Your browser is old and dusty. Try Google Chrome!

Details for ssl0410

ORF ssl0410
Accession NP_440040.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -66 -52 13.8643 0.0392
NP_441061.1_2 Reverse -59 -73 -0.688726 0.237
NP_440795.1_7 Forward -66 -59 14.6904 0.0123
NP_440795.1_7 Reverse -59 -66 14.6904 0.0123
NP_441418.1_6 Reverse -58 -77 -20.8467 0.129
NP_441418.1_6 Forward -133 -114 -30.3848 0.274
NP_441418.1_6 Forward -67 -48 -30.6798 0.291
NP_442291.1_5 Forward -68 -52 13.4315 0.0291
NP_442291.1_5 Reverse -57 -73 -1.71142 0.202
NP_441453.1_4 Reverse -58 -66 16.539 0.00633
NP_441453.1_4 Forward -67 -59 16.539 0.00633
NP_442151.1_6 Forward -67 -53 13.6676 0.0474
NP_442151.1_6 Forward -121 -107 8.35772 0.175
NP_442151.1_6 Forward -61 -47 6.98109 0.214
NP_442151.1_6 Reverse -109 -123 5.60446 0.27
NP_441818.1_1 Forward -66 -55 18.8393 0.00301
NP_441818.1_9 Forward -132 -113 -6.58872 0.264
NP_440226.1_1 Forward -67 -48 9.73422 0.0694
NP_440226.1_1 Reverse -58 -77 3.14605 0.237
NP_442169.1_1 Forward -378 -359 -2.75381 0.28
NP_440348.1_6 Reverse -256 -275 5.211 0.229
NP_440150.1_2 Forward -65 -46 12.0933 0.197
NP_442173.1_1 Forward -66 -58 15.4574 0.00633
NP_442173.1_1 Reverse -59 -67 15.4574 0.00633
NP_442173.1_1 Reverse -369 -377 9.45919 0.0825
NP_442752.1_4 Forward -67 -60 13.8055 0.0199
NP_442752.1_4 Reverse -58 -65 13.8055 0.0199
NP_443027.1_4 Reverse -56 -66 14.0414 0.0452
NP_443027.1_4 Forward -69 -59 11.8781 0.0872
NP_441812.1_3 Forward -68 -54 8.55439 0.251
NP_442975.1_10 Forward -71 -57 12.782 0.0459
NP_442975.1_10 Reverse -54 -68 4.71887 0.241
NP_440784.1_7 Forward -66 -59 15.9687 0.0123
NP_440784.1_7 Reverse -59 -66 15.9687 0.0123
NP_442909.1_7 Forward -66 -52 11.7003 0.131
NP_440061.1_9 Reverse -56 -70 9.93039 0.134
NP_439979.1_3 Forward -288 -269 16.5035 0.294
NP_439979.1_9 Forward -303 -285 11.4255 0.227
NP_439979.1_9 Reverse -110 -128 10.7372 0.227
NP_440878.1_9 Forward -394 -375 3.04771 0.174
NP_442062.1_8 Reverse -58 -68 19.4496 0.000558
NP_442062.1_8 Forward -67 -57 17.3846 0.00193
NP_440761.1_1 Forward -380 -361 12.0942 0.258
NP_440304.1_4 Reverse -56 -66 10.8948 0.051
NP_440304.1_4 Forward -69 -59 1.84832 0.299
NP_442242.1_4 Forward -66 -59 14.3954 0.0124
NP_442242.1_4 Reverse -59 -66 14.3954 0.0124
NP_441781.1_7 Forward -67 -48 4.71934 0.186
NP_441035.1_3 Reverse -186 -205 -0.197208 0.287
NP_442762.1_10 Forward -396 -377 -2.85214 0.22
NP_440853.1_5 Forward -292 -273 14.3558 0.209
NP_442602.1_3 Forward -240 -221 0.294447 0.203
NP_441594.1_6 Reverse -49 -68 0.196116 0.291
NP_442110.1_7 Forward -67 -53 8.84938 0.0807
NP_441925.1_4 Reverse -270 -289 -5.70449 0.181
NP_441925.1_4 Forward -100 -81 -16.2258 0.281
NP_441083.1_5 Forward -67 -57 20.3345 0.00053
NP_441083.1_5 Reverse -58 -68 11.3864 0.0159
NP_441083.1_5 Reverse -368 -378 7.94484 0.048
NP_441738.1_2 Forward -65 -58 15.28 0.0102
NP_441738.1_2 Reverse -60 -67 15.28 0.0102
NP_440209.1_1 Reverse -58 -66 18.1123 0.00295
NP_440209.1_1 Forward -67 -59 18.1123 0.00295
NP_442889.1_8 Forward -70 -56 21.0417 0.00339
NP_440178.1_7 Forward -68 -49 -14.8485 0.156
NP_440178.1_7 Reverse -91 -110 -22.3217 0.261
NP_442570.1_3 Forward -69 -50 -3.24547 0.217
NP_442461.1_4 Forward -381 -362 9.63589 0.214
NP_441716.1_1 Reverse -109 -123 12.9793 0.0689
NP_441716.1_1 Forward -67 -53 4.12949 0.258
NP_442111.1_3 Forward -256 -243 15.5315 0.196
NP_442111.1_4 Reverse -57 -71 20.9441 0.00257
NP_441163.1_9 Forward -76 -57 15.2408 0.224
NP_440343.1_3 Reverse -369 -387 2.37835 0.3
NP_440906.1_5 Forward -66 -59 15.8704 0.0124
NP_440906.1_5 Reverse -59 -66 15.8704 0.0124
NP_440747.1_10 Reverse -55 -67 7.51213 0.00286
NP_440747.1_10 Forward -70 -58 7.21714 0.00643
NP_441130.1_7 Reverse -369 -383 17.3052 0.287
NP_441130.1_10 Reverse -56 -70 9.34103 0.126
NP_441130.1_10 Forward -69 -55 8.75105 0.133
NP_441130.1_10 Forward -174 -160 8.06273 0.141
NP_441486.1_1 Reverse -55 -69 12.9793 0.00973
NP_441486.1_1 Forward -70 -56 2.85119 0.074
NP_441486.1_1 Reverse -365 -379 -5.21195 0.226
NP_441486.1_1 Forward -380 -366 -5.9986 0.272
NP_441880.2_10 Reverse -59 -77 12.4089 0.128
NP_442634.1_2 Forward -288 -269 1.57275 0.287
NP_442634.1_4 Forward -69 -55 -2.06536 0.149
NP_440403.1_4 Reverse -59 -78 -9.34199 0.274
