -265 -272 15.6737 0.0124
NP_442484.1_2 Forward -284 -265 6.4893 0.156
NP_442484.1_2 Reverse -253 -272 6.29264 0.156
NP_442484.1_2 Reverse -196 -215 -1.37718 0.288
NP_440168.1_2 Reverse -304 -323 -3.93378 0.276
NP_440586.1_8 Forward -272 -265 13.2151 0.026
NP_440586.1_8 Reverse -265 -272 13.2151 0.026
NP_442251.1_6 Forward -272 -265 15.2804 0.0124
NP_442251.1_6 Reverse -265 -272 15.2804 0.0124
NP_442959.1_5 Reverse -286 -305 10.0292 0.224
NP_441262.1_3 Reverse -264 -271 14.7888 0.0223
NP_441262.1_3 Forward -273 -266 14.7888 0.0223
NP_440027.1_8 Forward -276 -257 4.91521 0.285
NP_443051.1_1 Reverse -263 -272 10.4228 0.00754
NP_443051.1_1 Forward -274 -265 10.4228 0.00754
NP_439937.1_9 Forward -274 -257 -6.84499 0.157
NP_441740.2_10 Reverse -258 -277 7.47261 0.286
NP_440408.1_7 Forward -273 -254 10.8159 0.24
NP_440439.1_1 Forward -276 -263 1.39592 0.156
NP_440439.1_1 Reverse -261 -274 0.314277 0.194
NP_440372.1_2 Forward -272 -265 16.3621 0.0124
NP_440372.1_2 Reverse -265 -272 16.3621 0.0124
NP_441181.1_6 Reverse -265 -283 12.9988 0.185
NP_441181.1_6 Forward -326 -308 4.83737 0.239
NP_440819.1_5 Reverse -135 -143 7.68924 0.266
NP_441803.1_2 Reverse -259 -278 5.89931 0.16
NP_441572.1_7 Forward -120 -101 0.58944 0.164
NP_441572.1_7 Reverse -258 -277 -1.18052 0.186
NP_441572.1_7 Forward -279 -260 -1.96717 0.19
NP_442384.1_10 Forward -273 -260 16.4406 0.00838
NP_442384.1_10 Reverse -264 -277 15.7522 0.00946
NP_442384.1_10 Forward -315 -302 2.37923 0.228
NP_442262.1_10 Forward -272 -265 14.1988 0.0123
NP_442262.1_10 Reverse -265 -272 14.1988 0.0123
NP_441689.1_5 Reverse -262 -272 5.78111 0.197
NP_440344.1_10 Forward -280 -263 16.5584 0.00362
NP_440344.1_10 Reverse -257 -274 -9.20427 0.141
NP_440531.1_6 Forward -281 -262 -0.000545616 0.2
NP_440531.1_6 Forward -224 -205 -2.85214 0.258
NP_440531.1_6 Reverse -256 -275 -4.42544 0.28
NP_442910.1_1 Reverse -257 -276 2.26107 0.118
NP_440487.1_1 Reverse -261 -280 -5.50708 0.221
NP_440297.1_9 Reverse -2 -12 4.79825 0.22
NP_440297.1_9 Forward -272 -262 -0.118297 0.282
NP_440297.1_9 Reverse -265 -275 -0.118297 0.282
NP_441896.1_1 Forward -65 -46 17.2065 0.0563
NP_440894.1_10 Forward -278 -259 4.03102 0.259
NP_440894.1_10 Forward -290 -271 2.45773 0.29
NP_440999.1_9 Forward -277 -263 13.0776 0.0332
NP_440888.1_2 Forward -273 -259 9.93039 0.11
NP_440888.1_2 Reverse -264 -278 8.16044 0.171
NP_440888.1_2 Forward -288 -274 5.99717 0.254
NP_440052.1_5 Forward -284 -265 -1.08219 0.194
NP_439969.1_3 Forward -278 -259 9.53756 0.116
NP_440237.1_5 Forward -79 -65 13.372 0.197
NP_441949.1_5 Reverse -46 -65 16.7536 0.115
NP_442077.1_9 Forward -78 -59 -6.39206 0.289
NP_441543.1_2 Reverse -265 -274 18.486 0.00236
NP_441543.1_2 Forward -272 -263 16.9127 0.00359
NP_442845.1_2 Reverse -258 -272 14.0609 0.0872
