Your browser is old and dusty. Try Google Chrome!

Details for smr0008

ORF smr0008
Accession NP_440415.1
Symbol psbJ
Category Photosystem II
Definition photosystem II PsbJ protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -195 -181 11.5043 0.242
NP_441061.1_2 Forward -194 -180 13.9626 0.0392
NP_441061.1_2 Reverse -187 -201 1.96621 0.179
NP_440795.1_7 Forward -194 -187 14.6904 0.0123
NP_440795.1_7 Reverse -187 -194 14.6904 0.0123
NP_440694.1_7 Reverse -116 -135 19.469 0.194
NP_441418.1_6 Forward -195 -176 -11.2103 0.0462
NP_441480.1_5 Forward -83 -64 10.3242 0.248
NP_440897.1_9 Forward -290 -272 12.8997 0.222
NP_441453.1_1 Reverse -179 -197 2.96833 0.281
NP_441453.1_1 Forward -202 -184 2.87 0.282
NP_441453.1_4 Reverse -186 -194 16.539 0.00633
NP_441453.1_4 Forward -195 -187 16.539 0.00633
NP_441453.1_4 Reverse -238 -246 4.24765 0.259
NP_442151.1_6 Reverse -186 -200 12.7826 0.0674
NP_441818.1_6 Reverse -179 -193 8.75105 0.274
NP_441818.1_9 Forward -84 -65 -9.14533 0.287
NP_441818.1_9 Forward -90 -71 -10.6203 0.296
NP_441818.1_9 Forward -81 -62 -10.817 0.299
NP_440226.1_1 Forward -195 -176 5.99764 0.139
NP_440259.1_4 Forward -263 -249 12.3957 0.254
NP_441098.1_3 Reverse -327 -346 0.197422 0.25
NP_440150.1_6 Forward -198 -179 15.0441 0.0993
NP_440996.1_3 Forward -79 -61 9.36059 0.281
NP_442173.1_1 Forward -194 -186 15.4574 0.00633
NP_442173.1_1 Reverse -187 -195 15.4574 0.00633
NP_442752.1_4 Forward -195 -188 13.8055 0.0199
NP_442752.1_4 Reverse -186 -193 13.8055 0.0199
NP_443027.1_4 Reverse -184 -194 13.943 0.0452
NP_443027.1_4 Forward -197 -187 6.46988 0.275
NP_440784.1_7 Forward -194 -187 15.9687 0.0123
NP_440784.1_7 Reverse -187 -194 15.9687 0.0123
NP_440784.1_7 Reverse -239 -246 10.2655 0.0801
NP_440061.1_9 Reverse -184 -198 11.7987 0.105
NP_439979.1_9 Forward -236 -218 7.39397 0.288
NP_442062.1_8 Forward -195 -185 19.4496 0.000558
NP_442062.1_8 Reverse -186 -196 17.6796 0.00193
NP_441859.1_3 Reverse -185 -204 18.6815 0.0348
NP_440304.1_4 Forward -197 -187 17.9746 0.00654
NP_440304.1_4 Reverse -184 -194 9.91146 0.051
NP_440304.1_4 Forward -249 -239 3.51995 0.296
NP_442242.1_4 Forward -194 -187 14.3954 0.0124
NP_442242.1_4 Reverse -187 -194 14.3954 0.0124
NP_439918.1_2 Reverse -274 -293 5.60432 0.154
NP_439918.1_3 Forward -81 -62 8.45592 0.252
NP_442359.1_10 Forward -89 -70 15.4374 0.281
NP_441208.1_9 Forward -198 -184 17.1092 0.0647
NP_441208.1_9 Forward -66 -52 10.1277 0.194
NP_440132.1_1 Forward -197 -179 8.18062 0.28
NP_440518.1_4 Forward -368 -349 11.9958 0.228
NP_442110.1_7 Reverse -186 -200 0.786239 0.248
NP_442259.1_7 Forward -221 -202 18.0924 0.157
NP_440330.1_2 Forward -207 -188 16.3224 0.178
NP_440856.1_4 Forward -202 -183 -1.96717 0.205
NP_440856.1_7 Forward -198 -179 -0.0988766 0.167
NP_441083.1_5 Reverse -186 -196 19.3512 0.000718
NP_441083.1_5 Forward -195 -185 11.3864 0.0159
NP_439957.1_9 Forward -350 -331 4.72643 0.3
NP_442827.1_8 Reverse -178 -197 2.06362 0.167
NP_441738.1_2 Forward -193 -186 15.28 0.0102
NP_441738.1_2 Reverse -188 -195 15.28 0.0102
NP_441738.1_2 Reverse -59 -66 8.29857 0.176
NP_440209.1_1 Reverse -186 -194 18.1123 0.00295
NP_440209.1_1 Forward -195 -187 18.1123 0.00295
NP_442398.1_4 Forward -392 -373 7.57013 0.244
NP_441713.1_1 Forward -201 -182 -2.75381 0.113
NP_441770.1_5 Reverse -49 -68 7.7676 0.152
NP_443013.1_8 Reverse -175 -193 8.7706 0.258
NP_442111.1_4 Forward -196 -182 9.73436 0.0587
NP_442111.1_4 Reverse -185 -199 3.63784 0.236
NP_441624.1_7 Forward -228 -214 9.63603 0.218
NP_440343.1_9 Forward -76 -57 15.0441 0.139
NP_440906.1_5 Forward -194 -187 15.8704 0.0124
NP_440906.1_5 Reverse -187 -194 15.8704 0.0124
NP_440747.1_10 Forward -198 -186 7.80712 0.00223
NP_440747.1_10 Reverse -183 -195 7.70879 0.00236
NP_440747.1_10 Forward -225 -213 -2.4193 0.0434
NP_441130.1_10 Reverse -184 -198 11.6026 0.106
NP_441130.1_10 Forward -197 -183 8.84938 0.131
NP_441486.1_1 Reverse -183 -197 -3.54032 0.179
NP_441486.1_10 Reverse -309 -326 16.71 0.167
NP_442634.1_4 Forward -197 -183 12.7826 0.0373
NP_442634.1_4 Reverse -184 -198 4.81781 0.0721
NP_441265.1_3 Forward -201 -187 5.99778 0.181
NP_441265.1_3 Forward -253 -239 4.42448 0.181
NP_441639.1_3 Reverse -185 -204 5.01433 0.264
NP_440403.1_4 Reverse -177 -196 -1.86883 0.174
NP_443018.1_3 Forward -194 -187 14.8871 0.0123
NP_443018.1_3 Reverse -187 -194 14.8871 0.0123
NP_443018.1_3 Forward -246 -239 4.26735 0.267
NP_443018.1_3 Reverse -239 -246 4.16902 0.278
NP_441316.1_7 Forward -197 -182 14.7295 0.0486
NP_441316.1_7 Reverse -184 -199 13.6479 0.0486
NP_441634.1_8 Forward -224 -210 11.6026 0.0569
NP_441634.1_8 Forward -239 -225 0.491246 0.228
NP_441634.1_8 Forward -197 -183 -2.65535 0.295
