Your browser is old and dusty. Try Google Chrome!

Details for ssl0438

ORF ssl0438
Accession NP_441285.1
Symbol
Category Ribosomal proteins: synthesis and modification
Definition similar to 50S ribosomal protein L12
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -319 -305 0.196253 0.215
NP_441453.1_4 Forward -45 -37 5.0343 0.209
NP_442151.1_6 Reverse -310 -324 9.83269 0.139
NP_441098.1_3 Forward -34 -15 -4.97059 0.28
NP_440348.1_5 Forward -301 -282 14.2574 0.114
NP_442173.1_1 Reverse -37 -45 4.93597 0.241
NP_441054.1_4 Forward -242 -224 -2.24246 0.228
NP_441476.1_5 Reverse -150 -169 -2.26216 0.224
NP_440304.1_4 Reverse -153 -163 2.83163 0.299
NP_440893.1_3 Forward -159 -140 0.490334 0.275
NP_441208.1_9 Reverse -370 -384 8.94771 0.219
NP_441208.1_9 Forward -310 -296 8.84938 0.219
NP_441594.1_6 Forward -316 -297 5.60432 0.209
NP_441082.1_10 Reverse -230 -243 11.4257 0.236
NP_441083.1_5 Reverse -229 -239 2.14332 0.195
NP_439957.1_1 Forward -120 -101 15.5357 0.0692
NP_441716.1_2 Forward -72 -53 -1.81236 0.289
NP_441327.1_5 Forward -138 -129 14.356 0.192
NP_440438.2_9 Forward -352 -333 19.6656 0.117
NP_441486.1_1 Reverse -33 -47 -5.50694 0.242
NP_442634.1_4 Forward -321 -307 -4.52363 0.206
NP_440376.1_1 Reverse -266 -275 3.34298 0.206
NP_442589.1_3 Reverse -321 -340 17.5339 0.214
NP_440642.1_10 Forward -328 -314 5.40719 0.241
NP_440642.1_10 Reverse -131 -145 1.27731 0.296
NP_441422.1_3 Forward -60 -41 14.8062 0.26
NP_440691.1_5 Forward -244 -225 14.6508 0.184
NP_441950.1_5 Forward -313 -294 16.4832 0.222
NP_442496.1_5 Reverse -141 -159 9.55725 0.218
NP_442496.1_5 Forward -240 -222 8.27895 0.253
NP_441165.1_10 Forward -392 -374 11.5239 0.239
NP_441317.1_4 Reverse -4 -18 16.7213 0.136
NP_440203.1_5 Forward -146 -136 8.92768 0.281
NP_442364.1_2 Reverse -128 -147 13.3725 0.235
NP_441338.2_9 Forward -382 -363 6.58763 0.252
NP_442598.1_2 Reverse -3 -12 16.5193 0.252
NP_441712.1_1 Reverse -27 -46 12.7098 0.251
NP_442438.1_10 Reverse -293 -307 1.37622 0.197
NP_441916.1_10 Reverse -147 -166 0.786102 0.275
NP_440345.1_3 Reverse -18 -32 14.5264 0.215
NP_440569.1_7 Forward -367 -348 10.7175 0.286
NP_440703.1_9 Forward -244 -231 7.49186 0.254
NP_440736.1_10 Forward -355 -337 12.6055 0.293
NP_440289.1_2 Reverse -218 -231 -0.472371 0.198
NP_440498.1_1 Reverse -151 -169 -1.25915 0.222
NP_442068.1_4 Forward -157 -138 18.9765 0.0814
NP_441644.1_6 Forward -319 -309 5.28945 0.199
NP_440867.1_10 Forward -241 -222 3.44104 0.283
NP_442215.1_2 Forward -328 -312 -5.05468 0.244
NP_442933.1_1 Reverse -4 -23 11.0289 0.249
NP_442554.1_8 Reverse -311 -321 3.71661 0.215