NP_441014.1_8 Reverse -369 -388 -0.295539 0.218
NP_441014.1_10 Reverse -57 -76 2.55527 0.216
NP_442848.1_1 Reverse -52 -66 5.99778 0.0803
NP_442848.1_1 Forward -73 -59 -0.983719 0.263
NP_441012.1_4 Reverse -180 -193 7.78743 0.272
NP_443018.1_3 Forward -66 -59 14.8871 0.0123
NP_443018.1_3 Reverse -59 -66 14.8871 0.0123
NP_443018.1_3 Reverse -369 -376 8.8889 0.136
NP_441634.1_5 Forward -390 -376 19.3708 0.107
NP_441634.1_8 Reverse -56 -70 3.73617 0.143
NP_441634.1_8 Forward -69 -55 -4.52363 0.295
NP_441634.1_9 Reverse -99 -118 10.9134 0.252
NP_440376.1_1 Forward -67 -58 19.4693 0.000692
NP_440376.1_1 Reverse -58 -67 19.4693 0.000692
NP_440376.1_1 Reverse -2 -11 4.32629 0.163
NP_440376.1_1 Reverse -145 -154 3.44131 0.203
NP_440376.1_1 Reverse -144 -153 -0.000272808 0.285
NP_441588.1_4 Forward -65 -55 8.63316 0.14
NP_443065.1_6 Forward -71 -52 6.98095 0.206
NP_442687.1_7 Forward -68 -58 15.8113 0.0125
NP_442687.1_7 Reverse -57 -67 8.92815 0.0994
NP_442958.1_3 Forward -78 -59 3.93269 0.253
NP_440642.1_10 Forward -326 -312 1.96562 0.284
NP_441422.1_7 Forward -69 -52 6.03703 0.0992
NP_442735.1_7 Reverse -53 -72 16.6174 0.121
NP_440667.1_2 Reverse -235 -254 -1.08219 0.23
NP_442658.1_1 Forward -69 -59 17.0891 0.00615
NP_442658.1_1 Reverse -188 -198 8.73102 0.181
NP_442658.1_1 Reverse -56 -66 6.76441 0.214
NP_440141.1_4 Forward -295 -276 -12.0953 0.298
NP_442205.1_9 Reverse -52 -68 -0.43312 0.264
NP_441414.1_9 Reverse -58 -77 4.42435 0.0543
NP_441414.1_9 Forward -377 -358 -6.78538 0.203
NP_440800.1_7 Forward -277 -263 21.2391 0.0827
NP_440607.1_9 Forward -140 -121 16.9946 0.243
NP_442937.1_5 Forward -72 -53 12.2908 0.113
NP_442937.1_5 Reverse -53 -72 8.25926 0.229
NP_441958.1_5 Forward -68 -58 12.2714 0.00183
NP_441958.1_5 Reverse -57 -67 12.2714 0.00183
NP_440450.1_7 Reverse -367 -381 15.6336 0.255
NP_440203.1_5 Reverse -192 -202 8.53436 0.294
NP_439990.1_5 Forward -123 -110 5.82081 0.272
NP_442911.1_2 Forward -77 -58 15.4374 0.0106
NP_440153.1_5 Reverse -59 -73 9.43936 0.125
NP_442064.1_4 Reverse -252 -271 6.48849 0.25
NP_442064.1_4 Forward -71 -52 4.71854 0.285
NP_442064.1_4 Forward -182 -163 4.12856 0.298
NP_440993.1_3 Reverse -102 -121 -1.47628 0.282
NP_441099.1_5 Forward -128 -109 -0.4922 0.0937
NP_441099.1_5 Reverse -358 -377 -1.7705 0.113
NP_441099.1_5 Forward -77 -58 -8.94866 0.209
NP_442002.1_9 Forward -68 -61 10.7572 0.185
NP_441294.1_7 Forward -71 -57 9.4426 0.244
NP_441646.1_1 Forward -74 -55 15.8307 0.0796
NP_441646.1_1 Forward -384 -365 0.687771 0.245
NP_442438.1_10 Reverse -53 -67 8.84938 0.0718
NP_441000.1_6 Forward -68 -54 3.53951 0.111
NP_441000.1_6 Reverse -57 -71 -2.45868 0.216
NP_441110.1_1 Reverse -112 -131 4.22769 0.296
NP_440147.1_4 Forward -69 -56 9.95071 0.0362
NP_440147.1_4 Reverse -56 -69 8.47575 0.0504
NP_441550.1_8 Reverse -56 -66 12.3692 0.0336
NP_441550.1_8 Forward -69 -59 8.82935 0.112
NP_441916.1_7 Reverse -58 -68 18.4663 0.00144
NP_441916.1_7 Forward -67 -57 10.3048 0.0261
NP_440206.1_4 Forward -134 -115 2.26028 0.289
NP_441041.1_4 Reverse -109 -128 -12.8819 0.276
NP_441041.1_7 Forward -70 -58 8.48655 0.135
NP_442004.1_6 Forward -67 -53 2.94952 0.254
NP_441725.1_4 Forward -72 -58 12.0937 0.0693
NP_441725.1_5 Forward -66 -56 11.2881 0.0247
NP_441725.1_5 Reverse -59 -69 2.04498 0.115
NP_439966.1_7 Forward -69 -59 17.9741 0.00631
NP_439966.1_7 Reverse -56 -66 15.8108 0.0124
NP_439966.1_7 Reverse -366 -376 5.68278 0.214
NP_439966.1_9 Forward -69 -60 0.884706 0.253
NP_442941.1_3 Forward -66 -56 19.9412 0.00262
NP_442941.1_3 Reverse -59 -69 10.7964 0.0116
NP_440289.1_2 Forward -70 -57 11.1307 0.0212
NP_440289.1_2 Reverse -55 -68 6.60746 0.0591
NP_440983.1_2 Forward -143 -124 3.24438 0.297
NP_442281.1_1 Reverse -53 -67 15.9285 0.00992
NP_442281.1_1 Forward -72 -58 11.307 0.0487
NP_440177.1_9 Forward -75 -56 15.5357 0.19
NP_440437.1_1 Forward -73 -54 0.294447 0.172
NP_442012.1_1 Reverse -201 -220 1.67108 0.213
NP_442982.1_5 Reverse -48 -67 -3.44213 0.298
NP_440375.1_8 Reverse -369 -388 8.06259 0.16
NP_441644.1_6 Forward -67 -57 17.3841 0.00127
NP_441644.1_6 Reverse -368 -378 10.501 0.0628
NP_441644.1_6 Reverse -58 -68 10.1076 0.0628
NP_442215.1_2 Reverse -260 -276 -3.38305 0.214
NP_442215.1_2 Forward -120 -104 -3.8747 0.223