NP_441634.1_9 Reverse -214 -233 10.0284 0.262
NP_440376.1_1 Forward -195 -186 19.4693 0.000692
NP_440376.1_1 Reverse -186 -195 19.4693 0.000692
NP_440376.1_1 Reverse -213 -222 4.81794 0.149
NP_441857.1_5 Forward -254 -236 1.39578 0.297
NP_442687.1_7 Forward -196 -186 18.5646 0.0028
NP_442687.1_7 Reverse -185 -195 15.8113 0.0125
NP_442485.1_3 Forward -197 -178 -1.37718 0.257
NP_442485.1_3 Forward -239 -220 -5.31042 0.289
NP_441013.1_3 Forward -253 -234 5.70265 0.281
NP_441422.1_7 Reverse -184 -201 -0.551145 0.168
NP_441950.1_7 Forward -81 -62 2.65439 0.175
NP_440360.1_10 Reverse -188 -202 8.45605 0.227
NP_442658.1_1 Reverse -184 -194 18.7607 0.00222
NP_442658.1_1 Forward -197 -187 17.6791 0.00565
NP_442658.1_1 Forward -249 -239 12.6642 0.0497
NP_442198.1_7 Reverse -235 -254 10.7167 0.228
NP_440141.1_8 Forward -81 -62 7.86593 0.232
NP_441414.1_9 Reverse -186 -205 -2.16383 0.111
NP_441414.1_9 Forward -195 -176 -5.50708 0.177
NP_441958.1_5 Forward -196 -186 20.5312 0.000966
NP_441958.1_5 Reverse -185 -195 12.2714 0.00183
NP_440450.1_7 Forward -135 -121 16.1252 0.226
NP_440203.1_5 Reverse -189 -199 11.2876 0.2
NP_439905.1_1 Reverse -187 -200 9.85238 0.216
NP_440984.1_7 Reverse -181 -195 10.6193 0.122
NP_440984.1_7 Forward -200 -186 10.0294 0.126
NP_440984.1_7 Forward -224 -210 5.40779 0.257
NP_442376.1_2 Forward -200 -181 -11.1119 0.286
NP_442690.1_1 Reverse -26 -45 -16.1268 0.283
NP_442911.1_2 Forward -205 -186 11.8975 0.0131
NP_442911.1_2 Reverse -176 -195 5.89931 0.0311
NP_442051.1_9 Forward -86 -67 19.4017 0.19
NP_440993.1_2 Reverse -181 -197 4.68009 0.249
NP_440993.1_3 Reverse -59 -78 5.2102 0.156
NP_440993.1_3 Forward -205 -186 -1.96793 0.292
NP_441099.1_5 Forward -205 -186 -8.26035 0.191
NP_442002.1_9 Forward -196 -189 14.1004 0.074
NP_442002.1_9 Reverse -185 -192 10.7572 0.185
NP_441646.1_1 Forward -229 -210 2.45773 0.218
NP_442438.1_10 Reverse -181 -195 5.50613 0.132
NP_442438.1_10 Forward -200 -186 5.30946 0.135
NP_441000.1_6 Forward -196 -182 -3.04867 0.221
NP_441000.1_6 Forward -248 -234 -3.93365 0.225
NP_442771.1_1 Forward -197 -179 14.4738 0.0174
NP_442771.1_1 Reverse -184 -202 -3.02911 0.166
NP_440147.1_4 Reverse -184 -197 13.0973 0.0326
NP_440147.1_4 Forward -197 -184 12.114 0.0326
NP_441125.1_6 Reverse -315 -328 9.45906 0.254
NP_441550.1_8 Forward -197 -187 19.8424 0.00352
NP_441550.1_8 Reverse -184 -194 10.501 0.066
NP_441916.1_7 Forward -195 -185 18.4663 0.00144
NP_441916.1_7 Reverse -186 -196 16.893 0.00407
NP_441916.1_10 Reverse -205 -224 2.26107 0.25
NP_440345.1_3 Reverse -29 -43 12.6166 0.233
NP_440345.1_5 Forward -40 -26 16.0528 0.263
NP_440465.1_10 Reverse -183 -202 8.16093 0.173
NP_440465.1_10 Forward -198 -179 1.0811 0.283
NP_441041.1_7 Forward -198 -186 18.593 0.00508
NP_441041.1_7 Reverse -183 -195 16.2608 0.0165
NP_443063.1_2 Reverse -56 -75 7.86593 0.283
NP_442004.1_6 Reverse -186 -200 14.8476 0.0661
NP_441725.1_5 Reverse -187 -197 18.7612 0.0119
NP_441725.1_5 Forward -194 -184 9.02648 0.0553
NP_441725.1_5 Reverse -239 -249 5.48657 0.115
NP_439966.1_7 Reverse -184 -194 17.4824 0.00636
NP_439966.1_7 Forward -197 -187 8.14104 0.14
NP_439966.1_9 Reverse -184 -193 10.7178 0.0863
NP_439966.1_9 Forward -197 -188 0.983037 0.253
NP_442941.1_3 Forward -194 -184 2.53664 0.14
NP_442941.1_3 Reverse -187 -197 2.43831 0.14
NP_440289.1_2 Reverse -183 -196 12.999 0.0132
NP_440289.1_2 Forward -198 -185 4.73917 0.0649
NP_440983.1_5 Reverse -60 -79 0.884433 0.214
NP_440983.1_5 Reverse -186 -205 -8.16202 0.294
NP_442281.1_1 Reverse -181 -195 17.8952 0.00513
NP_442281.1_1 Forward -200 -186 16.5185 0.00772
NP_441334.1_7 Reverse -170 -189 -6.98204 0.12
NP_441334.1_7 Forward -197 -178 -18.9784 0.275
NP_441079.1_7 Forward -334 -315 3.24359 0.168
NP_442012.1_1 Reverse -180 -199 15.5357 0.058
NP_442012.1_1 Forward -201 -182 13.4708 0.058
NP_442012.1_9 Reverse -53 -71 17.2659 0.194
NP_441556.1_10 Forward -200 -186 10.7085 0.262
NP_440498.1_1 Reverse -177 -195 -0.865831 0.22
NP_442982.1_5 Reverse -176 -195 -3.54046 0.299
NP_440375.1_8 Forward -133 -114 3.34271 0.22
NP_443030.1_4 Reverse -207 -226 -5.01543 0.259
NP_441644.1_6 Reverse -186 -196 15.7125 0.0048
NP_441644.1_6 Forward -195 -185 10.1076 0.0628
NP_441644.1_6 Forward -222 -212 5.09279 0.21
NP_442215.1_1 Reverse -215 -234 3.14605 0.288
NP_442215.1_2 Reverse -184 -200 2.8118 0.108
NP_442215.1_2 Forward -309 -293 2.02515 0.123
NP_442215.1_2 Forward -236 -220 -4.66135 0.237
NP_442177.1_5 Reverse -122 -136 8.45605 0.276
NP_440253.1_2 Forward -195 -177 1.69077 0.155
NP_440929.1_8 Forward -195 -186 19.2726 0.000701
NP_440929.1_8 Reverse -186 -195 19.2726 0.000701
NP_442933.1_10 Forward -195 -186 17.601 0.00325