NP_442142.1_4 Forward -376 -363 2.18201 0.299
NP_442292.1_5 Reverse -369 -388 -2.45882 0.29
NP_441264.1_5 Reverse -344 -363 -1.27885 0.165
NP_443009.1_5 Reverse -359 -370 8.51463 0.106
NP_440881.1_5 Forward -285 -266 12.9791 0.299
NP_440279.1_2 Forward -312 -293 4.62101 0.298
NP_441468.1_1 Forward -231 -224 6.72562 0.126
NP_441020.2_7 Forward -244 -225 11.3067 0.22
NP_442811.1_2 Forward -315 -296 6.09597 0.198
NP_441637.1_9 Reverse -118 -136 -3.02911 0.293
NP_441764.1_8 Forward -265 -255 14.6604 0.284
NP_442868.1_6 Forward -276 -266 1.35667 0.205
NP_441612.1_2 Reverse -298 -308 6.61303 0.283
NP_442808.1_1 Reverse -265 -275 2.24121 0.274
NP_441101.1_4 Reverse -114 -133 6.29264 0.295
NP_441849.1_2 Forward -87 -68 4.91741 0.245
NP_442050.1_1 Forward -239 -220 12.5858 0.212
NP_441433.1_8 Forward -148 -129 12.5858 0.147
NP_442192.1_5 Forward -274 -255 7.07928 0.292
NP_441116.1_9 Reverse -370 -384 12.1926 0.26
NP_441728.2_4 Forward -35 -16 12.0793 0.273
NP_440899.1_8 Reverse -118 -137 0.196116 0.184
NP_440899.1_8 Reverse -363 -382 -8.26035 0.254
NP_440256.1_1 Reverse -307 -326 -1.18052 0.101
NP_441559.1_8 Reverse -261 -275 6.78443 0.0752
NP_441559.1_8 Forward -374 -360 -4.7203 0.236
NP_442150.1_2 Forward -265 -246 16.9279 0.213
NP_441494.1_6 Reverse -150 -163 6.31247 0.289
NP_441750.1_1 Reverse -134 -153 -9.73531 0.3
NP_441271.1_8 Forward -243 -233 16.7946 0.208
NP_440146.1_1 Forward -122 -104 15.0897 0.238
NP_442240.1_2 Forward -306 -287 -20.2567 0.295
NP_442714.1_5 Reverse -293 -312 0.392778 0.258
NP_441134.1_10 Forward -247 -229 9.85225 0.26
NP_440586.1_1 Reverse -376 -395 -5.50708 0.285
NP_440586.1_9 Forward -243 -224 5.11266 0.288
NP_442251.1_8 Reverse -132 -146 19.0758 0.205
NP_442959.1_5 Reverse -360 -379 6.98095 0.242
NP_441138.1_5 Reverse -6 -19 10.4704 0.233
NP_440819.1_5 Forward -267 -259 6.41093 0.285
NP_441803.1_2 Reverse -293 -312 1.96607 0.222
NP_439977.1_5 Forward -170 -151 -0.000545616 0.217
NP_442368.1_3 Forward -242 -224 3.26407 0.3
NP_441572.1_9 Reverse -227 -246 14.6499 0.181
NP_442549.1_6 Reverse -250 -269 12.7825 0.201
NP_442384.1_10 Forward -307 -294 1.10092 0.268
NP_440693.1_6 Reverse -295 -314 16.7157 0.229
NP_440075.1_2 Reverse -136 -155 4.22769 0.292
NP_440282.1_10 Reverse -300 -319 -8.26035 0.26
NP_441103.1_9 Reverse -130 -140 12.4895 0.291
NP_440575.1_4 Forward -319 -300 14.6695 0.208
NP_442845.1_2 Forward -238 -224 4.71948 0.254
NP_443064.1_6 Reverse -229 -239 9.94905 0.187
NP_440544.1_5 Reverse -258 -265 14.5681 0.264
NP_440255.1_9 Forward -224 -205 15.2305 0.278
NP_440454.1_2 Forward -19 -5 11.2797 0.286