NP_442845.1_2 Forward -273 -259 4.81781 0.251
NP_440380.1_5 Reverse -271 -290 0.294447 0.299
NP_441469.1_8 Forward -274 -265 16.126 0.00797
NP_441469.1_8 Reverse -263 -272 6.48957 0.227
NP_443064.1_6 Forward -273 -263 12.5669 0.0796
NP_442337.1_8 Forward -141 -122 2.26107 0.217
NP_442337.1_8 Forward -21 -2 -1.67217 0.288
NP_442578.1_7 Forward -272 -265 14.5921 0.026
NP_442578.1_7 Reverse -265 -272 14.5921 0.026
NP_440220.1_4 Reverse -233 -252 5.99684 0.204
NP_441462.1_2 Forward -273 -263 11.5831 0.00406
NP_441462.1_2 Reverse -264 -274 11.5831 0.00406
NP_441462.1_2 Reverse -17 -27 -0.806614 0.254
NP_441621.1_7 Forward -275 -261 -3.24533 0.188
NP_441621.1_7 Reverse -262 -276 -3.34366 0.188
NP_443062.1_1 Reverse -264 -282 6.30325 0.204
NP_443062.1_1 Forward -273 -255 3.57305 0.293
NP_443062.1_6 Reverse -256 -275 0.294447 0.299
NP_442204.1_1 Forward -277 -266 8.7118 0.0852
NP_442487.1_5 Forward -27 -8 4.81688 0.234
NP_440516.1_2 Forward -279 -261 4.83737 0.137
NP_440516.1_8 Forward -273 -264 16.9127 0.00442
NP_440516.1_8 Reverse -264 -273 16.9127 0.00442
NP_442428.1_5 Forward -272 -265 15.8704 0.0124
NP_442428.1_5 Reverse -265 -272 15.8704 0.0124
NP_440673.1_3 Forward -271 -264 12.4288 0.0426
NP_440673.1_3 Reverse -266 -273 12.4288 0.0426
NP_441714.1_3 Forward -280 -262 15.653 0.138
NP_441052.1_2 Forward -273 -263 19.9412 0.00106
NP_441052.1_2 Reverse -264 -274 10.5014 0.0285
NP_441052.1_2 Reverse -306 -316 4.10993 0.166
NP_442219.1_8 Forward -325 -306 8.74691 0.241
NP_442219.1_9 Forward -272 -263 17.7976 0.00718
NP_442219.1_9 Reverse -265 -274 8.35786 0.0681
NP_440436.1_4 Reverse -265 -274 18.1905 0.00233
NP_440436.1_4 Forward -272 -263 17.2072 0.00233
NP_440436.1_4 Forward -215 -206 7.07914 0.142
NP_440041.1_2 Forward -28 -9 -4.22878 0.293
NP_441669.1_2 Reverse -366 -380 19.8618 0.116
NP_441719.1_4 Forward -272 -265 16.3621 0.0124
NP_441719.1_4 Reverse -265 -272 16.3621 0.0124
NP_441733.1_10 Reverse -261 -274 7.39411 0.153
NP_441004.1_1 Reverse -258 -277 -14.6519 0.269
NP_442366.1_3 Reverse -263 -281 8.47561 0.0653
NP_442366.1_3 Forward -274 -256 5.91901 0.0829
NP_442366.1_5 Reverse -261 -271 14.0409 0.0497
NP_442366.1_5 Forward -276 -266 11.9759 0.148
NP_443029.1_5 Forward -300 -281 13.5683 0.22
NP_441115.1_4 Forward -274 -256 12.703 0.0976
NP_442206.1_10 Reverse -264 -279 2.43817 0.201
NP_443054.1_2 Forward -189 -175 3.73617 0.24
NP_443054.1_2 Reverse -262 -276 1.76955 0.245
NP_441851.1_10 Forward -274 -264 16.008 0.00552
NP_441851.1_10 Reverse -263 -273 15.8113 0.00552
NP_442208.1_8 Forward -134 -116 15.9488 0.235
NP_442856.1_7 Forward -282 -263 4.03102 0.137
NP_441668.1_4 Reverse -197 -216 0.58944 0.235
NP_440593.1_3 Reverse -259 -278 -1.47551 0.211
NP_441540.1_1 Reverse -360 -379 19.3698 0.12