NP_442933.1_10 Reverse -186 -195 17.601 0.00325
NP_442933.1_10 Forward -247 -238 3.7363 0.284
NP_441751.2_8 Reverse -187 -201 11.6026 0.0222
NP_441751.2_8 Forward -194 -180 5.60446 0.0419
NP_442554.1_8 Reverse -187 -197 16.9913 0.0065
NP_442554.1_8 Forward -194 -184 16.008 0.0065
NP_442554.1_8 Reverse -239 -249 3.12662 0.239
NP_441762.1_7 Forward -196 -184 20.9835 0.00342
NP_441762.1_7 Reverse -185 -197 11.7404 0.0142
NP_442142.1_4 Forward -198 -185 15.7516 0.0264
NP_442142.1_4 Reverse -183 -196 8.47516 0.113
NP_442142.1_4 Reverse -216 -229 4.73861 0.212
NP_442142.1_9 Reverse -179 -198 1.96607 0.282
NP_442292.1_1 Forward -194 -185 9.63616 0.0183
NP_442292.1_1 Reverse -187 -196 9.53783 0.0183
NP_442476.1_6 Reverse -187 -201 20.1574 0.0222
NP_442476.1_6 Forward -194 -180 11.8976 0.0525
NP_442476.1_6 Forward -379 -365 -0.197071 0.29
NP_442381.1_8 Forward -198 -179 -5.60541 0.148
NP_442381.1_8 Reverse -183 -202 -14.0619 0.28
NP_443009.1_5 Forward -196 -185 20.6093 0.001
NP_443009.1_5 Reverse -185 -196 9.10461 0.0965
NP_441865.1_3 Forward -173 -155 12.4089 0.287
NP_441715.1_4 Forward -194 -184 9.32148 0.097
NP_440357.1_3 Reverse -184 -203 4.52268 0.242
NP_440881.1_10 Forward -194 -181 11.524 0.249
NP_441198.1_4 Forward -78 -59 13.5691 0.241
NP_441198.1_8 Forward -197 -187 15.2245 0.0427
NP_440379.1_5 Forward -237 -218 0.196116 0.172
NP_441758.1_4 Reverse -121 -140 8.55425 0.254
NP_441468.1_1 Forward -194 -187 15.8704 0.0124
NP_441468.1_1 Reverse -187 -194 15.8704 0.0124
NP_441468.1_1 Forward -246 -239 10.2655 0.0906
NP_441569.1_8 Forward -376 -357 21.5339 0.047
NP_441020.2_6 Forward -197 -180 25.2116 0.000186
NP_441020.2_6 Reverse -184 -201 16.2635 0.0304
NP_441015.1_10 Forward -200 -181 -5.21209 0.219
NP_441673.1_1 Forward -195 -186 20.8459 0.000698
NP_441673.1_1 Reverse -186 -195 20.8459 0.000698
NP_441731.1_3 Reverse -178 -197 4.32602 0.159
NP_441016.2_6 Reverse -57 -76 19.5664 0.0795
NP_441826.1_2 Reverse -180 -194 1.37622 0.154
NP_441826.1_2 Forward -201 -187 -4.13031 0.292
NP_442490.1_9 Reverse -174 -193 -2.95047 0.22
NP_442490.1_9 Forward -207 -188 -8.55534 0.292
NP_442868.1_6 Forward -197 -187 16.7946 0.0131
NP_442868.1_6 Reverse -184 -194 8.53483 0.0555
NP_442227.1_2 Reverse -179 -198 -0.688862 0.257
NP_442808.1_1 Reverse -185 -195 18.4657 0.00201
NP_442808.1_1 Forward -196 -186 8.73102 0.0481
NP_442808.1_1 Forward -381 -371 3.91283 0.218
NP_441101.1_1 Forward -197 -179 9.65558 0.286
NP_441101.1_10 Forward -199 -180 -0.197208 0.189
NP_440145.1_3 Forward -232 -213 -5.50708 0.269
NP_442542.1_2 Reverse -184 -197 11.6223 0.114
NP_442542.1_2 Forward -197 -184 4.73917 0.298
NP_442050.1_5 Forward -197 -187 14.9258 0.0175
NP_442050.1_5 Reverse -184 -194 8.23937 0.234
NP_442342.1_9 Reverse -184 -200 6.45005 0.218
NP_440558.1_2 Forward -241 -222 -7.67036 0.298
NP_442789.1_4 Forward -197 -178 1.17943 0.185
NP_442789.1_4 Forward -236 -217 -6.98204 0.289
NP_441518.1_3 Reverse -176 -195 -13.0786 0.264
NP_441878.1_6 Forward -196 -186 20.2362 0.0046
NP_441878.1_6 Reverse -185 -195 10.4031 0.0176
NP_441878.1_6 Forward -248 -238 0.865012 0.132
NP_441878.1_6 Forward -223 -213 -7.29646 0.217
NP_441036.1_8 Reverse -185 -195 17.7779 0.000554
NP_441036.1_8 Forward -196 -186 8.4365 0.174
NP_441557.1_5 Forward -195 -186 19.9609 0.000699
NP_441557.1_5 Reverse -186 -195 19.9609 0.000699
NP_441445.1_1 Forward -204 -185 5.80098 0.163
NP_442066.2_9 Reverse -182 -195 10.8357 0.154
NP_442777.1_3 Reverse -179 -197 2.47668 0.274
NP_440738.1_5 Reverse -190 -209 0.294447 0.297
NP_441308.1_8 Reverse -184 -194 9.22315 0.226
NP_440101.1_3 Forward -200 -181 6.4893 0.181
NP_440101.1_3 Reverse -181 -200 6.4893 0.181
NP_441458.1_8 Reverse -296 -315 3.15712 0.279
NP_442183.1_1 Forward -195 -181 20.0591 0.00507
NP_442183.1_1 Reverse -186 -200 16.7159 0.0139
NP_442183.1_9 Reverse -122 -132 9.41981 0.296
NP_441549.1_9 Reverse -182 -200 1.69077 0.101
NP_441549.1_9 Forward -199 -181 -8.43732 0.228
NP_440414.1_3 Forward -263 -244 34.317 0.00000646
NP_440414.1_4 Forward -188 -169 34.022 0.00000903
NP_440414.1_6 Forward -212 -193 23.8939 0.0071
NP_440414.1_7 Forward -242 -223 33.9236 0.000000631
NP_441467.1_10 Forward -81 -67 5.01447 0.294
NP_442347.1_2 Forward -194 -185 11.1111 0.056
NP_442347.1_2 Forward -113 -104 3.83464 0.284
NP_442347.1_2 Reverse -187 -196 3.34298 0.284
NP_442888.1_9 Reverse -207 -226 17.0107 0.171
NP_441037.1_4 Forward -197 -187 18.9151 0.00351
NP_441037.1_4 Reverse -184 -194 16.2838 0.0168
NP_441037.1_4 Forward -249 -239 7.02532 0.237
NP_442508.1_8 Reverse -119 -136 11.4452 0.256
NP_442047.1_2 Reverse -376 -390 11.6026 0.297
NP_442317.1_6 Reverse -181 -200 8.16093 0.216
NP_441633.1_3 Reverse -184 -197 15.4572 0.0103