NP_440516.1_6 Forward -319 -305 7.17714 0.284
NP_442080.1_7 Forward -324 -305 -1.37718 0.287
NP_441443.1_1 Reverse -146 -165 -5.01543 0.297
NP_442120.1_10 Reverse -149 -168 -15.9302 0.296
NP_442219.1_8 Reverse -294 -313 10.0998 0.213
NP_441884.1_9 Forward -385 -366 -23.6983 0.284
NP_442577.1_9 Reverse -278 -292 14.0603 0.211
NP_442813.1_2 Forward -168 -149 0.786102 0.273
NP_442813.1_4 Reverse -365 -384 -8.35868 0.299
NP_442366.1_3 Reverse -297 -315 -2.0458 0.219
NP_442873.1_3 Reverse -219 -238 3.04693 0.299
NP_442206.1_10 Forward -319 -304 9.02635 0.167
NP_441851.1_10 Reverse -35 -45 5.5849 0.207
NP_441668.1_4 Reverse -370 -389 5.11266 0.173
NP_441982.1_6 Reverse -23 -32 13.0583 0.274
NP_442689.1_8 Forward -72 -55 -8.12263 0.292
NP_440940.1_7 Forward -284 -266 3.55831 0.274
NP_441661.1_3 Forward -172 -155 -6.05768 0.283
NP_441409.1_8 Forward -25 -6 9.23384 0.237
NP_440432.1_9 Forward -300 -285 -1.49507 0.167
NP_439960.1_10 Reverse -132 -150 5.32902 0.152
NP_442237.1_1 Forward -129 -115 17.6776 0.206
NP_442006.1_2 Forward -245 -228 -14.4158 0.203
NP_441078.1_4 Forward -307 -298 -1.47524 0.266
NP_440707.1_7 Forward -291 -272 4.62101 0.284
NP_441432.1_8 Forward -320 -311 5.21127 0.185
NP_441432.1_9 Forward -121 -108 8.30749 0.29
NP_441333.1_1 Reverse -5 -15 11.6853 0.241
NP_440313.1_5 Reverse -351 -369 12.3097 0.235
NP_442400.1_10 Forward -378 -365 8.46506 0.278
NP_440831.1_3 Forward -247 -228 10.2702 0.179
NP_442404.1_9 Forward -389 -375 11.1104 0.263
NP_441813.1_3 Forward -277 -258 13.0738 0.296
NP_440594.1_5 Forward -331 -312 4.32522 0.293
NP_441239.1_9 Forward -234 -222 5.54551 0.217
NP_441239.1_9 Forward -321 -309 3.38223 0.285
NP_441951.1_9 Forward -387 -368 5.30933 0.254
NP_441009.1_4 Reverse -305 -324 11.5042 0.254
NP_442270.1_9 Forward -318 -299 -9.44032 0.234
NP_441541.1_1 Reverse -14 -32 14.8032 0.0795
NP_441541.1_1 Forward -32 -14 -1.43039 0.238
NP_440833.1_6 Forward -382 -368 15.0436 0.143
NP_441119.1_5 Forward -76 -57 5.30933 0.25
NP_441782.1_3 Forward -243 -224 21.0423 0.102
NP_442499.1_4 Forward -322 -308 11.996 0.226
NP_440374.1_3 Reverse -18 -36 12.1295 0.272
NP_441868.1_4 Forward -355 -341 12.586 0.284
NP_442402.1_4 Reverse -259 -278 -1.96793 0.195
NP_442402.1_4 Reverse -260 -279 -8.26108 0.278
NP_441848.1_4 Forward -132 -116 11.8478 0.213
NP_440653.1_10 Forward -325 -306 22.1239 0.0201
NP_439942.1_7 Reverse -357 -376 -1.37718 0.242
NP_442923.1_4 Reverse -236 -255 0.294447 0.196
NP_442679.1_1 Forward -138 -119 -0.885524 0.226
NP_442679.1_1 Forward -137 -118 -5.50708 0.293
NP_440160.1_2 Forward -276 -257 -3.63879 0.26
NP_440160.1_9 Reverse -310 -329 7.37428 0.292