NP_442215.1_2 Forward -69 -53 -3.97304 0.225
NP_442177.1_5 Reverse -80 -94 11.3077 0.22
NP_442029.1_6 Reverse -201 -220 4.62101 0.268
NP_442029.1_6 Reverse -115 -134 3.83436 0.275
NP_440253.1_2 Reverse -58 -76 19.7837 0.00589
NP_440929.1_8 Forward -67 -58 19.2726 0.000701
NP_440929.1_8 Reverse -58 -67 19.2726 0.000701
NP_440566.1_6 Reverse -75 -94 21.7306 0.13
NP_442933.1_10 Forward -67 -58 17.601 0.00325
NP_442933.1_10 Reverse -58 -67 17.601 0.00325
NP_441751.2_8 Forward -66 -52 13.9626 0.0133
NP_442926.1_5 Forward -72 -53 9.78484 0.267
NP_442554.1_8 Forward -66 -56 15.9097 0.00747
NP_442554.1_8 Reverse -59 -69 14.1397 0.0144
NP_441762.1_7 Reverse -57 -69 2.98891 0.0676
NP_441762.1_7 Forward -68 -56 2.30059 0.0676
NP_442142.1_4 Reverse -55 -68 16.7349 0.0264
NP_442142.1_4 Forward -70 -57 5.91857 0.178
NP_442142.1_4 Reverse -283 -296 5.13193 0.201
NP_442142.1_4 Reverse -365 -378 4.73861 0.212
NP_442292.1_1 Forward -66 -57 18.486 0.00229
NP_442292.1_1 Reverse -59 -68 9.63616 0.0183
NP_442476.1_6 Reverse -59 -73 8.25939 0.105
NP_442381.1_8 Forward -70 -51 -6.68705 0.164
NP_443009.1_5 Reverse -57 -68 18.3477 0.00265
NP_441715.1_4 Reverse -59 -69 18.8596 0.00741
NP_441715.1_4 Forward -66 -56 14.828 0.0268
NP_440015.1_9 Forward -67 -49 11.3272 0.0927
NP_441448.1_1 Reverse -179 -198 3.24438 0.299
NP_440379.1_5 Forward -181 -162 -4.42544 0.215
NP_441468.1_1 Forward -66 -59 15.8704 0.0124
NP_441468.1_1 Reverse -59 -66 15.8704 0.0124
NP_441020.2_6 Reverse -56 -73 12.9202 0.0824
NP_441015.1_10 Reverse -53 -72 -3.44213 0.189
NP_441673.1_1 Forward -67 -58 20.8459 0.000698
NP_441673.1_1 Reverse -58 -67 20.8459 0.000698
NP_441673.1_1 Forward -11 -2 -8.06341 0.254
NP_441826.1_2 Reverse -52 -66 6.19444 0.0946
NP_441826.1_2 Forward -73 -59 1.08123 0.164
NP_441826.1_2 Forward -67 -53 -0.590395 0.215
NP_441826.1_2 Reverse -362 -376 -1.8687 0.257
NP_441330.1_1 Forward -276 -257 -15.3402 0.275
NP_442868.1_6 Forward -69 -59 10.3048 0.038
NP_442868.1_6 Reverse -56 -66 9.91146 0.038
NP_442868.1_6 Forward -135 -125 0.176696 0.247
NP_441251.1_8 Reverse -43 -56 14.3856 0.254
NP_441251.1_8 Forward -85 -72 13.5261 0.254
NP_441056.1_1 Forward -67 -48 0.491109 0.156
NP_441612.1_2 Forward -67 -57 8.54929 0.21
NP_442808.1_1 Forward -68 -58 18.4657 0.00201
NP_442808.1_1 Reverse -57 -67 8.63269 0.0481
NP_441101.1_10 Reverse -269 -288 -0.4922 0.189
NP_440145.1_3 Forward -77 -58 -5.99873 0.286
NP_442542.1_2 Forward -69 -56 17.6205 0.0422
NP_442542.1_2 Forward -386 -373 7.98409 0.167
NP_442050.1_5 Reverse -56 -66 16.4991 0.00812
NP_442050.1_5 Forward -69 -59 6.96107 0.27
NP_442342.1_9 Reverse -220 -236 2.02515 0.294
NP_441114.1_3 Reverse -191 -200 8.35786 0.231
NP_441114.1_3 Forward -59 -50 7.27622 0.247
NP_440558.1_2 Forward -64 -45 -6.98204 0.284
NP_442789.1_4 Forward -183 -164 -1.96717 0.231
NP_442789.1_4 Reverse -173 -192 -8.45701 0.299
NP_441878.1_6 Forward -68 -58 10.4031 0.0176
NP_441878.1_6 Reverse -57 -67 10.4031 0.0176
NP_441878.1_6 Reverse -51 -61 -7.39479 0.222
NP_441878.1_6 Reverse -209 -219 -7.88644 0.278
NP_441036.1_4 Reverse -148 -167 20.8456 0.0182
NP_441036.1_8 Forward -68 -58 17.7779 0.000554
NP_441036.1_8 Reverse -57 -67 8.33817 0.174
NP_441557.1_5 Forward -67 -58 19.9609 0.000699
NP_441557.1_5 Reverse -58 -67 19.9609 0.000699
NP_441445.1_1 Reverse -49 -68 6.09597 0.156
NP_442066.2_9 Forward -71 -58 10.8357 0.154
NP_442419.1_2 Forward -72 -53 0.786102 0.238
NP_442183.1_1 Forward -67 -53 14.3559 0.0336
NP_442183.1_1 Reverse -58 -72 12.8809 0.05
NP_442183.1_1 Forward -377 -363 4.62115 0.254
NP_440190.1_5 Forward -208 -190 12.1139 0.282
NP_442397.1_9 Forward -67 -48 10.5209 0.246
NP_441116.1_9 Reverse -17 -31 10.816 0.297
NP_440276.1_8 Reverse -75 -94 6.19431 0.294
NP_441549.1_9 Forward -104 -86 -9.32229 0.245
NP_442347.1_2 Forward -66 -57 12.4878 0.056
NP_442347.1_2 Reverse -59 -68 11.1111 0.056
NP_442347.1_2 Reverse -233 -242 3.44131 0.284
NP_442645.1_2 Reverse -50 -69 -6.58872 0.0908
NP_442645.1_2 Forward -75 -56 -12.3902 0.144
NP_442645.1_2 Forward -69 -50 -22.125 0.29
NP_440547.1_1 Forward -135 -116 12.0933 0.19
NP_441037.1_4 Forward -69 -59 6.92787 0.237
NP_442594.1_8 Reverse -128 -147 5.70265 0.241
NP_442594.1_8 Reverse -127 -146 2.75272 0.293