NP_441633.1_3 Forward -197 -184 3.95252 0.0699
NP_440136.1_2 Forward -194 -187 15.9687 0.0123
NP_440136.1_2 Reverse -187 -194 15.9687 0.0123
NP_442998.1_10 Forward -193 -186 15.5754 0.0102
NP_442998.1_10 Reverse -188 -195 15.5754 0.0102
NP_440899.1_8 Forward -277 -258 -0.688862 0.191
NP_440299.1_1 Reverse -182 -195 9.95012 0.0631
NP_440299.1_1 Forward -199 -186 8.86849 0.0835
NP_441799.1_1 Forward -199 -185 17.9935 0.00957
NP_441799.1_1 Reverse -182 -196 6.58715 0.167
NP_441007.1_10 Forward -200 -187 20.9638 0.0116
NP_441007.1_10 Reverse -181 -194 11.4257 0.064
NP_441229.1_4 Reverse -214 -233 18.289 0.109
NP_441559.1_8 Forward -227 -213 -4.13031 0.217
NP_441559.1_8 Reverse -182 -196 -5.01529 0.245
NP_441559.1_8 Forward -242 -228 -5.9986 0.271
NP_441559.1_8 Reverse -181 -195 -6.98191 0.281
NP_440915.1_6 Reverse -182 -196 13.3726 0.0187
NP_440915.1_6 Forward -226 -212 6.78443 0.0791
NP_440915.1_6 Forward -199 -185 5.60446 0.088
NP_442158.1_4 Forward -84 -74 10.8948 0.283
NP_442866.1_1 Reverse -181 -200 -4.22878 0.225
NP_441464.1_8 Reverse -186 -200 11.5043 0.178
NP_441464.1_10 Reverse -123 -137 15.1426 0.166
NP_441464.1_10 Forward -79 -65 7.47274 0.296
NP_441939.1_3 Forward -194 -175 9.24257 0.151
NP_441199.1_6 Reverse -182 -201 11.7992 0.0648
NP_441494.1_6 Forward -200 -187 20.1771 0.0343
NP_442993.1_1 Forward -195 -179 -9.08625 0.179
NP_440677.1_1 Reverse -177 -196 9.14423 0.187
NP_440677.1_6 Reverse -378 -397 8.06259 0.277
NP_440677.1_6 Reverse -177 -196 7.27595 0.298
NP_442386.1_9 Reverse -185 -194 15.7322 0.0144
NP_442386.1_9 Forward -196 -187 6.39082 0.219
NP_442386.1_9 Reverse -237 -246 6.09583 0.23
NP_441340.1_5 Forward -194 -187 15.6737 0.0124
NP_441340.1_5 Reverse -187 -194 15.6737 0.0124
NP_441340.1_5 Reverse -239 -246 4.07068 0.239
NP_441271.1_1 Forward -201 -183 18.5045 0.202
NP_440168.1_9 Forward -197 -178 4.03102 0.227
NP_440146.1_8 Forward -75 -57 13.9249 0.277
NP_442240.1_2 Forward -246 -227 -13.4719 0.169
NP_440161.1_3 Forward -197 -178 9.63589 0.238
NP_440586.1_1 Forward -202 -183 4.03102 0.202
NP_440586.1_1 Forward -82 -63 -3.14714 0.263
NP_440586.1_8 Forward -194 -187 13.2151 0.026
NP_440586.1_8 Reverse -187 -194 13.2151 0.026
NP_440586.1_9 Forward -226 -207 4.62101 0.288
NP_442251.1_6 Forward -194 -187 15.2804 0.0124
NP_442251.1_6 Reverse -187 -194 15.2804 0.0124
NP_440192.1_5 Forward -82 -63 6.4893 0.224
NP_441262.1_3 Reverse -186 -193 14.7888 0.0223
NP_441262.1_3 Forward -195 -188 14.7888 0.0223
NP_440027.1_3 Reverse -228 -246 11.6214 0.159
NP_440027.1_3 Forward -390 -372 2.47668 0.289
NP_443051.1_1 Forward -196 -187 18.0926 0.00402
NP_443051.1_1 Reverse -185 -194 10.4228 0.00754
NP_439937.1_8 Reverse -184 -203 4.81767 0.199
NP_439937.1_8 Forward -197 -178 -5.01543 0.286
NP_439937.1_9 Reverse -185 -202 2.7914 0.0798
NP_439937.1_9 Forward -196 -179 -16.1864 0.287
NP_440408.1_7 Reverse -186 -205 7.27595 0.29
NP_440439.1_1 Reverse -183 -196 18.8005 0.0105
NP_440439.1_1 Forward -198 -185 8.67241 0.0513
NP_440372.1_2 Forward -194 -187 16.3621 0.0124
NP_440372.1_2 Reverse -187 -194 16.3621 0.0124
NP_441181.1_2 Reverse -75 -94 3.24438 0.255
NP_441789.1_7 Reverse -233 -252 4.91521 0.193
NP_441789.1_7 Reverse -218 -237 -3.34455 0.272
NP_441803.1_2 Reverse -181 -200 3.44104 0.191
NP_439977.1_5 Reverse -180 -199 7.07928 0.125
NP_439977.1_5 Forward -201 -182 -0.4922 0.227
NP_441572.1_7 Forward -201 -182 -1.7705 0.19
NP_442384.1_10 Reverse -186 -199 10.049 0.047
NP_442384.1_10 Forward -195 -182 7.78743 0.0743
NP_442114.1_4 Forward -195 -184 12.1534 0.107
NP_441877.1_7 Reverse -181 -200 3.34192 0.218
NP_442790.1_4 Reverse -177 -196 -7.08038 0.149
NP_442262.1_10 Forward -194 -187 14.1988 0.0123
NP_442262.1_10 Reverse -187 -194 14.1988 0.0123
NP_441689.1_5 Reverse -39 -49 4.99446 0.285
NP_440163.1_10 Reverse -69 -79 7.94484 0.297
NP_440344.1_10 Forward -202 -185 6.92201 0.016
NP_440344.1_10 Reverse -179 -196 -10.6792 0.187
NP_440282.1_3 Forward -288 -269 -1.08219 0.298
NP_442123.1_3 Reverse -186 -205 11.9958 0.217
NP_440562.1_3 Forward -194 -177 7.41366 0.15
NP_441965.1_10 Forward -198 -182 4.18844 0.247
NP_440297.1_9 Reverse -187 -197 9.51814 0.0917
NP_440297.1_9 Reverse -239 -249 0.766681 0.282
NP_440297.1_9 Forward -194 -184 -0.216628 0.282
NP_440350.1_2 Forward -73 -54 9.0459 0.248
NP_441592.1_4 Reverse -234 -253 2.65439 0.192
NP_441592.1_4 Reverse -186 -205 -2.0655 0.26
NP_441896.1_3 Reverse -177 -196 -0.000545616 0.231
NP_442067.1_4 Reverse -175 -194 7.47261 0.195
NP_440999.1_9 Reverse -182 -196 17.4042 0.0167
NP_440999.1_9 Reverse -209 -223 4.22782 0.116
NP_440999.1_9 Forward -199 -185 0.88457 0.174
NP_440999.1_9 Reverse -234 -248 -3.44199 0.293