NP_442532.1_1 Forward -133 -119 10.891 0.232
NP_440914.1_1 Forward -319 -309 9.00547 0.186
NP_440914.1_7 Forward -33 -14 15.517 0.179
NP_442533.1_1 Forward -241 -222 -16.7168 0.275
NP_442541.1_10 Reverse -217 -231 11.602 0.182
NP_442322.1_3 Reverse -189 -203 19.1741 0.282
NP_441028.1_6 Reverse -257 -267 8.14104 0.217
NP_441028.1_6 Reverse -130 -140 5.38779 0.255
NP_441527.1_4 Forward -20 -1 -3.1994 0.164
NP_441527.1_4 Reverse -142 -161 -7.78302 0.237
NP_441602.1_4 Reverse -281 -300 14.7491 0.278
NP_440886.1_7 Reverse -297 -307 3.51951 0.279
NP_440404.1_9 Forward -135 -116 12.3658 0.209
NP_440907.2_9 Forward -383 -364 2.45694 0.268
NP_441021.1_1 Reverse -37 -56 -11.8986 0.275
NP_440193.1_1 Forward -199 -180 15.8357 0.202
NP_441463.1_2 Forward -190 -172 4.79171 0.175
NP_441463.1_3 Reverse -300 -319 -5.80207 0.232
NP_442842.1_10 Reverse -122 -141 1.63036 0.254
NP_442794.1_1 Forward -311 -299 6.33216 0.185
NP_442794.1_1 Forward -323 -311 2.59558 0.287
NP_441401.1_4 Forward -133 -120 16.6372 0.131
NP_442698.1_10 Forward -138 -119 -1.27885 0.297
NP_440457.1_1 Forward -352 -340 -0.0593532 0.25
NP_441801.1_4 Forward -248 -238 2.63497 0.29
NP_442680.1_5 Forward -139 -120 2.80756 0.237
NP_442680.1_5 Forward -137 -118 1.3422 0.243
NP_442680.1_5 Forward -138 -119 0.853752 0.257
NP_442509.1_9 Forward -307 -297 6.37109 0.274
NP_441496.1_1 Reverse -122 -136 15.5768 0.265
NP_440478.1_2 Reverse -156 -175 -0.295539 0.284
NP_442703.1_6 Reverse -114 -133 15.4215 0.279
NP_442341.1_7 Reverse -297 -311 3.73617 0.214
NP_442638.1_3 Reverse -109 -128 11.9838 0.298
NP_441105.1_3 Forward -318 -299 -7.86702 0.261
NP_440172.1_1 Forward -319 -309 2.04498 0.286
NP_440416.1_9 Forward -159 -140 -17.4051 0.239
NP_442403.1_9 Forward -313 -294 5.01433 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCGTCACTTTAATCACCGGCAAAATTCACCAGGAATTACCTCACTTGGAAGGGCGTTCCAACAAAGCGAAATCTTCCTTAGCCAATGGCATTGATTATCGCCGTCACTTGATTTGGGTAATTAGGGGTAACCCCGGAGAAAAGTTAACCATTACTGCCCAGGCTGAGCGGGCTGGCACGGTTAAAGTAGAATTGACTTTACCCTAGATCTTGTTTGGAAAGCTGTGTTTTGGAGTTGAAATTCCCTCTGCCCTCATTCACAAGGGGAAAATAATTGAAAAATCACTCTTTTTAAGAGAGGTTTAGGGAGATAAATCGTTTGATTTTGAGTTTTCCAACAAACTCCTAGAACGTGAGCAATAGCACATTTTTTAACTAACTTAATAAACAAAAAAAAGAA

CDS

ATGGGCATGACTATAATTTTGATATTGGTAGCGTTAGTAGTGATATTTCTACTAGTAATTTTCCTTCAGACAGGAACACCCACTGCTCCTCGAGATATTACCTATACCAAGGAAATTATTCAGCAATTATCTGCCAGTGAAAAAGAACAAATCATGGTACTGCTAAGGCAAGGCAAGAAAATTGAAGCGATCAAAGTCTGCCGTTCCCTAACTGGTTGTGGGCTAAAAGAAGCTAAAGACACAGTAAAAAAGCTGCTGGAAACTTTCTGA

Protein

MGMTIILILVALVVIFLLVIFLQTGTPTAPRDITYTKEIIQQLSASEKEQIMVLLRQGKKIEAIKVCRSLTGCGLKEAKDTVKKLLETF