NP_442317.1_6 Forward -72 -53 3.24438 0.264
NP_442317.1_6 Forward -159 -140 2.85105 0.268
NP_441633.1_3 Forward -69 -56 5.62415 0.0481
NP_441633.1_3 Reverse -56 -69 1.39592 0.109
NP_441633.1_3 Forward -221 -208 -4.79893 0.212
NP_440136.1_2 Forward -66 -59 15.9687 0.0123
NP_440136.1_2 Reverse -59 -66 15.9687 0.0123
NP_442590.1_10 Forward -67 -48 5.40766 0.26
NP_442998.1_10 Forward -65 -58 15.5754 0.0102
NP_442998.1_10 Reverse -60 -67 15.5754 0.0102
NP_442998.1_10 Reverse -370 -377 12.5271 0.0457
NP_440299.1_1 Forward -71 -58 18.5049 0.00393
NP_440299.1_1 Reverse -54 -67 4.44361 0.207
NP_441799.1_1 Reverse -54 -68 12.5853 0.0421
NP_441799.1_1 Forward -381 -367 5.80051 0.194
NP_441799.1_1 Forward -71 -57 3.44058 0.298
NP_441007.1_10 Reverse -53 -66 2.77255 0.183
NP_442201.1_10 Forward -78 -59 -4.32711 0.152
NP_440256.1_1 Reverse -55 -74 15.9291 0.00634
NP_441559.1_8 Reverse -63 -77 5.50613 0.0905
NP_441559.1_8 Forward -72 -58 3.44117 0.143
NP_441559.1_8 Forward -224 -210 -5.31028 0.259
NP_441559.1_8 Forward -276 -262 -5.9986 0.271
NP_441559.1_8 Forward -134 -120 -6.19526 0.275
NP_441559.1_8 Forward -16 -2 -6.58858 0.279
NP_442756.1_1 Forward -294 -275 12.1925 0.162
NP_440915.1_6 Forward -71 -57 12.1926 0.0218
NP_441704.1_8 Forward -72 -53 5.40686 0.294
NP_440748.1_5 Reverse -192 -211 11.6025 0.129
NP_442993.1_1 Forward -67 -51 19.7247 0.00378
NP_442386.1_9 Forward -68 -59 15.7322 0.0144
NP_442386.1_9 Reverse -57 -66 13.8639 0.0289
NP_441340.1_5 Forward -66 -59 15.6737 0.0124
NP_441340.1_5 Reverse -59 -66 15.6737 0.0124
NP_441340.1_5 Forward -376 -369 4.07068 0.239
NP_440327.1_6 Forward -388 -369 3.14605 0.285
NP_442240.1_2 Reverse -59 -78 -11.8003 0.145
NP_442714.1_2 Forward -273 -254 18.0924 0.285
NP_440586.1_8 Forward -66 -59 13.2151 0.026
NP_440586.1_8 Reverse -59 -66 13.2151 0.026
NP_440586.1_8 Forward -240 -233 10.7568 0.128
NP_442251.1_6 Forward -66 -59 15.2804 0.0124
NP_442251.1_6 Reverse -59 -66 15.2804 0.0124
NP_440192.1_4 Reverse -118 -137 13.9575 0.169
NP_440684.1_9 Reverse -52 -66 15.8309 0.0845
NP_441262.1_3 Reverse -58 -65 14.7888 0.0223
NP_441262.1_3 Forward -67 -60 14.7888 0.0223
NP_440027.1_3 Reverse -368 -386 12.3097 0.159
NP_440027.1_3 Forward -77 -59 6.01657 0.23
NP_443051.1_1 Reverse -57 -66 10.4228 0.00754
NP_443051.1_1 Forward -68 -59 10.4228 0.00754
NP_441657.1_5 Reverse -179 -198 0.687771 0.205
NP_440439.1_1 Forward -70 -57 2.96921 0.122
NP_440439.1_1 Reverse -55 -68 0.117615 0.202
NP_440439.1_1 Reverse -117 -130 -2.04567 0.293
NP_440372.1_2 Forward -66 -59 16.3621 0.0124
NP_440372.1_2 Reverse -59 -66 16.3621 0.0124
NP_440372.1_2 Forward -376 -369 4.07068 0.262
NP_441789.1_7 Reverse -285 -304 -2.36125 0.257
NP_440316.1_10 Reverse -51 -61 6.96153 0.251
NP_441803.1_2 Forward -66 -47 0.884433 0.243
NP_439977.1_5 Forward -104 -85 12.9791 0.0531
NP_439977.1_5 Forward -73 -54 1.0811 0.196
NP_439977.1_5 Reverse -108 -127 -0.39387 0.225
NP_440139.1_1 Reverse -52 -71 2.35861 0.235
NP_442384.1_10 Reverse -58 -71 19.4888 0.00338
NP_442384.1_10 Forward -67 -54 1.10092 0.268
NP_442114.1_4 Reverse -58 -69 9.20345 0.17
NP_441877.1_7 Forward -72 -53 6.68515 0.218
NP_441018.1_7 Forward -170 -151 13.0775 0.142
NP_442790.1_4 Forward -76 -57 -4.03212 0.13
NP_442262.1_10 Forward -66 -59 14.1988 0.0123
NP_442262.1_10 Reverse -59 -66 14.1988 0.0123
NP_442262.1_10 Reverse -369 -376 11.4455 0.102
NP_441689.1_5 Reverse -56 -66 15.3192 0.0403
NP_441814.1_9 Reverse -67 -86 17.0107 0.0364
NP_440163.1_10 Reverse -55 -65 11.3864 0.169
NP_440344.1_10 Forward -74 -57 -6.451 0.113
NP_440344.1_10 Reverse -361 -378 -7.53264 0.118
NP_440344.1_10 Reverse -51 -68 -7.82764 0.119
NP_440189.1_2 Reverse -50 -69 0.0977854 0.279
NP_441640.1_1 Reverse -53 -72 2.94938 0.287
NP_440297.1_9 Forward -66 -56 9.32148 0.0917
NP_440297.1_9 Forward -153 -143 1.25834 0.282
NP_440297.1_9 Reverse -59 -69 -0.118297 0.282
NP_441896.1_3 Forward -76 -57 1.17943 0.22
NP_440894.1_10 Forward -158 -139 4.22769 0.257
NP_441679.1_1 Reverse -300 -319 -2.65548 0.228
NP_441679.1_6 Forward -72 -53 1.0811 0.243
NP_440999.1_9 Forward -71 -57 12.0943 0.0414
NP_440888.1_2 Reverse -58 -72 16.9119 0.00511
NP_440888.1_2 Forward -67 -53 16.3219 0.00724
NP_440888.1_2 Reverse -262 -276 6.29216 0.241