NP_440888.1_2 Forward -195 -181 12.3887 0.046
NP_440888.1_2 Reverse -213 -227 9.24208 0.134
NP_440888.1_2 Reverse -186 -200 5.40719 0.28
NP_440060.1_2 Forward -203 -184 14.2566 0.274
NP_442147.1_6 Forward -129 -115 18.6818 0.182
NP_440491.1_1 Forward -198 -179 7.20938 0.274
NP_442033.1_10 Reverse -184 -203 -8.16202 0.191
NP_441543.1_2 Forward -194 -185 18.486 0.00236
NP_441543.1_2 Reverse -187 -196 9.34117 0.0818
NP_442845.1_2 Forward -201 -187 7.47274 0.195
NP_441551.1_5 Reverse -182 -198 17.4624 0.047
NP_441551.1_5 Forward -199 -183 7.72766 0.241
NP_441469.1_8 Reverse -185 -194 16.126 0.00797
NP_441469.1_8 Forward -196 -187 13.3727 0.073
NP_443064.1_6 Reverse -186 -196 13.8273 0.0796
NP_441223.1_5 Reverse -314 -328 19.586 0.033
NP_441306.1_10 Reverse -116 -130 13.4703 0.25
NP_442578.1_7 Forward -194 -187 14.5921 0.026
NP_442578.1_7 Reverse -187 -194 14.5921 0.026
NP_441462.1_2 Reverse -186 -196 20.1379 0.000967
NP_441462.1_2 Forward -195 -185 11.5831 0.00406
NP_441621.1_7 Forward -197 -183 24.0907 0.00827
NP_441621.1_7 Reverse -184 -198 16.2242 0.0266
NP_443062.1_1 Reverse -186 -204 4.15809 0.272
NP_443062.1_1 Forward -222 -204 3.37804 0.3
NP_443062.1_6 Forward -203 -184 1.86774 0.266
NP_440936.1_10 Forward -327 -308 5.0129 0.178
NP_442204.1_5 Forward -205 -186 11.7008 0.0743
NP_442204.1_5 Reverse -176 -195 -0.295539 0.283
NP_442204.1_5 Forward -244 -225 -0.688862 0.296
NP_440516.1_8 Forward -195 -186 16.9127 0.00442
NP_440516.1_8 Reverse -186 -195 16.9127 0.00442
NP_442080.1_7 Forward -86 -67 -0.590531 0.275
NP_442428.1_5 Forward -194 -187 15.8704 0.0124
NP_442428.1_5 Reverse -187 -194 15.8704 0.0124
NP_442428.1_5 Forward -246 -239 4.66067 0.244
NP_440818.1_1 Reverse -371 -390 -4.52377 0.286
NP_440673.1_3 Forward -193 -186 12.4288 0.0426
NP_440673.1_3 Reverse -188 -195 12.4288 0.0426
NP_440865.1_9 Forward -201 -182 7.37428 0.0657
NP_440865.1_10 Forward -138 -124 17.0102 0.242
NP_441052.1_2 Forward -195 -185 10.5014 0.0285
NP_441052.1_2 Reverse -186 -196 10.4031 0.0285
NP_442219.1_9 Forward -194 -185 8.35786 0.0681
NP_442219.1_9 Reverse -187 -196 8.25953 0.0681
NP_440436.1_4 Forward -194 -185 18.1905 0.00233
NP_440436.1_4 Reverse -187 -196 15.9289 0.00508
NP_440436.1_4 Reverse -292 -301 6.48915 0.157
NP_440436.1_4 Forward -246 -237 4.7192 0.244
NP_441884.1_9 Forward -198 -179 -6.88371 0.0594
NP_441884.1_9 Reverse -183 -202 -23.6 0.284
NP_441719.1_4 Forward -194 -187 16.3621 0.0124
NP_441719.1_4 Reverse -187 -194 16.3621 0.0124
NP_441733.1_10 Forward -198 -185 16.9322 0.0382
NP_441733.1_10 Reverse -183 -196 15.7522 0.0564
NP_441004.1_1 Forward -201 -182 -9.63698 0.21
NP_442366.1_3 Forward -196 -178 4.73903 0.093
NP_442366.1_3 Reverse -290 -308 3.65739 0.106
NP_440296.1_10 Forward -198 -179 -13.3736 0.269
NP_442694.1_4 Forward -65 -56 11.7011 0.277
NP_442206.1_1 Reverse -186 -205 -9.73531 0.219
NP_442206.1_10 Forward -195 -180 14.6312 0.0799
NP_442206.1_10 Forward -186 -171 -0.118434 0.284
NP_440328.1_4 Reverse -180 -199 3.53937 0.176
NP_443054.1_2 Forward -224 -210 5.99778 0.212
NP_443054.1_2 Forward -197 -183 5.01447 0.24
NP_443054.1_2 Reverse -184 -198 1.17956 0.251
NP_440508.1_4 Reverse -374 -393 13.0775 0.231
NP_441851.1_10 Forward -196 -186 17.4829 0.0027
NP_441851.1_10 Reverse -185 -195 16.008 0.00552
NP_441851.1_10 Forward -248 -238 6.07655 0.187
NP_441555.1_2 Reverse -345 -364 11.3154 0.299
NP_442515.1_1 Reverse -185 -199 7.47274 0.0913
NP_442515.1_1 Forward -196 -182 6.58777 0.0975
NP_440593.1_9 Forward -225 -211 8.84938 0.255
NP_442709.1_3 Forward -202 -183 2.94938 0.288
NP_441349.1_10 Forward -205 -186 -7.86702 0.261
NP_441409.1_6 Forward -201 -182 -5.9004 0.116
NP_440474.1_8 Forward -194 -180 8.25877 0.189
NP_440431.1_3 Forward -370 -351 -6.78538 0.195
NP_440431.1_4 Reverse -312 -331 5.0129 0.0794
NP_442450.1_5 Forward -197 -187 10.1081 0.115
NP_440588.1_2 Forward -204 -185 15.2408 0.0142
NP_440588.1_2 Reverse -177 -196 10.2259 0.0391
NP_440588.1_2 Forward -243 -224 -5.31042 0.247
NP_440040.1_8 Reverse -309 -328 5.20389 0.236
NP_442006.1_2 Forward -195 -178 -17.1691 0.27
NP_441003.1_9 Reverse -177 -196 7.96426 0.227
NP_443047.1_6 Forward -230 -211 20.354 0.0732
NP_440078.1_10 Reverse -213 -232 2.16274 0.279
NP_441078.1_4 Forward -195 -186 19.6659 0.0007
NP_441078.1_4 Reverse -186 -195 19.6659 0.0007
NP_441078.1_4 Forward -222 -213 5.40793 0.112
NP_442729.1_8 Forward -199 -186 10.2457 0.125
NP_442729.1_8 Reverse -182 -195 9.65572 0.125
NP_441663.1_8 Reverse -180 -199 17.404 0.028
NP_442348.1_2 Forward -66 -57 7.76787 0.28
NP_440526.1_3 Reverse -187 -198 18.446 0.0306
NP_440526.1_3 Forward -194 -183 9.49793 0.0826
NP_440526.1_3 Reverse -239 -250 7.43299 0.148
