Your browser is old and dusty. Try Google Chrome!

Details for smr0005

ORF smr0005
Accession NP_440325.1
Symbol psaM
Category Photosystem I
Definition photosystem I subunit XII
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -115 -129 -1.47537 0.262
NP_441818.1_9 Forward -202 -183 -11.0136 0.3
NP_442655.1_2 Reverse -57 -76 2.65439 0.259
NP_441054.1_2 Reverse -56 -75 10.2259 0.284
NP_439979.1_9 Forward -232 -214 12.8022 0.227
NP_442972.1_2 Forward -375 -361 12.9786 0.218
NP_442762.1_10 Reverse -145 -164 -9.93197 0.257
NP_441352.1_2 Forward -189 -170 3.44104 0.222
NP_441935.1_2 Forward -141 -122 -3.44213 0.253
NP_441141.1_3 Reverse -59 -77 15.9488 0.157
NP_441713.1_1 Forward -181 -162 -8.65367 0.155
NP_441598.1_4 Forward -252 -233 16.6174 0.247
NP_441014.1_2 Reverse -345 -364 13.5691 0.245
NP_441014.1_2 Forward -159 -140 12.7825 0.245
NP_441014.1_10 Reverse -119 -138 0.686995 0.239
NP_441014.1_10 Reverse -211 -230 -2.36125 0.274
NP_441012.1_4 Reverse -152 -165 6.80412 0.276
NP_441182.1_1 Reverse -204 -220 7.72835 0.297
NP_440376.1_1 Forward -244 -235 3.04799 0.21
NP_442687.1_7 Forward -176 -166 4.20827 0.262
NP_441846.1_10 Forward -209 -190 -15.3402 0.247
NP_440642.1_1 Forward -164 -145 14.4541 0.135
NP_441422.1_7 Reverse -174 -191 2.10379 0.115
NP_440533.1_6 Reverse -276 -295 8.35759 0.276
NP_442198.1_7 Forward -168 -149 9.83173 0.253
NP_442161.1_7 Reverse -202 -221 9.3409 0.131
NP_440141.1_8 Forward -138 -119 10.8159 0.208
NP_442782.1_2 Reverse -61 -75 2.65453 0.275
NP_442544.1_2 Forward -64 -50 -1.27871 0.272
NP_442321.1_4 Reverse -209 -228 -9.24366 0.296
NP_441317.1_4 Reverse -352 -366 16.5303 0.136
NP_441127.1_1 Reverse -64 -78 11.996 0.215
NP_442486.1_4 Reverse -168 -187 6.88262 0.274
NP_442025.1_9 Forward -210 -191 13.8641 0.284
NP_439905.1_1 Reverse -25 -38 6.1158 0.299
NP_440984.1_7 Forward -169 -155 10.6193 0.122
NP_442690.1_1 Forward -55 -36 -11.7019 0.232
NP_442911.1_2 Reverse -110 -129 -6.88371 0.195
NP_440325.1_1 Forward -91 -72 24.3855 0.0132
NP_440325.1_1 Reverse -83 -102 14.8474 0.188
NP_440325.1_2 Forward -60 -41 25.9588 0.00294
NP_442438.1_10 Reverse -161 -175 -0.393733 0.259
NP_442431.1_7 Reverse -54 -73 5.211 0.285
NP_440377.1_1 Reverse -36 -53 11.7569 0.271
NP_441041.1_1 Forward -141 -122 10.1275 0.211
NP_441041.1_4 Forward -227 -208 -11.1119 0.241
NP_439966.1_8 Reverse -368 -387 5.99764 0.298
NP_442281.1_1 Reverse -115 -129 3.44058 0.231
NP_442500.1_8 Reverse -35 -49 11.3353 0.261
NP_440498.1_1 Forward -178 -160 1.00246 0.211
NP_443049.1_6 Forward -203 -193 13.0072 0.214
NP_441071.1_3 Forward -342 -323 15.7316 0.137
NP_442554.1_8 Forward -128 -118 6.46988 0.117
NP_442292.1_5 Forward -189 -170 8.45592 0.14
NP_440881.1_3 Forward -338 -319 12.6833 0.293
NP_441448.1_1 Forward -238 -219 8.65258 0.206
NP_440158.1_1 Reverse -41 -60 12.2703 0.195
NP_441015.1_10 Forward -190 -171 -11.4069 0.296
NP_442227.1_2 Reverse -187 -206 3.04771 0.219
NP_442227.1_2 Reverse -214 -233 2.26107 0.235
NP_442227.1_2 Reverse -116 -135 1.86774 0.242
NP_442227.1_4 Forward -78 -59 11.7983 0.285