NP_440888.1_2 Reverse -368 -382 5.70218 0.267
NP_440888.1_2 Reverse -77 -91 5.40719 0.28
NP_440600.1_4 Forward -75 -57 -6.56903 0.285
NP_440052.1_5 Forward -195 -176 -4.13045 0.249
NP_440052.1_8 Forward -303 -284 18.1907 0.0498
NP_441543.1_2 Reverse -59 -68 18.486 0.00236
NP_441543.1_2 Forward -66 -57 16.9127 0.00359
NP_442845.1_2 Reverse -52 -66 16.1259 0.0651
NP_442845.1_4 Forward -69 -50 11.3075 0.178
NP_441319.1_8 Reverse -280 -298 9.0656 0.223
NP_441918.1_7 Reverse -57 -76 -3.04881 0.297
NP_441469.1_8 Forward -68 -59 16.126 0.00797
NP_441469.1_8 Reverse -51 -60 7.76787 0.227
NP_441469.1_8 Reverse -57 -66 6.48957 0.227
NP_443064.1_6 Reverse -144 -154 12.7608 0.0796
NP_443064.1_6 Forward -67 -57 12.5669 0.0796
NP_442578.1_7 Forward -66 -59 14.5921 0.026
NP_442578.1_7 Reverse -59 -66 14.5921 0.026
NP_440710.1_1 Forward -75 -57 -3.91409 0.208
NP_440220.1_4 Forward -338 -319 3.14526 0.226
NP_441462.1_2 Forward -67 -57 11.5831 0.00406
NP_441462.1_2 Reverse -58 -68 11.5831 0.00406
NP_443062.1_1 Reverse -58 -76 6.79079 0.192
NP_441410.1_3 Reverse -49 -68 5.99764 0.23
NP_442204.1_1 Reverse -312 -323 2.81194 0.266
NP_442204.1_1 Forward -71 -60 2.12362 0.266
NP_442204.1_1 Reverse -384 -395 0.0586712 0.284
NP_442204.1_1 Forward -275 -264 -0.334653 0.295
NP_441560.1_8 Reverse -152 -171 12.097 0.268
NP_440516.1_8 Forward -67 -58 16.9127 0.00442
NP_440516.1_8 Reverse -58 -67 16.9127 0.00442
NP_440516.1_8 Forward -377 -368 9.24284 0.0264
NP_442768.1_1 Forward -294 -275 36.6769 0.00000414
NP_442768.1_2 Forward -326 -307 32.0544 0.0000747
NP_441785.1_1 Forward -67 -53 13.2231 0.231
NP_442428.1_5 Forward -66 -59 15.8704 0.0124
NP_442428.1_5 Reverse -59 -66 15.8704 0.0124
NP_442120.1_10 Forward -67 -48 -15.7335 0.294
NP_440673.1_3 Forward -65 -58 12.4288 0.0426
NP_440673.1_3 Reverse -60 -67 12.4288 0.0426
NP_440673.1_3 Reverse -370 -377 9.77388 0.167
NP_440673.1_3 Forward -182 -175 6.3323 0.283
NP_440673.1_7 Reverse -47 -66 1.37609 0.251
NP_440865.1_9 Reverse -52 -71 11.4058 0.0497
NP_441052.1_2 Forward -67 -57 19.9412 0.00106
NP_441052.1_2 Reverse -58 -68 10.5014 0.0285
NP_441052.1_2 Forward -118 -108 2.14332 0.216
NP_441052.1_2 Reverse -109 -119 1.94665 0.221
NP_441052.1_2 Reverse -368 -378 1.06167 0.252
NP_442219.1_9 Forward -66 -57 17.7976 0.00718
NP_442219.1_9 Reverse -59 -68 8.35786 0.0681
NP_442219.1_9 Forward -214 -205 3.04799 0.206
NP_440436.1_4 Reverse -59 -68 18.1905 0.00233
NP_440436.1_4 Forward -66 -57 17.2072 0.00233
NP_440436.1_4 Reverse -369 -378 4.32588 0.272
NP_442864.1_7 Forward -383 -365 5.52568 0.274
NP_440314.1_9 Reverse -59 -78 1.86774 0.0872
NP_440314.1_9 Reverse -146 -165 -8.35868 0.247
NP_442907.1_7 Reverse -246 -265 15.2408 0.192
NP_441719.1_4 Forward -66 -59 16.3621 0.0124
NP_441719.1_4 Reverse -59 -66 16.3621 0.0124
NP_441733.1_10 Reverse -55 -68 9.95071 0.106
NP_441004.1_1 Forward -304 -285 -4.91709 0.175
NP_441004.1_1 Forward -277 -258 -18.1918 0.298
NP_442366.1_3 Forward -68 -50 19.587 0.0119
NP_441437.1_1 Reverse -3 -22 7.27595 0.27
NP_442873.1_9 Reverse -48 -67 7.27514 0.237
NP_441115.1_2 Forward -209 -190 11.7 0.171
NP_442206.1_10 Reverse -58 -73 -0.118434 0.284
NP_443054.1_2 Reverse -49 -63 5.89945 0.212
NP_443054.1_2 Reverse -56 -70 3.14618 0.24
NP_443054.1_2 Forward -69 -55 1.37622 0.247
NP_441851.1_10 Forward -68 -58 16.008 0.00552
NP_441851.1_10 Reverse -57 -67 15.8113 0.00552
NP_442208.1_5 Reverse -207 -226 -10.1286 0.296
NP_441668.1_4 Forward -77 -58 3.24438 0.187
NP_442515.1_1 Reverse -57 -71 4.71948 0.107
NP_442515.1_1 Reverse -333 -347 0.687908 0.183
NP_442515.1_1 Forward -68 -54 0.687908 0.183
NP_442515.1_1 Reverse -144 -158 -2.55701 0.277
NP_440463.1_8 Forward -131 -112 11.7597 0.203
NP_441349.1_10 Reverse -48 -67 5.211 0.0457
NP_440432.1_9 Reverse -59 -74 3.91314 0.0797
NP_442843.1_1 Reverse -59 -78 -4.03212 0.232
NP_442843.1_1 Forward -171 -152 -10.7186 0.28
NP_440474.1_8 Forward -66 -52 9.43874 0.16
NP_441477.1_10 Reverse -51 -69 0.412472 0.283
NP_442450.1_5 Reverse -56 -66 9.32148 0.115
NP_440588.1_2 Reverse -49 -68 1.27776 0.138
NP_440040.1_3 Forward -15 -5 18.3679 0.201
NP_440040.1_4 Forward -309 -290 29.7937 0.000815
NP_440040.1_5 Forward -35 -16 16.0843 0.271