NP_442689.1_8 Forward -60 -43 -4.58271 0.267
NP_442689.1_8 Forward -69 -52 -7.82764 0.292
NP_440940.1_7 Forward -283 -265 6.40989 0.225
NP_441349.1_10 Reverse -254 -273 11.4058 0.0232
NP_442024.1_8 Reverse -32 -42 15.418 0.254
NP_440726.1_2 Forward -283 -264 -0.39387 0.295
NP_440431.1_3 Forward -217 -198 0.294447 0.132
NP_440431.1_3 Forward -274 -255 -12.1936 0.296
NP_440431.1_4 Reverse -51 -70 -8.45146 0.275
NP_442450.1_5 Reverse -262 -272 7.55152 0.13
NP_442450.1_5 Forward -275 -265 7.55152 0.13
NP_440588.1_2 Reverse -255 -274 14.9458 0.0144
NP_440588.1_2 Forward -282 -263 -1.57384 0.155
NP_441031.1_1 Reverse -53 -72 6.91914 0.259
NP_442006.1_2 Reverse -270 -287 -5.36936 0.143
NP_442006.1_2 Reverse -264 -281 -16.7758 0.264
NP_441003.1_9 Forward -123 -104 4.52268 0.277
NP_441003.1_9 Forward -282 -263 3.04771 0.3
NP_441570.1_1 Forward -26 -8 -2.43913 0.0656
NP_441570.1_1 Reverse -264 -282 -7.45401 0.0895
NP_441570.1_1 Forward -273 -255 -17.1888 0.267
NP_441078.1_4 Forward -273 -264 19.6659 0.0007
NP_441078.1_4 Reverse -264 -273 19.6659 0.0007
NP_441078.1_4 Reverse -306 -315 -0.983583 0.213
NP_442443.1_4 Forward -311 -301 14.8275 0.202
NP_440526.1_3 Forward -272 -261 8.02298 0.126
NP_441432.1_8 Reverse -263 -272 16.8143 0.00595
NP_441432.1_8 Reverse -305 -314 9.73449 0.0754
NP_441432.1_8 Forward -274 -265 8.25953 0.0755
NP_441432.1_9 Reverse -368 -381 11.604 0.221
NP_441432.1_9 Forward -153 -140 10.6345 0.245
NP_442320.1_8 Reverse -258 -272 -3.54032 0.124
NP_441732.1_2 Forward -277 -261 2.02515 0.0253
NP_441732.1_2 Reverse -260 -276 -17.1494 0.24
NP_440629.1_1 Reverse -49 -67 16.3421 0.0502
NP_440760.1_1 Reverse -264 -283 -14.4552 0.131
NP_441805.1_1 Reverse -131 -150 -5.99873 0.3
NP_442353.1_4 Forward -279 -260 12.29 0.0806
NP_442400.1_10 Reverse -55 -68 9.61097 0.271
NP_440713.1_4 Forward -283 -264 5.50599 0.208
NP_440713.1_4 Reverse -7 -26 1.27776 0.289
NP_442489.1_2 Forward -278 -259 6.78429 0.174
NP_442489.1_2 Forward -284 -265 4.81767 0.206
NP_442489.1_7 Forward -273 -264 20.1576 0.000695
NP_442489.1_7 Reverse -264 -273 20.1576 0.000695
NP_442489.1_7 Reverse -17 -26 -1.6719 0.235
NP_441706.1_1 Reverse -369 -388 -3.73712 0.271
NP_440559.1_1 Forward -272 -263 17.4043 0.00658
NP_440559.1_1 Reverse -265 -274 8.75118 0.0586
NP_441659.2_8 Forward -273 -263 18.1713 0.00133
NP_441659.2_8 Reverse -264 -274 11.9764 0.0147
NP_441022.1_1 Reverse -63 -72 10.8747 0.284
NP_441040.1_5 Reverse -259 -278 6.4893 0.229
NP_441040.1_5 Forward -278 -259 4.62101 0.246
NP_441800.1_3 Forward -278 -260 4.24738 0.289
NP_442346.1_5 Reverse -263 -273 16.6963 0.00248
NP_442346.1_5 Forward -274 -264 9.02648 0.118
NP_440352.1_5 Reverse -126 -145 14.5051 0.143
NP_440545.1_3 Reverse -260 -277 13.6085 0.0167