NP_440526.1_7 Reverse -334 -353 13.0554 0.255
NP_441432.1_8 Forward -196 -187 8.35786 0.0755
NP_441432.1_8 Reverse -185 -194 8.25953 0.0755
NP_441333.1_1 Forward -323 -313 13.9731 0.217
NP_442320.1_8 Forward -201 -187 -0.295402 0.0817
NP_442320.1_8 Reverse -180 -194 -2.95034 0.1
NP_442344.1_7 Reverse -187 -206 -9.34199 0.249
NP_441732.1_2 Forward -199 -183 -15.8711 0.163
NP_441732.1_2 Reverse -182 -198 -16.0677 0.164
NP_440629.1_6 Reverse -180 -199 14.8476 0.162
NP_442815.1_2 Reverse -187 -205 5.03403 0.237
NP_440760.1_1 Reverse -186 -205 -3.14714 0.034
NP_440760.1_1 Forward -195 -176 -22.8133 0.271
NP_441945.1_10 Forward -82 -63 11.1109 0.238
NP_441057.1_4 Forward -391 -373 -4.11075 0.299
NP_442489.1_7 Forward -195 -186 20.1576 0.000695
NP_442489.1_7 Reverse -186 -195 20.1576 0.000695
NP_442489.1_7 Forward -222 -213 -1.37691 0.195
NP_440559.1_1 Reverse -187 -196 17.306 0.00658
NP_440559.1_1 Forward -194 -185 8.75118 0.0586
NP_441659.2_8 Reverse -186 -196 19.3512 0.000966
NP_441659.2_8 Forward -195 -185 11.9764 0.0147
NP_441659.2_8 Reverse -213 -223 3.42162 0.161
NP_441659.2_8 Reverse -238 -248 2.33998 0.205
NP_441022.1_1 Forward -36 -27 11.5462 0.274
NP_441040.1_2 Reverse -177 -196 -13.9635 0.284
NP_440708.1_6 Forward -232 -213 -9.24366 0.261
NP_441800.1_7 Reverse -58 -76 -2.93078 0.268
NP_440779.1_5 Reverse -238 -255 -5.07437 0.127
NP_440779.1_5 Forward -195 -178 -14.3175 0.244
NP_440779.1_5 Reverse -186 -203 -14.3175 0.244
NP_442346.1_5 Forward -196 -186 17.9746 0.00128
NP_442346.1_5 Reverse -185 -195 9.02648 0.118
NP_440545.1_3 Forward -199 -182 17.2468 0.0111
NP_440545.1_3 Reverse -182 -199 10.1669 0.0347
NP_440545.1_3 Forward -251 -234 -0.256152 0.151
NP_440545.1_3 Reverse -209 -226 -6.05768 0.268
NP_440831.1_3 Forward -204 -185 11.3381 0.163
NP_440486.1_6 Reverse -374 -393 6.19431 0.283
NP_440486.1_6 Reverse -212 -231 5.99764 0.284
NP_442934.1_1 Reverse -131 -150 12.1925 0.267
NP_442603.1_7 Reverse -186 -200 6.68548 0.232
NP_441888.1_7 Forward -55 -41 7.66941 0.225
NP_441888.1_7 Reverse -181 -195 3.53951 0.225
NP_440946.1_4 Forward -233 -214 11.5042 0.229
NP_441833.1_4 Forward -194 -187 15.9687 0.0124
NP_441833.1_4 Reverse -187 -194 15.9687 0.0124
NP_441329.1_1 Forward -40 -21 7.78217 0.236
NP_441329.1_4 Reverse -23 -41 11.27 0.251
NP_441329.1_6 Reverse -42 -61 5.96782 0.191
NP_442060.1_10 Forward -135 -116 11.0125 0.244
NP_442162.1_9 Forward -194 -187 16.2637 0.0124
NP_442162.1_9 Reverse -187 -194 16.2637 0.0124
NP_440788.1_5 Reverse -108 -127 8.65258 0.079
NP_442073.1_6 Forward -204 -185 0.392778 0.25
NP_442199.1_5 Forward -203 -184 -1.7705 0.181
NP_442140.1_3 Forward -194 -184 17.4829 0.0159
NP_442140.1_3 Reverse -187 -197 14.828 0.0433
NP_442140.1_3 Forward -246 -236 3.42162 0.297
NP_440875.1_9 Forward -193 -183 18.3004 0.0104
NP_440875.1_9 Reverse -188 -198 9.24806 0.233
NP_441813.1_5 Reverse -184 -194 10.0098 0.0208
NP_441813.1_5 Forward -197 -187 8.92815 0.0347
NP_441813.1_5 Reverse -236 -246 -0.609952 0.261
NP_442028.1_1 Forward -325 -312 11.2343 0.251
NP_442028.1_1 Reverse -323 -336 7.03268 0.292
NP_442028.1_1 Forward -38 -25 6.8417 0.294
NP_442089.1_6 Forward -222 -203 6.58763 0.197
NP_440590.1_4 Forward -194 -181 -3.32397 0.255
NP_440590.1_4 Reverse -187 -200 -5.29059 0.277
NP_440567.1_1 Reverse -187 -201 18.8791 0.0136
NP_440567.1_1 Forward -194 -180 15.5359 0.017
NP_442497.1_10 Reverse -187 -196 19.8626 0.00532
NP_442497.1_10 Forward -194 -185 10.4228 0.0087
NP_440821.1_4 Forward -197 -187 19.5479 0.00399
NP_440821.1_4 Reverse -184 -194 18.7612 0.00422
NP_440821.1_4 Forward -249 -239 -0.314959 0.251
NP_442810.1_5 Forward -48 -29 19.3698 0.083
NP_441239.1_9 Reverse -184 -196 19.6068 0.00769
NP_441239.1_9 Forward -197 -185 17.0502 0.0153
NP_441239.1_9 Forward -249 -237 11.4454 0.0607
NP_441239.1_9 Reverse -236 -248 3.18557 0.292
NP_441951.1_3 Reverse -209 -228 15.1424 0.286
NP_441009.1_4 Reverse -186 -205 18.7807 0.131
NP_441727.1_3 Forward -202 -183 15.8307 0.116
NP_440604.1_6 Reverse -186 -205 12.9791 0.0411
NP_440604.1_6 Forward -195 -176 -3.14714 0.225
NP_442044.1_1 Forward -200 -181 -4.81876 0.18
NP_442044.1_1 Reverse -181 -200 -14.4552 0.291
NP_441508.1_1 Reverse -26 -45 12.7681 0.224
NP_440573.1_3 Reverse -330 -343 15.054 0.262
NP_440212.1_9 Forward -337 -318 2.29119 0.252
NP_440949.1_7 Forward -194 -175 9.34008 0.264
NP_440949.1_7 Reverse -178 -197 8.35677 0.288
NP_440354.1_5 Reverse -183 -202 4.42435 0.212
NP_442138.1_5 Reverse -205 -224 14.4541 0.276
NP_442052.1_1 Forward -86 -67 18.9474 0.224
NP_440546.1_4 Reverse -186 -196 12.8578 0.0572
NP_440546.1_4 Forward -195 -185 11.8882 0.0679
NP_440546.1_6 Forward -205 -186 7.86593 0.266
NP_440462.1_6 Reverse -184 -194 17.9746 0.00578