NP_440558.1_2 Reverse -203 -222 3.53937 0.155
NP_440558.1_2 Reverse -111 -130 -3.93378 0.239
NP_440162.1_2 Reverse -238 -257 6.39097 0.282
NP_442650.1_2 Forward -129 -115 2.45787 0.271
NP_442066.2_4 Forward -244 -225 -7.96535 0.293
NP_441458.1_10 Reverse -111 -130 2.3594 0.269
NP_440547.1_1 Reverse -307 -326 7.07848 0.294
NP_442594.1_8 Forward -202 -183 7.57094 0.213
NP_441633.1_3 Reverse -164 -177 -5.97891 0.236
NP_442998.1_5 Forward -278 -268 7.25653 0.298
NP_440731.1_2 Forward -141 -122 13.3725 0.193
NP_440299.1_1 Reverse -116 -129 7.09854 0.121
NP_441296.1_9 Reverse -208 -221 17.3249 0.118
NP_440306.1_8 Forward -90 -71 4.62021 0.204
NP_442993.1_1 Forward -33 -17 -11.0529 0.233
NP_441912.1_3 Reverse -155 -174 5.80098 0.297
NP_440027.1_8 Reverse -111 -130 6.58682 0.27
NP_439937.1_9 Reverse -175 -192 -14.3181 0.287
NP_443039.1_7 Reverse -207 -221 18.0918 0.0413
NP_441803.1_2 Reverse -121 -140 -1.18052 0.294
NP_441018.1_7 Reverse -327 -346 7.07928 0.277
NP_442262.1_10 Forward -274 -267 7.21728 0.281
NP_441689.1_5 Reverse -22 -32 5.68278 0.215
NP_440189.1_2 Forward -347 -328 5.50599 0.268
NP_440189.1_10 Reverse -315 -334 4.12936 0.279
NP_441640.1_8 Forward -140 -121 -5.70374 0.289
NP_440350.1_5 Reverse -329 -348 1.27776 0.158
NP_442280.1_10 Reverse -264 -282 5.35702 0.287
NP_441103.1_9 Forward -167 -157 12.5872 0.291
NP_441759.1_8 Reverse -170 -189 8.4551 0.211
NP_441929.1_6 Forward -360 -341 8.94757 0.262
NP_440936.1_6 Reverse -88 -100 20.1962 0.057
NP_441410.1_3 Forward -253 -234 3.83436 0.295
NP_440519.1_8 Reverse -61 -77 3.00846 0.254
NP_440454.1_2 Reverse -36 -50 14.1444 0.227
NP_440436.1_4 Reverse -115 -124 4.81753 0.239
NP_441884.1_8 Forward -203 -184 -8.26035 0.262
NP_440648.1_1 Forward -202 -183 3.14605 0.262
NP_441004.1_1 Forward -200 -181 -7.67036 0.199
NP_441004.1_1 Forward -141 -122 -10.1286 0.218
NP_441004.1_2 Forward -205 -186 -3.93378 0.286
NP_441004.1_3 Reverse -58 -77 5.01433 0.224
NP_441004.1_4 Forward -197 -187 9.22315 0.259
NP_441004.1_9 Reverse -59 -77 12.1855 0.257
NP_442813.1_4 Reverse -355 -374 -8.26035 0.299
NP_440296.1_10 Forward -205 -186 -13.9635 0.269
NP_442694.1_4 Reverse -64 -73 11.4061 0.277
NP_442206.1_10 Forward -129 -114 6.17475 0.178
NP_442854.1_6 Forward -175 -156 8.75091 0.22
NP_442208.1_5 Reverse -130 -149 -5.9004 0.266
NP_442939.1_5 Forward -104 -90 17.0004 0.269
NP_441668.1_5 Reverse -248 -267 6.09597 0.295
NP_441273.1_8 Forward -283 -264 -2.65548 0.296
NP_441982.1_6 Reverse -253 -262 10.7665 0.292
NP_441046.1_2 Reverse -62 -81 3.93269 0.231
NP_442689.1_8 Forward -51 -34 -4.87771 0.268
NP_442843.1_1 Forward -193 -174 -12.0953 0.298
NP_442006.1_2 Forward -284 -267 -19.234 0.299
NP_442348.1_2 Reverse -63 -72 6.5879 0.299
NP_440707.1_6 Reverse -344 -363 10.4217 0.283
NP_442443.1_1 Forward -193 -174 -5.60541 0.282
NP_442443.1_1 Reverse -227 -246 -5.99873 0.289
NP_440199.1_10 Forward -132 -122 13.353 0.108
NP_441040.1_2 Reverse -224 -243 -4.42544 0.167
NP_440486.1_6 Forward -209 -190 5.99764 0.284
NP_440459.1_2 Reverse -147 -164 8.59364 0.254
NP_443040.1_1 Forward -395 -381 15.8853 0.276