NP_440545.1_3 Forward -277 -260 -3.10775 0.199
NP_440545.1_5 Reverse -260 -277 10.3636 0.21
NP_440250.1_4 Forward -73 -54 5.40686 0.253
NP_440459.1_2 Forward -275 -258 9.97027 0.212
NP_441888.1_7 Forward -278 -264 3.73617 0.225
NP_441948.1_4 Forward -280 -262 -0.177514 0.139
NP_441948.1_4 Reverse -257 -275 -2.14413 0.16
NP_441833.1_4 Forward -272 -265 15.9687 0.0124
NP_441833.1_4 Reverse -265 -272 15.9687 0.0124
NP_441329.1_1 Forward -111 -92 4.82192 0.281
NP_441329.1_3 Reverse -216 -226 15.8708 0.231
NP_441895.1_2 Forward -267 -248 -17.6018 0.234
NP_442162.1_9 Forward -272 -265 16.2637 0.0124
NP_442162.1_9 Reverse -265 -272 16.2637 0.0124
NP_440671.1_4 Reverse -258 -272 6.78443 0.235
NP_442140.1_3 Reverse -265 -275 16.2046 0.0255
NP_442140.1_3 Forward -272 -262 12.2714 0.0632
NP_441609.1_1 Reverse -162 -181 2.16274 0.189
NP_440875.1_9 Reverse -266 -276 9.15072 0.233
NP_441813.1_5 Forward -275 -265 9.91146 0.021
NP_441813.1_5 Reverse -262 -272 8.63316 0.0367
NP_440590.1_4 Reverse -265 -278 13.589 0.013
NP_440590.1_4 Forward -272 -259 1.10092 0.133
NP_440567.1_1 Forward -272 -258 17.6008 0.0153
NP_440567.1_1 Reverse -265 -279 6.29277 0.085
NP_440035.1_2 Reverse -297 -316 11.0125 0.163
NP_442497.1_10 Forward -272 -263 10.4228 0.0087
NP_442497.1_10 Reverse -265 -274 10.4228 0.0087
NP_440821.1_4 Forward -275 -265 10.2065 0.0163
NP_440821.1_4 Reverse -262 -272 9.41981 0.0286
NP_441239.1_9 Forward -275 -263 12.3303 0.0477
NP_441239.1_9 Reverse -262 -274 5.93884 0.202
NP_441009.1_4 Forward -273 -254 14.1591 0.175
NP_441009.1_4 Reverse -264 -283 13.9625 0.183
NP_441892.1_1 Forward -282 -265 1.8088 0.147
NP_442270.1_9 Forward -284 -265 -8.35868 0.217
NP_441508.1_1 Reverse -49 -68 16.3242 0.101
NP_441508.1_1 Forward -73 -54 11.9992 0.236
NP_442643.1_1 Forward -32 -13 -11.7019 0.231
NP_442643.1_1 Reverse -258 -277 -11.8986 0.235
NP_441541.1_1 Forward -395 -377 -0.76195 0.237
NP_441526.1_6 Reverse -268 -287 2.85105 0.271
NP_442138.1_10 Forward -26 -7 -4.52377 0.256
NP_440546.1_4 Reverse -264 -274 11.8882 0.0679
NP_440546.1_4 Forward -273 -263 10.046 0.109
NP_440462.1_6 Forward -275 -265 9.02648 0.0498
NP_440462.1_6 Reverse -262 -272 1.35667 0.294
NP_440868.1_4 Reverse -260 -272 13.2153 0.022
NP_440868.1_4 Forward -277 -265 8.6921 0.0582
NP_441474.1_1 Forward -283 -264 -0.689632 0.255
NP_441084.1_6 Forward -218 -204 14.2889 0.106
NP_439942.1_2 Forward -387 -368 13.8612 0.228
NP_442460.1_7 Reverse -252 -271 0.982764 0.256
NP_442039.1_4 Forward -272 -265 15.1821 0.0124
NP_442039.1_4 Reverse -265 -272 15.1821 0.0124
NP_441180.1_1 Forward -141 -122 22.418 0.0272
NP_440008.1_9 Reverse -189 -208 12.6841 0.183
NP_440825.1_7 Forward -272 -262 12.9096 0.152
NP_440825.1_7 Reverse -265 -275 12.4217 0.155
NP_442837.1_3 Forward -272 -265 15.7721 0.0124