NP_440462.1_6 Forward -197 -187 10.4031 0.0396
NP_440868.1_4 Reverse -182 -194 19.0169 0.0123
NP_440868.1_4 Forward -199 -187 9.77374 0.043
NP_440868.1_8 Forward -199 -180 7.07928 0.103
NP_442499.1_3 Reverse -185 -203 4.73903 0.289
NP_441672.1_10 Forward -245 -226 12.8808 0.278
NP_440341.1_7 Forward -396 -382 13.5693 0.2
NP_441848.1_4 Reverse -34 -50 12.3253 0.206
NP_440696.1_3 Forward -247 -229 4.14905 0.2
NP_442039.1_4 Forward -194 -187 15.1821 0.0124
NP_442039.1_4 Reverse -187 -194 15.1821 0.0124
NP_442039.1_7 Forward -298 -288 14.1397 0.211
NP_440825.1_6 Forward -74 -55 7.47261 0.285
NP_442696.1_2 Forward -196 -178 12.4089 0.135
NP_442837.1_3 Forward -194 -187 15.7721 0.0124
NP_442837.1_3 Reverse -187 -194 15.7721 0.0124
NP_442053.1_1 Forward -195 -186 18.3876 0.0007
NP_442053.1_1 Reverse -186 -195 18.3876 0.0007
NP_440505.1_3 Reverse -184 -194 14.1397 0.0235
NP_440505.1_3 Forward -197 -187 7.84651 0.147
NP_442532.1_2 Reverse -26 -45 2.91208 0.218
NP_442532.1_7 Forward -195 -181 5.70279 0.171
NP_440914.1_1 Forward -300 -290 9.39583 0.186
NP_440914.1_1 Forward -195 -185 8.6151 0.186
NP_440914.1_1 Reverse -186 -196 8.51751 0.186
NP_441011.1_8 Forward -194 -185 16.9127 0.00602
NP_441011.1_8 Reverse -187 -196 14.356 0.0249
NP_441011.1_8 Forward -246 -237 5.11294 0.283
NP_442533.1_1 Forward -252 -233 -13.6686 0.237
NP_442533.1_6 Forward -195 -186 17.2076 0.00137
NP_442533.1_6 Reverse -186 -195 17.2076 0.00137
NP_442533.1_6 Forward -222 -213 12.8811 0.0253
NP_442232.1_3 Forward -203 -184 13.1758 0.052
NP_442232.1_3 Forward -255 -236 -14.7502 0.288
NP_442229.1_1 Reverse -184 -198 9.24208 0.184
NP_443016.1_1 Reverse -180 -199 0.58944 0.193
NP_441482.1_7 Forward -201 -187 0.589577 0.0554
NP_441482.1_7 Reverse -180 -194 -10.7185 0.213
NP_439944.1_9 Reverse -187 -197 17.4829 0.00423
NP_439944.1_9 Forward -194 -184 10.4031 0.0887
NP_441697.1_5 Forward -334 -315 -5.49121 0.227
NP_441028.1_6 Forward -59 -49 10.1076 0.21
NP_442202.1_4 Reverse -184 -198 13.417 0.252
NP_441527.1_4 Reverse -25 -44 -2.33998 0.156
NP_441527.1_4 Reverse -313 -332 -5.01375 0.194
NP_440115.1_6 Forward -198 -188 19.2529 0.0106
NP_440115.1_6 Reverse -183 -193 10.5998 0.115
NP_440115.1_6 Reverse -368 -378 6.56821 0.178
NP_440007.1_9 Forward -226 -212 1.37622 0.285
NP_439965.1_1 Forward -204 -185 -2.85214 0.177
NP_441680.1_4 Reverse -209 -228 -2.0655 0.266
NP_441347.1_5 Forward -201 -187 9.43874 0.269
NP_441602.1_3 Forward -200 -181 -2.16383 0.233
NP_441602.1_3 Reverse -181 -200 -4.03212 0.258
NP_441972.1_5 Reverse -187 -206 -6.39206 0.229
NP_441106.1_1 Reverse -185 -194 18.191 0.0028
NP_441106.1_1 Forward -196 -187 9.73449 0.0311
NP_441106.1_1 Reverse -237 -246 4.71961 0.21
NP_442306.1_10 Reverse -181 -200 -20.5517 0.213
NP_441286.1_1 Reverse -185 -197 14.6903 0.00418
NP_441286.1_1 Forward -196 -184 5.34885 0.0259
NP_442674.1_3 Forward -203 -184 2.26028 0.3
NP_440670.1_8 Forward -195 -186 18.3876 0.000699
NP_440670.1_8 Reverse -186 -195 18.3876 0.000699
NP_441705.1_3 Reverse -35 -54 1.67108 0.244
NP_440886.1_7 Reverse -185 -195 17.7774 0.0011
NP_440886.1_7 Forward -196 -186 8.04271 0.0805
NP_440886.1_7 Forward -135 -125 3.22451 0.291
NP_442614.1_2 Reverse -186 -200 17.6992 0.0588
NP_439995.1_5 Reverse -176 -195 8.75091 0.235
NP_442072.1_9 Forward -223 -205 -13.0589 0.098
NP_442072.1_9 Forward -196 -178 -21.2203 0.206
NP_440907.2_8 Reverse -187 -197 19.449 0.00351
NP_440907.2_8 Forward -194 -184 17.4824 0.00685
NP_442459.1_2 Forward -294 -275 8.06259 0.297
NP_441463.1_3 Forward -205 -186 -1.18052 0.137
NP_441626.1_2 Forward -194 -187 15.7721 0.0124
NP_441626.1_2 Reverse -187 -194 15.7721 0.0124
NP_442209.1_5 Reverse -287 -306 15.065 0.261
NP_442615.1_1 Forward -204 -186 14.8671 0.00922
NP_442615.1_1 Reverse -177 -195 12.6055 0.0131
NP_441962.1_4 Forward -200 -181 17.8957 0.0137
NP_441962.1_4 Reverse -208 -227 -13.3736 0.272
NP_440387.1_1 Forward -195 -179 22.5763 0.00191
NP_440387.1_1 Forward -222 -206 -2.98973 0.153
NP_440387.1_1 Reverse -186 -202 -3.38305 0.158
NP_441431.1_2 Reverse -183 -197 17.8952 0.0234
NP_441431.1_2 Forward -198 -184 15.6336 0.045
NP_441836.1_2 Reverse -180 -199 -0.39387 0.212
NP_441836.1_2 Forward -201 -182 -1.86883 0.223
NP_441993.1_1 Reverse -207 -226 0.484826 0.298
NP_441174.1_2 Forward -198 -184 12.3893 0.252
NP_440114.1_10 Reverse -186 -200 9.5377 0.169
NP_442684.1_5 Reverse -366 -384 16.8337 0.162
NP_441817.1_10 Forward -197 -178 13.0775 0.199
NP_441510.2_7 Forward -134 -120 11.9953 0.28
NP_442087.1_7 Forward -45 -26 -3.54122 0.285
NP_440293.1_3 Forward -203 -184 -6.1954 0.287
NP_440293.1_9 Reverse -280 -294 9.31494 0.285
NP_440766.1_4 Forward -199 -185 7.86607 0.0871