NP_440040.1_6 Forward -92 -73 25.2705 0.0072
NP_440040.1_7 Forward -193 -176 21.1792 0.0678
NP_440040.1_8 Forward -266 -247 21.2465 0.0583
NP_441003.1_9 Reverse -100 -119 13.2741 0.213
NP_441570.1_1 Forward -377 -359 -7.749 0.0949
NP_441570.1_1 Forward -67 -49 -9.51896 0.139
NP_441570.1_1 Reverse -52 -70 -16.1071 0.238
NP_441078.1_4 Forward -67 -58 19.6659 0.0007
NP_441078.1_4 Reverse -58 -67 19.6659 0.0007
NP_441078.1_4 Reverse -2 -11 -0.786921 0.207
NP_441078.1_4 Forward -11 -2 -1.57357 0.266
NP_442729.1_7 Forward -200 -182 6.11567 0.286
NP_442729.1_8 Forward -71 -58 9.06573 0.125
NP_442348.1_2 Forward -199 -190 12.2911 0.218
NP_442443.1_1 Forward -279 -260 4.32602 0.158
NP_440526.1_3 Forward -66 -55 10.1862 0.0646
NP_441432.1_8 Reverse -57 -66 16.8143 0.00595
NP_441432.1_8 Forward -378 -369 15.0444 0.0182
NP_441432.1_8 Forward -68 -59 8.25953 0.0755
NP_441432.1_8 Reverse -1 -10 3.14632 0.259
NP_442320.1_8 Reverse -52 -66 13.9626 0.0144
NP_442320.1_8 Forward -73 -59 5.30946 0.0394
NP_442344.1_7 Reverse -369 -388 -7.4737 0.183
NP_441732.1_2 Reverse -165 -181 -8.0046 0.105
NP_441732.1_2 Forward -71 -55 -15.5761 0.151
NP_440760.1_1 Reverse -58 -77 -1.96717 0.0328
NP_440760.1_1 Forward -67 -48 -23.305 0.293
NP_442797.1_7 Reverse -367 -385 0.609134 0.272
NP_440199.1_10 Reverse -55 -65 16.7946 0.0381
NP_442751.1_2 Reverse -367 -386 3.83357 0.263
NP_441072.1_2 Reverse -47 -66 8.06259 0.24
NP_442400.1_1 Forward -70 -51 -2.55715 0.243
NP_442489.1_2 Reverse -47 -66 3.93269 0.227
NP_442489.1_7 Forward -67 -58 20.1576 0.000695
NP_442489.1_7 Reverse -58 -67 20.1576 0.000695
NP_442489.1_7 Reverse -2 -11 -1.77023 0.247
NP_442489.1_7 Reverse -368 -377 -1.86856 0.259
NP_440559.1_1 Forward -66 -57 17.4043 0.00658
NP_440559.1_1 Reverse -59 -68 8.75118 0.0586
NP_441659.2_8 Forward -67 -57 18.1713 0.00133
NP_441659.2_8 Reverse -58 -68 11.9764 0.0147
NP_442913.1_10 Forward -386 -367 -3.93378 0.221
NP_441800.1_3 Reverse -104 -122 7.88563 0.286
NP_442346.1_5 Reverse -57 -67 16.6963 0.00248
NP_442346.1_5 Forward -68 -58 9.02648 0.118
NP_440545.1_3 Reverse -353 -370 -3.50107 0.206
NP_440545.1_3 Reverse -54 -71 -5.46769 0.25
NP_440545.1_5 Forward -381 -364 4.26707 0.258
NP_440025.1_1 Forward -137 -118 5.40766 0.296
NP_440025.1_3 Reverse -259 -273 14.4833 0.235
NP_440250.1_1 Reverse -48 -66 9.65558 0.273
NP_440459.1_2 Reverse -43 -60 10.0686 0.21
NP_442603.1_7 Reverse -58 -72 8.3571 0.176
NP_441888.1_7 Forward -72 -58 22.4191 0.0094
NP_440170.1_5 Forward -182 -163 5.30933 0.21
NP_441502.1_3 Forward -273 -254 6.78429 0.251
NP_441833.1_4 Forward -66 -59 15.9687 0.0124
NP_441833.1_4 Reverse -59 -66 15.9687 0.0124
NP_442162.1_9 Forward -66 -59 16.2637 0.0124
NP_442162.1_9 Reverse -59 -66 16.2637 0.0124
NP_442162.1_9 Reverse -369 -376 9.28223 0.0694
NP_440671.1_4 Reverse -52 -66 17.2075 0.0227
NP_440671.1_4 Reverse -362 -376 13.7659 0.0748
NP_441341.1_1 Forward -174 -155 16.3224 0.245
NP_442140.1_3 Reverse -59 -69 14.238 0.0486
NP_442140.1_3 Forward -66 -56 4.40493 0.243
NP_441609.1_1 Reverse -91 -110 -0.787193 0.242
NP_440875.1_9 Reverse -234 -244 13.0442 0.0873
NP_440875.1_9 Reverse -60 -70 8.46937 0.233
NP_441813.1_5 Forward -69 -59 19.4496 0.00647
NP_441813.1_5 Reverse -56 -66 15.9097 0.01
NP_441813.1_5 Reverse -366 -376 2.92996 0.181
NP_440594.1_6 Reverse -274 -293 8.65176 0.22
NP_440590.1_4 Reverse -59 -72 13.0973 0.013
NP_440590.1_4 Reverse -121 -134 2.77255 0.0813
NP_440590.1_4 Forward -66 -53 2.57589 0.0845
NP_440567.1_1 Forward -66 -52 6.3911 0.0837
NP_440567.1_6 Forward -66 -47 6.88262 0.228
NP_442497.1_10 Forward -66 -57 10.4228 0.0087
NP_442497.1_10 Reverse -59 -68 10.4228 0.0087
NP_440821.1_4 Reverse -56 -66 18.2696 0.00448
NP_440821.1_4 Forward -69 -59 10.2065 0.0163
NP_441239.1_9 Forward -69 -57 14.1986 0.0288
NP_441239.1_9 Reverse -56 -68 6.92215 0.173
NP_441951.1_4 Forward -383 -364 1.47442 0.283
NP_440400.1_1 Reverse -180 -199 0.981987 0.263
NP_441892.1_1 Reverse -49 -66 -3.79607 0.249
NP_442270.1_9 Reverse -47 -66 -9.047 0.226
NP_441017.1_6 Forward -71 -57 11.9953 0.232
NP_441017.1_6 Reverse -54 -68 11.7987 0.242
NP_441017.1_8 Reverse -141 -156 13.2546 0.174
NP_441874.1_1 Reverse -48 -62 11.0127 0.25
NP_440949.1_7 Forward -75 -56 15.4366 0.162