NP_442837.1_3 Reverse -265 -272 15.7721 0.0124
NP_440160.1_1 Reverse -44 -63 9.385 0.266
NP_442053.1_1 Forward -273 -264 18.3876 0.0007
NP_442053.1_1 Reverse -264 -273 18.3876 0.0007
NP_440505.1_3 Reverse -262 -272 9.22315 0.122
NP_440505.1_3 Forward -275 -265 6.76487 0.169
NP_441959.1_8 Forward -58 -45 9.48054 0.286
NP_441959.1_8 Reverse -349 -362 8.22726 0.298
NP_441252.1_6 Forward -110 -103 14.3954 0.168
NP_441203.1_1 Forward -272 -253 -19.6667 0.297
NP_440914.1_1 Forward -273 -263 17.5935 0.000537
NP_440914.1_1 Reverse -264 -274 8.6151 0.186
NP_441011.1_8 Reverse -265 -274 16.9127 0.00602
NP_441011.1_8 Forward -272 -263 8.25953 0.144
NP_442533.1_1 Reverse -162 -181 -11.9969 0.236
NP_442533.1_1 Forward -29 -10 -16.2252 0.263
NP_442533.1_6 Forward -273 -264 17.2076 0.00137
NP_442533.1_6 Reverse -264 -273 17.2076 0.00137
NP_442232.1_3 Reverse -256 -275 -13.4719 0.282
NP_442229.1_1 Reverse -262 -276 16.8135 0.0795
NP_442229.1_1 Forward -275 -261 10.1271 0.184
NP_441482.1_7 Forward -279 -265 -8.5552 0.193
NP_439944.1_9 Forward -272 -262 10.5014 0.0887
NP_441697.1_5 Forward -161 -142 -9.40638 0.268
NP_441028.1_6 Forward -122 -112 13.5492 0.158
NP_441028.1_6 Forward -143 -133 10.1076 0.21
NP_441028.1_6 Reverse -6 -16 3.8145 0.281
NP_442202.1_2 Forward -194 -175 16.0265 0.29
NP_440116.1_5 Reverse -261 -278 6.13536 0.17
NP_440116.1_5 Forward -276 -259 2.98877 0.249
NP_440116.1_8 Forward -272 -253 -1.27885 0.117
NP_441527.1_4 Reverse -52 -71 -7.11457 0.23
NP_441527.1_4 Forward -314 -295 -11.8892 0.284
NP_441527.1_4 Forward -380 -361 -13.0351 0.298
NP_440115.1_6 Reverse -261 -271 9.32148 0.115
NP_440115.1_6 Reverse -124 -134 8.4365 0.13
NP_440115.1_6 Reverse -115 -125 5.38824 0.25
NP_440007.1_9 Forward -190 -176 3.34284 0.27
NP_439965.1_1 Reverse -255 -274 18.4857 0.00907
NP_441680.1_6 Reverse -229 -248 17.6982 0.162
NP_441972.1_5 Reverse -265 -284 -3.93378 0.201
NP_441972.1_5 Forward -272 -253 -6.68705 0.233
NP_441106.1_1 Forward -274 -265 18.191 0.0028
NP_441106.1_1 Reverse -263 -272 9.63616 0.0311
NP_441106.1_3 Forward -67 -48 18.584 0.0578
NP_441106.1_9 Forward -73 -63 15.6147 0.286
NP_441825.1_4 Reverse -211 -221 17.6796 0.158
NP_441869.1_9 Forward -217 -198 11.7992 0.293
NP_441286.1_1 Reverse -263 -275 6.03717 0.0258
NP_441286.1_1 Forward -274 -262 3.38223 0.0467
NP_442674.1_3 Forward -279 -260 2.35861 0.3
NP_440670.1_8 Forward -273 -264 18.3876 0.000699
NP_440670.1_8 Reverse -264 -273 18.3876 0.000699
NP_441479.1_9 Reverse -264 -282 13.9821 0.271
NP_440886.1_7 Forward -274 -264 17.7774 0.0011
NP_440886.1_7 Reverse -263 -273 7.94438 0.0805
NP_442614.1_2 Forward -273 -259 15.4376 0.0773
NP_440205.1_4 Reverse -129 -148 23.2056 0.0186
NP_439899.1_1 Reverse -45 -63 6.91275 0.205
NP_442022.1_4 Reverse -195 -214 6.4893 0.271