NP_440766.1_4 Reverse -182 -196 5.30946 0.112
NP_440766.1_5 Forward -152 -140 13.6718 0.222
NP_441421.1_6 Reverse -23 -40 12.1796 0.272
NP_439988.1_7 Reverse -185 -199 14.9452 0.292
NP_441237.1_9 Reverse -187 -197 17.2863 0.00348
NP_441133.1_1 Reverse -280 -299 14.8474 0.2
NP_440457.1_1 Forward -199 -187 9.38042 0.0927
NP_440457.1_1 Reverse -182 -194 -0.452677 0.263
NP_442940.1_2 Reverse -186 -205 -0.983855 0.296
NP_440798.1_6 Forward -194 -181 1.29759 0.224
NP_440798.1_6 Reverse -187 -200 0.707601 0.251
NP_441436.1_8 Reverse -212 -231 7.86593 0.293
NP_440473.1_9 Reverse -175 -194 -7.08038 0.236
NP_442509.1_9 Reverse -186 -196 17.3841 0.00128
NP_442509.1_9 Forward -195 -185 16.2041 0.00739
NP_442509.1_9 Reverse -227 -237 9.41933 0.192
NP_442582.1_8 Forward -165 -147 6.41066 0.28
NP_440554.1_4 Forward -194 -184 13.943 0.0218
NP_440554.1_4 Reverse -187 -197 6.27322 0.123
NP_441885.1_5 Forward -195 -185 11.4848 0.00668
NP_441885.1_5 Reverse -186 -196 11.3864 0.00668
NP_441428.1_8 Forward -203 -184 3.93269 0.251
NP_442703.1_4 Reverse -186 -205 0.883656 0.284
NP_442341.1_7 Forward -196 -182 14.0609 0.0326
NP_442341.1_7 Reverse -185 -199 13.3726 0.0355
NP_442341.1_10 Reverse -106 -125 15.3391 0.247
NP_441756.1_5 Forward -226 -207 -3.44213 0.29
NP_442395.2_4 Reverse -185 -204 20.9431 0.0143
NP_443000.1_7 Forward -197 -187 2.14332 0.226
NP_443000.1_7 Reverse -184 -194 2.04498 0.226
NP_440507.2_3 Forward -204 -185 7.37347 0.281
NP_441842.1_10 Forward -202 -188 9.34103 0.192
NP_441842.1_10 Reverse -179 -193 7.37441 0.258
NP_440275.1_3 Forward -197 -187 19.5479 0.00756
NP_440275.1_3 Reverse -184 -194 17.9746 0.0082
NP_440091.1_1 Reverse -182 -194 3.2839 0.163
NP_440679.1_10 Reverse -179 -198 -12.8819 0.213
NP_442451.1_2 Reverse -230 -249 -3.93378 0.2
NP_442451.1_2 Reverse -178 -197 -9.14533 0.259
NP_441122.1_1 Reverse -287 -302 12.1729 0.179
NP_441207.1_7 Forward -147 -133 8.19046 0.293
NP_439962.1_4 Reverse -110 -129 -6.58872 0.283
NP_439962.1_4 Reverse -178 -197 -9.047 0.298
NP_441105.1_3 Forward -206 -187 0.884433 0.12
NP_441105.1_3 Forward -258 -239 -8.26035 0.269
NP_442373.1_2 Forward -84 -65 10.8159 0.0729
NP_440216.1_1 Forward -195 -181 -2.26202 0.0484
NP_440216.1_1 Reverse -186 -200 -2.26202 0.0484
NP_440216.1_9 Reverse -149 -158 6.19458 0.289
NP_440678.1_9 Forward -200 -181 9.53756 0.279
NP_440172.1_1 Reverse -186 -196 16.303 0.00854
NP_440172.1_1 Forward -195 -185 8.73149 0.0586
NP_442015.1_10 Forward -199 -186 3.26421 0.184
NP_442015.1_10 Reverse -182 -195 2.67422 0.187
NP_442015.1_10 Forward -226 -213 -0.472371 0.268
NP_441226.1_7 Forward -194 -187 14.4934 0.0123
NP_441226.1_7 Reverse -187 -194 14.4934 0.0123
NP_441226.1_7 Forward -127 -120 6.52862 0.253
NP_440305.1_1 Reverse -44 -58 12.903 0.285
NP_441111.1_7 Forward -194 -186 18.7023 0.00294
NP_441111.1_7 Reverse -187 -195 18.7023 0.00294
NP_442379.1_10 Reverse -179 -196 -0.747806 0.223
NP_440415.1_1 Forward -53 -34 35.0053 0.00000624
NP_440415.1_2 Forward -188 -169 33.137 0.0000173
NP_440415.1_3 Forward -263 -244 33.9236 0.00000253
NP_440415.1_4 Forward -122 -103 30.8754 0.00012
NP_440415.1_5 Forward -242 -223 34.1203 0.000000629
NP_440415.1_6 Forward -209 -190 27.3355 0.00154
NP_440415.1_7 Forward -98 -79 20.4523 0.0467
NP_440415.1_8 Forward -152 -133 26.2136 0.00257
NP_440415.1_9 Forward -77 -58 22.3206 0.0243
NP_441766.1_2 Forward -195 -186 17.5026 0.00297
NP_441766.1_2 Reverse -186 -195 17.5026 0.00297
NP_440416.1_1 Reverse -186 -205 -14.2585 0.284
NP_440416.1_9 Reverse -179 -198 -12.8819 0.16
NP_440416.1_9 Forward -202 -183 -14.8485 0.18
NP_443052.1_8 Reverse -176 -195 -8.85033 0.179
NP_443052.1_8 Forward -205 -186 -11.9969 0.244
NP_443052.1_9 Reverse -62 -81 -5.01543 0.265
NP_442116.1_6 Forward -47 -30 8.16895 0.254
NP_442154.1_1 Forward -83 -65 -6.56903 0.141
NP_442154.1_1 Forward -251 -233 -13.7472 0.217
NP_442154.1_1 Forward -74 -56 -17.2871 0.251
NP_440261.1_5 Reverse -187 -200 18.1122 0.00542
NP_440261.1_5 Forward -194 -181 8.37742 0.0263
NP_440988.1_4 Forward -73 -54 7.66927 0.295
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCAAGAGTTGCCCATTCTCCAGGAACGCTACGACATTAATCAGGAAATTCAAGAGTTTAATCAATAAAACATTTAATTGTTCTTTTTTAGTTGGTAATTAACAATGGCAACCCAAAATCCTAATCAACCGGTTACTTATCCCATTTTTACGGTGCGCTGGCTGGCGGTTCACACCCTGGCGGTGCCCTCTGTCTTCTTTGTCGGGGCGATCGCCGCGATGCAATTTATTCAACGCTAGGAGTTTTTCATGGACAGAAATTCAAACCCAAACCGCCAACCGGTGGAATTGAACCGCACTTCTTTATACCTGGGTCTATTGTTGGTGGCTGTGTTGGGGATTTTGTTCTCCAGCTATTTCTTTAACTAAACTTTTTTAATACGCAATTTAGGAGGCATGGT

CDS

ATGTTCGCAGAAGGCAGAATCCCTTTGTGGGTGGTGGGTGTAGTGGCCGGTATTGGCGCCATTGGTGTTCTAGGGTTATTTTTCTACGGAGCCTATGCTGGTTTAGGTTCTTCCATGTAA

Protein

MFAEGRIPLWVVGVVAGIGAIGVLGLFFYGAYAGLGSSM