NP_442138.1_1 Forward -69 -50 1.96529 0.258
NP_440546.1_4 Reverse -58 -68 11.8882 0.0679
NP_440546.1_4 Forward -67 -57 10.046 0.109
NP_443033.1_3 Reverse -59 -78 12.6841 0.268
NP_441230.1_10 Forward -93 -74 14.1591 0.293
NP_440675.1_1 Forward -184 -165 3.04771 0.258
NP_440462.1_6 Forward -69 -59 17.2863 0.00752
NP_440462.1_6 Reverse -56 -66 7.74818 0.0699
NP_440868.1_4 Reverse -54 -66 5.93884 0.0879
NP_440868.1_4 Forward -381 -369 3.48056 0.135
NP_440868.1_4 Forward -71 -59 3.48056 0.135
NP_440532.1_6 Reverse -71 -90 8.75091 0.286
NP_441879.1_3 Forward -66 -47 2.85105 0.261
NP_442402.1_4 Forward -56 -37 -3.34455 0.214
NP_442402.1_4 Forward -57 -38 -8.94939 0.285
NP_440696.1_3 Forward -387 -369 -3.91409 0.293
NP_442039.1_4 Forward -66 -59 15.1821 0.0124
NP_442039.1_4 Reverse -59 -66 15.1821 0.0124
NP_441926.1_3 Forward -67 -51 15.2998 0.0428
NP_442837.1_3 Forward -66 -59 15.7721 0.0124
NP_442837.1_3 Reverse -59 -66 15.7721 0.0124
NP_439994.1_3 Forward -68 -49 9.02386 0.264
NP_442053.1_1 Forward -67 -58 18.3876 0.0007
NP_442053.1_1 Reverse -58 -67 18.3876 0.0007
NP_442053.1_1 Reverse -368 -377 4.62128 0.235
NP_440505.1_3 Reverse -56 -66 16.303 0.00696
NP_440505.1_3 Forward -69 -59 15.9097 0.00857
NP_440505.1_3 Forward -379 -369 5.97822 0.202
NP_440505.1_3 Forward -13 -3 4.60159 0.277
NP_441959.1_8 Forward -260 -247 8.70929 0.286
NP_441203.1_1 Reverse -59 -78 -12.9802 0.149
NP_441203.1_1 Forward -66 -47 -20.5517 0.297
NP_441203.1_2 Reverse -115 -134 -3.93378 0.209
NP_442844.1_6 Forward -300 -281 18.3873 0.29
NP_442532.1_7 Reverse -58 -72 5.89945 0.171
NP_440914.1_1 Forward -67 -57 17.5935 0.000537
NP_440914.1_1 Reverse -190 -200 12.3236 0.0614
NP_440914.1_1 Forward -377 -367 10.1766 0.151
NP_440914.1_1 Reverse -58 -68 8.6151 0.186
NP_441011.1_8 Reverse -59 -68 16.9127 0.00602
NP_441011.1_8 Forward -66 -57 8.25953 0.144
NP_442533.1_1 Forward -298 -279 -14.3569 0.242
NP_442533.1_1 Forward -292 -273 -16.0285 0.262
NP_442533.1_6 Forward -67 -58 17.2076 0.00137
NP_442533.1_6 Reverse -58 -67 17.2076 0.00137
NP_442533.1_6 Forward -118 -109 2.458 0.255
NP_442232.1_3 Reverse -50 -69 -12.6852 0.282
NP_442232.1_3 Reverse -202 -221 -15.9302 0.299
NP_441482.1_7 Forward -73 -59 14.5526 0.0117
NP_441482.1_7 Reverse -52 -66 -8.94853 0.193
NP_439944.1_9 Forward -66 -56 19.0562 0.00329
NP_440116.1_8 Reverse -369 -388 -8.26035 0.25
NP_441527.1_4 Reverse -139 -158 -12.9396 0.296
NP_440115.1_6 Reverse -172 -182 9.12481 0.121
NP_440115.1_6 Forward -380 -370 6.27322 0.191
NP_442728.1_1 Forward -222 -203 9.3409 0.239
NP_439965.1_1 Reverse -49 -68 -5.80207 0.211
NP_441347.1_5 Reverse -356 -370 8.06211 0.298
NP_441961.1_4 Reverse -84 -103 2.45773 0.295
NP_440608.1_6 Reverse -369 -388 3.73524 0.282
NP_441602.1_3 Forward -103 -84 -5.01543 0.277
NP_441106.1_1 Forward -68 -59 18.191 0.0028
NP_441106.1_1 Reverse -57 -66 9.63616 0.0311
NP_439903.1_6 Forward -70 -51 -0.29631 0.28
NP_441286.1_1 Forward -68 -56 11.8387 0.0114
NP_441286.1_1 Reverse -57 -69 6.03717 0.0258
NP_441286.1_1 Forward -378 -366 1.21895 0.091
NP_440670.1_8 Forward -67 -58 18.3876 0.000699
NP_440670.1_8 Reverse -58 -67 18.3876 0.000699
NP_441930.1_2 Reverse -51 -61 12.8614 0.248
NP_440886.1_7 Forward -68 -58 17.7774 0.0011
NP_440886.1_7 Reverse -57 -67 7.94438 0.0805
NP_440828.1_4 Forward -140 -121 -4.22953 0.246
NP_442072.1_9 Reverse -57 -75 -15.3205 0.177
NP_441808.1_8 Forward -301 -282 8.94757 0.259
NP_440907.2_8 Reverse -59 -69 7.94438 0.117
NP_441021.1_1 Forward -66 -47 4.52268 0.076
NP_441021.1_1 Reverse -59 -78 -6.98204 0.181
NP_441021.1_8 Forward -72 -54 1.88744 0.256
NP_441463.1_3 Reverse -48 -67 -10.227 0.291
NP_441463.1_6 Reverse -56 -70 5.73949 0.287
NP_441626.1_2 Forward -66 -59 15.7721 0.0124
NP_441626.1_2 Reverse -59 -66 15.7721 0.0124
NP_442365.1_7 Reverse -54 -73 -1.86883 0.196
NP_442365.1_7 Reverse -364 -383 -5.9004 0.282
NP_442794.1_1 Forward -71 -59 7.61046 0.136
NP_442615.1_1 Reverse -49 -67 3.95239 0.0504
NP_441962.1_4 Reverse -53 -72 1.17943 0.106
NP_440387.1_1 Reverse -58 -74 15.5948 0.00527
NP_440387.1_1 Forward -67 -51 6.54838 0.0282
NP_440855.1_5 Forward -69 -50 1.96529 0.295
NP_441488.1_7 Forward -292 -273 2.16274 0.274
NP_440634.1_10 Reverse -283 -302 14.2566 0.131
NP_441993.1_1 Reverse -52 -71 18.3195 0.0394