NP_440907.2_8 Reverse -265 -275 14.2375 0.0312
NP_440907.2_8 Forward -272 -262 7.64939 0.117
NP_440841.1_4 Forward -218 -199 -11.4069 0.3
NP_441463.1_2 Forward -70 -52 3.92672 0.197
NP_441626.1_2 Forward -272 -265 15.7721 0.0124
NP_441626.1_2 Reverse -265 -272 15.7721 0.0124
NP_441626.1_6 Forward -277 -259 12.4081 0.177
NP_439958.1_5 Forward -303 -284 14.7491 0.218
NP_442794.1_1 Forward -277 -265 12.4287 0.0721
NP_442794.1_1 Reverse -260 -272 12.232 0.0721
NP_442615.1_1 Reverse -255 -273 16.9321 0.00746
NP_442615.1_1 Forward -282 -264 0.21581 0.106
NP_442615.1_1 Forward -324 -306 -0.669169 0.12
NP_441962.1_4 Reverse -259 -278 -14.0619 0.282
NP_440387.1_1 Reverse -264 -280 5.6634 0.0311
NP_440387.1_1 Forward -273 -257 -3.57971 0.162
NP_441431.1_2 Forward -276 -262 17.0102 0.0303
NP_441431.1_2 Reverse -261 -275 8.25877 0.221
NP_441431.1_2 Forward -265 -251 5.89884 0.284
NP_440358.1_8 Reverse -370 -389 -2.0655 0.292
NP_442805.1_1 Forward -73 -56 8.10198 0.22
NP_442698.1_10 Forward -319 -300 2.3594 0.284
NP_442087.1_7 Forward -83 -64 2.85027 0.186
NP_441237.1_9 Forward -272 -262 14.828 0.0242
NP_442743.1_4 Reverse -265 -284 -7.76869 0.28
NP_442743.1_8 Forward -236 -217 11.9031 0.185
NP_440278.1_2 Reverse -33 -52 14.3558 0.156
NP_439910.1_2 Forward -34 -17 -22.5773 0.267
NP_440457.1_1 Reverse -260 -272 2.10393 0.217
NP_440457.1_1 Forward -277 -265 -0.452677 0.263
NP_440798.1_6 Forward -272 -259 13.0973 0.0445
NP_440798.1_6 Reverse -265 -278 3.36254 0.151
NP_440801.1_9 Reverse -204 -218 15.0653 0.227
NP_442509.1_9 Reverse -264 -274 16.2041 0.00739
NP_442509.1_9 Forward -273 -263 8.14104 0.192
NP_440081.1_4 Forward -237 -218 13.9214 0.286
NP_442582.1_3 Reverse -349 -363 12.5211 0.286
NP_443037.1_7 Reverse -360 -379 -3.44213 0.276
NP_440524.1_2 Reverse -266 -285 -4.42544 0.276
NP_440554.1_4 Reverse -265 -275 7.35486 0.103
NP_441885.1_5 Forward -273 -263 20.9245 0.000538
NP_441885.1_5 Reverse -264 -274 11.4848 0.00668
NP_441885.1_5 Reverse -306 -316 0.668351 0.133
NP_441275.1_1 Forward -66 -48 29.7151 0.00037
NP_441275.1_2 Forward -244 -225 24.8772 0.00655
NP_441275.1_2 Reverse -228 -247 12.6841 0.1
NP_441275.1_3 Forward -368 -354 16.2242 0.121
NP_441275.1_4 Forward -212 -193 26.3522 0.002
NP_441275.1_5 Forward -346 -327 21.4347 0.0443
NP_441275.1_6 Forward -15 -2 20.5705 0.156
NP_440478.1_10 Forward -275 -261 8.06273 0.257
NP_441428.1_7 Forward -62 -43 12.0942 0.123
NP_442703.1_9 Reverse -50 -68 11.3272 0.244
NP_442341.1_7 Reverse -263 -277 17.7975 0.0111
NP_442341.1_7 Forward -274 -260 6.3911 0.127
NP_442341.1_9 Forward -275 -261 17.8952 0.0212
NP_442395.2_4 Forward -274 -255 14.7483 0.0507
NP_442395.2_9 Forward -396 -380 13.5299 0.233
NP_440423.1_10 Forward -307 -288 9.3409 0.26