NP_441895.1_2 Forward -236 -217 -17.2085 0.213
NP_442055.1_8 Reverse -112 -131 11.405 0.254
NP_441044.1_4 Forward -75 -57 2.87075 0.238
NP_442943.1_1 Reverse -80 -95 10.6662 0.184
NP_442199.1_7 Reverse -28 -47 11.0117 0.118
NP_441508.1_4 Forward -346 -332 13.667 0.297
NP_441508.1_4 Reverse -255 -269 12.903 0.299
NP_441936.1_8 Forward -276 -257 21.2389 0.217
NP_441936.1_9 Forward -199 -180 20.059 0.0916
NP_440546.1_4 Forward -202 -192 9.07643 0.156
NP_442611.1_5 Reverse -332 -346 18.8791 0.182
NP_442402.1_4 Reverse -170 -189 -1.57461 0.194
NP_442039.1_10 Forward -80 -62 12.8997 0.232
NP_442470.1_3 Reverse -193 -212 11.995 0.201
NP_442541.1_10 Reverse -206 -220 8.06211 0.225
NP_442322.1_4 Reverse -141 -158 -10.1882 0.298
NP_443016.1_1 Reverse -187 -206 -4.22878 0.232
NP_441028.1_6 Reverse -237 -247 7.94438 0.217
NP_441028.1_6 Forward -262 -252 4.30615 0.278
NP_441527.1_4 Reverse -21 -40 -13.1306 0.298
NP_440007.1_9 Forward -133 -119 9.5377 0.171
NP_442728.1_2 Forward -193 -174 16.0274 0.194
NP_441972.1_3 Forward -212 -193 12.7825 0.257
NP_441106.1_7 Forward -373 -354 10.7167 0.297
NP_439903.1_6 Forward -85 -66 -0.591301 0.283
NP_442674.1_3 Reverse -242 -261 2.45694 0.3
NP_441705.1_3 Forward -191 -172 -6.1954 0.291
NP_440083.1_8 Forward -318 -299 6.29264 0.286
NP_440028.1_6 Forward -134 -116 12.2122 0.245
NP_440326.1_4 Forward -95 -76 22.4879 0.0257
NP_441463.1_2 Forward -105 -87 2.19674 0.24
NP_442238.1_1 Forward -227 -208 2.75272 0.215
NP_441431.1_3 Forward -215 -196 15.0441 0.162
NP_441993.1_1 Reverse -275 -294 5.94244 0.192
NP_440293.1_3 Forward -203 -184 -2.0655 0.239
NP_440293.1_10 Forward -197 -178 -1.27885 0.271
NP_440457.1_1 Forward -220 -208 -1.23932 0.3
NP_441428.1_1 Forward -94 -75 15.9291 0.0111
NP_442703.1_9 Forward -359 -341 12.3105 0.227
NP_442341.1_7 Reverse -119 -133 6.09611 0.135
NP_442341.1_9 Reverse -191 -205 6.0955 0.243
NP_441173.1_9 Forward -78 -70 10.2454 0.261
NP_443000.1_7 Reverse -164 -174 4.3066 0.203
NP_442513.1_4 Reverse -157 -176 17.4032 0.276
NP_441561.1_7 Reverse -182 -201 13.47 0.148
NP_442354.1_2 Forward -190 -171 1.67108 0.299
NP_441902.1_3 Reverse -71 -81 14.8281 0.205
NP_441902.1_3 Forward -351 -341 13.4676 0.23
NP_441207.1_7 Reverse -33 -47 14.6769 0.179
NP_442373.1_2 Forward -203 -184 -8.85033 0.253
NP_442015.1_10 Reverse -116 -129 -0.865694 0.285
NP_441226.1_7 Reverse -194 -201 8.29857 0.205
NP_443052.1_9 Reverse -184 -203 2.16274 0.175
NP_442154.1_1 Forward -155 -137 -15.5171 0.22
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAATTGAAAACATTCAAATGCAGGTCAACCAACAAAAGAGCGAAATTCTGGAGCAGAAAAACCAAGCCCTGCAACAAATGCAACAGGTGCAGTTATTAGAACTGAACCAAGAAGTCATCCAAGGACAGATGGAGAGCTTTTTCCGTATCCAAAAGGGGGACAACCTCGTGCAGAAAATGGGAGTGGAATTGGTACTGCGGGATGGGGTAGTGGAGGAAATCCGGGGTGAACTCTAGCCCCTGCCGAGGAGTTGTGCCTGGCAGCCTCAATGGAGATGGGAATGGTTAAGTATCGACTTTTCTAAAGACTTGTAACAACTTGTTTCCCAAAACTGCCCCCATATTGCAAAGTGTTGTTAATGTTTCTCACGATCTGTTTTTATCTAGGAGTTAACTATCC

CDS

ATGGCATTATCCGACACCCAAATTTTGGCAGCCCTAGTGGTTGCCCTCCTGCCTGCTTTCCTGGCTTTCCGTCTCTCCACGGAACTTTATAAGTAA

Protein

MALSDTQILAALVVALLPAFLAFRLSTELYK