NP_441993.1_1 Reverse -204 -223 1.65431 0.273
NP_440143.1_7 Reverse -185 -199 19.0758 0.229
NP_440114.1_10 Forward -67 -53 12.291 0.0866
NP_442087.1_2 Forward -308 -289 13.0182 0.262
NP_440766.1_4 Reverse -54 -68 8.06273 0.0871
NP_439910.1_2 Reverse -50 -67 -21.4956 0.183
NP_442867.1_8 Forward -358 -339 8.35759 0.236
NP_440457.1_1 Forward -71 -59 6.33216 0.123
NP_440457.1_1 Reverse -87 -99 1.61227 0.232
NP_440457.1_1 Reverse -54 -66 0.0389777 0.25
NP_440798.1_6 Reverse -369 -382 4.54251 0.145
NP_440801.1_8 Forward -68 -49 -2.36049 0.299
NP_442509.1_9 Reverse -58 -68 16.2041 0.00739
NP_442509.1_9 Forward -67 -57 8.14104 0.192
NP_441253.1_1 Reverse -114 -133 4.12936 0.29
NP_440554.1_4 Reverse -59 -69 16.4996 0.0189
NP_440554.1_4 Forward -66 -56 7.05986 0.106
NP_441885.1_5 Forward -67 -57 20.9245 0.000538
NP_441885.1_5 Reverse -58 -68 11.4848 0.00668
NP_441885.1_5 Forward -377 -367 0.373358 0.164
NP_441885.1_5 Reverse -91 -101 -1.59326 0.273
NP_442228.1_3 Forward -317 -298 -1.18052 0.139
NP_440478.1_10 Reverse -122 -136 6.09611 0.3
NP_442341.1_7 Reverse -57 -71 12.1926 0.0467
NP_442341.1_7 Forward -68 -54 8.35772 0.0881
NP_442341.1_7 Reverse -374 -388 3.8345 0.21
NP_442341.1_7 Forward -378 -364 3.34284 0.227
NP_442341.1_9 Forward -69 -55 17.6985 0.0235
NP_441756.1_5 Forward -71 -52 -0.39387 0.244
NP_442395.2_4 Forward -68 -49 1.6703 0.235
NP_440423.1_6 Reverse -50 -69 -4.72043 0.131
NP_443000.1_7 Reverse -56 -66 17.0896 0.00865
NP_443000.1_7 Forward -69 -59 11.5831 0.0344
NP_440507.2_3 Reverse -49 -68 14.6499 0.121
NP_441842.1_1 Reverse -370 -383 13.5883 0.143
NP_440275.1_3 Forward -69 -59 15.418 0.0178
NP_440275.1_3 Reverse -56 -66 8.1415 0.0602
NP_440091.1_1 Reverse -54 -66 16.4603 0.0153
NP_443060.1_5 Reverse -50 -69 7.66846 0.226
NP_442275.1_1 Forward -370 -351 0.687771 0.285
NP_440679.1_10 Forward -293 -274 -11.2103 0.182
NP_440175.1_4 Reverse -50 -69 -12.4886 0.235
NP_442495.1_4 Reverse -266 -276 14.7297 0.16
NP_440149.1_8 Reverse -52 -71 6.78429 0.064
NP_440149.1_8 Forward -67 -48 -1.18052 0.157
NP_440149.1_8 Reverse -58 -77 -1.47551 0.16
NP_441105.1_3 Forward -382 -363 -6.09707 0.229
NP_441105.1_3 Reverse -78 -97 -7.76869 0.259
NP_440216.1_1 Reverse -58 -72 7.27608 0.00942
NP_440216.1_1 Forward -67 -53 -1.8687 0.0412
NP_440216.1_1 Reverse -368 -382 -12.2918 0.256
NP_440172.1_1 Forward -67 -57 15.0247 0.00945
NP_440172.1_1 Reverse -58 -68 8.73149 0.0586
NP_440172.1_1 Forward -377 -367 3.02829 0.251
NP_440249.1_2 Forward -255 -245 14.8275 0.273
NP_442015.1_10 Forward -71 -58 12.8023 0.0365
NP_442015.1_10 Reverse -54 -67 0.60927 0.221
NP_441226.1_7 Forward -66 -59 14.4934 0.0123
NP_441226.1_7 Reverse -59 -66 14.4934 0.0123
NP_441226.1_7 Reverse -375 -382 6.52862 0.253
NP_441111.1_7 Forward -66 -58 18.7023 0.00294
NP_441111.1_7 Reverse -59 -67 18.7023 0.00294
NP_442379.1_10 Reverse -51 -68 -3.10775 0.248
NP_441766.1_2 Forward -67 -58 17.5026 0.00297
NP_441766.1_2 Reverse -58 -67 17.5026 0.00297
NP_441766.1_2 Reverse -368 -377 4.91628 0.154
NP_442417.1_5 Reverse -58 -72 19.7641 0.0165
NP_440416.1_9 Reverse -367 -386 -10.0303 0.137
NP_440416.1_9 Reverse -51 -70 -15.8318 0.201
NP_443052.1_8 Reverse -48 -67 -13.0786 0.273
NP_440591.1_9 Reverse -51 -69 23.7169 0.00607
NP_442564.1_10 Reverse -375 -389 8.75105 0.296
NP_440261.1_5 Reverse -59 -72 -11.9771 0.268
NP_440988.1_10 Reverse -366 -380 14.7737 0.131
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTTACATCTTCTGGGCCGGTTGGCAATCGGGATTGTATGGCCTAGTCCTACTTGGTCTGGTTACCAGTGTAGTTTCCATCTACTACTACATCCGGGTGGTGAAAATGATGGTGGTGAAGGAGCCCCAGGAAATGTCCGAAGTAATCAAAAATTACCCGGCCATCAAATGGAATTTACCCGGCATGCGTCCCCTACAGGTGGGCATTGTCGCTACTTTGGTTGCTACCTCGCTGGCAGGTATTCTGGCTAATCCCCTCTTTAACCTCGCCACCGATTCCGTGGTCAGCACCAAGATGTTGCAGACAGCCCTCCAGCAAACAGGAGAAACTCCGGCGATCGCCATTTCCCATGATTTACCCTAGGGGTATCAGGAAATATTGCTTTGCAGGCAAAAGCCA

CDS

ATGAGTGTAACTATAGAAACCGATTTAAAGGAGATCTTGGGGGAAATTAAGACCAAACTCGATGACCTCCAAAAAGATGTAACTTCTCTTAAGATCGATATGGCAACGGTGAAAACCGAGTTATCTGCGGTCAGGATGGAGATAGGTACAGTCAAGGATGATGTTAAAGATGTCAAAGGGCGGGCTAATGCTCAAATTTGGGCGTTGATTCTTGCCGTCATCGGAGCCATAATTACCACCTTGGTGCGTTTTGGCATTTTCCCTAATCCCTAA

Protein

MSVTIETDLKEILGEIKTKLDDLQKDVTSLKIDMATVKTELSAVRMEIGTVKDDVKDVKGRANAQIWALILAVIGAIITTLVRFGIFPNP