NP_443000.1_7 Reverse -262 -272 10.3048 0.0345
NP_443000.1_7 Forward -275 -265 1.94665 0.226
NP_440552.1_8 Forward -63 -46 9.69683 0.292
NP_441842.1_10 Reverse -257 -271 6.19444 0.297
NP_440275.1_3 Forward -275 -265 8.33817 0.0602
NP_440275.1_3 Reverse -262 -272 8.04317 0.0602
NP_442932.1_9 Reverse -273 -292 4.81767 0.276
NP_440091.1_1 Reverse -260 -272 1.41561 0.197
NP_441307.1_6 Reverse -264 -283 7.27595 0.217
NP_443060.1_5 Reverse -256 -275 10.52 0.175
NP_441397.1_8 Reverse -134 -147 16.3909 0.142
NP_440679.1_5 Reverse -267 -286 9.0459 0.291
NP_440679.1_10 Reverse -266 -285 -15.4385 0.25
NP_441122.1_1 Reverse -260 -275 4.89645 0.28
NP_441207.1_7 Forward -306 -292 12.063 0.241
NP_441207.1_7 Reverse -221 -235 9.44903 0.28
NP_440175.1_7 Reverse -371 -389 9.36312 0.28
NP_440149.1_8 Reverse -264 -283 4.22769 0.0853
NP_441875.1_7 Forward -109 -99 16.2046 0.227
NP_441105.1_3 Reverse -253 -272 -6.98204 0.243
NP_440216.1_1 Forward -273 -259 8.65272 0.00592
NP_440216.1_1 Reverse -264 -278 -2.06536 0.0458
NP_440216.1_9 Reverse -132 -141 11.6028 0.254
NP_440216.1_9 Reverse -133 -142 7.27622 0.286
NP_440172.1_1 Forward -273 -263 15.0247 0.00945
NP_440172.1_1 Reverse -264 -274 8.73149 0.0586
NP_440172.1_1 Reverse -17 -27 2.14332 0.283
NP_440249.1_2 Forward -400 -390 14.4342 0.273
NP_442015.1_10 Forward -277 -264 20.1771 0.00366
NP_442015.1_10 Reverse -260 -273 10.1474 0.0402
NP_441226.1_7 Forward -272 -265 14.4934 0.0123
NP_441226.1_7 Reverse -265 -272 14.4934 0.0123
NP_441111.1_7 Forward -272 -264 18.7023 0.00294
NP_441111.1_7 Reverse -265 -273 18.7023 0.00294
NP_441766.1_2 Forward -273 -264 17.5026 0.00297
NP_441766.1_2 Reverse -264 -273 17.5026 0.00297
NP_442417.1_5 Reverse -264 -278 10.226 0.122
NP_440416.1_9 Reverse -257 -276 6.4893 0.0325
NP_440416.1_9 Forward -280 -261 -5.40875 0.0797
NP_443052.1_9 Forward -286 -267 -6.39206 0.282
NP_442116.1_6 Forward -58 -41 7.50051 0.254
NP_440261.1_5 Forward -272 -259 -1.06236 0.0655
NP_440261.1_5 Reverse -265 -278 -2.83231 0.0932
NP_440261.1_7 Forward -115 -96 -5.70374 0.241
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCTAAAATTTGCAAGTATAAAAATCAGCAAATAGTTATATTGTTAATAATTCAATGACCCAATAACTCGTACTGTTATCTACGTGGTGAAAGCCAAAAAGACGAACAGTTTAGCCTCCTCCTCCTCGGCGATCGCCAAGCGAAATGTCATGGGAGATGTTCAGATTGAGCATTTTTTTCTAAAAGCCCTTGCTAAAACAAACCACATGTGCAGGGTGTCCCCGATGTTGACTAAATTCAGCGGACTTAAAACCTATTTTTTCCCTGGGTTGCTAGGTTTGCCCCCCGTTTTGGGCAAGCTTGTATAAGCAGATACTGTTAATTGGGTCAACTTTTTGTTACATTTATTTACAATTGATTGTTTACAATTGAAAGGTAGTCGCCTTGGAGGGCAACAGCT

CDS

ATGAAACCTGAATCCTTCGATCTCACCATTGAACAAATGTTTGAGTTCCGTCGCATGCAGGATGCCACCGCCAACATCAGCCAGGAGCAAGCCCTGGAACTTTTGGTCCAAGCCTCTCGACTGTTGATGATTAAATCCAACGTCATCCGGGACTTAATGCGCCAGGCTCCCCTGGAGCCCCTAGGTTAA

Protein

MKPESFDLTIEQMFEFRRMQDATANISQEQALELLVQASRLLMIKSNVIRDLMRQAPLEPLG