Your browser is old and dusty. Try Google Chrome!

Details for sml0006

ORF sml0006
Accession NP_440648.1
Symbol rpl36
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L36
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -113 -127 -1.37704 0.258
NP_441418.1_6 Reverse -209 -228 -30.7781 0.296
NP_441453.1_1 Reverse -202 -220 4.73828 0.258
NP_441453.1_4 Forward -218 -210 6.80426 0.121
NP_441453.1_4 Reverse -209 -217 6.11594 0.121
NP_442151.1_6 Forward -218 -204 10.9143 0.113
NP_441818.1_9 Reverse -174 -193 -4.72043 0.242
NP_442173.1_1 Reverse -210 -218 12.0158 0.0316
NP_442173.1_1 Forward -217 -209 4.83764 0.241
NP_442752.1_4 Forward -218 -211 13.8055 0.0199
NP_442752.1_4 Forward -330 -323 10.5605 0.1
NP_443027.1_4 Forward -311 -301 5.87989 0.294
NP_441745.1_3 Forward -70 -51 13.6666 0.282
NP_441812.1_3 Forward -331 -317 8.35772 0.254
NP_440784.1_7 Forward -217 -210 6.23397 0.241
NP_440784.1_7 Reverse -210 -217 6.13563 0.241
NP_441054.1_2 Reverse -214 -233 9.14423 0.299
NP_440761.1_3 Reverse -378 -397 9.01981 0.263
NP_441900.1_2 Forward -276 -258 -6.66806 0.295
NP_441859.1_3 Reverse -208 -227 5.50519 0.198
NP_441935.1_1 Forward -324 -305 4.916 0.293
NP_441594.1_3 Reverse -252 -271 0.196116 0.176
NP_441925.1_2 Reverse -246 -265 2.94938 0.262
NP_441083.1_5 Reverse -209 -219 8.82982 0.03
NP_441083.1_5 Forward -218 -208 -1.00328 0.289
NP_441738.1_2 Reverse -211 -218 15.28 0.0102
NP_440209.1_1 Forward -218 -210 8.57422 0.0425
NP_440209.1_1 Reverse -209 -217 5.52596 0.0821
NP_442180.1_9 Reverse -328 -347 18.1898 0.13
NP_441327.1_1 Reverse -126 -145 8.44218 0.211
NP_441327.1_3 Forward -206 -187 19.6648 0.176
NP_442111.1_4 Reverse -208 -222 19.1741 0.00447
NP_441163.1_9 Forward -185 -166 14.0608 0.236
NP_440906.1_5 Forward -217 -210 6.23397 0.234
NP_440906.1_5 Reverse -210 -217 6.13563 0.241
NP_440747.1_10 Forward -221 -209 -2.4193 0.0434
NP_441012.1_4 Reverse -323 -336 9.65572 0.272
NP_443018.1_3 Reverse -210 -217 11.7405 0.0655
NP_443018.1_3 Forward -217 -210 5.44732 0.193
NP_441634.1_8 Forward -347 -333 -0.590395 0.262
NP_441643.1_3 Forward -221 -202 6.58763 0.291
NP_440376.1_1 Forward -218 -209 5.99792 0.111
NP_440376.1_1 Reverse -306 -315 0.884706 0.259
NP_440376.1_1 Reverse -209 -218 -0.196935 0.285
NP_442687.1_7 Forward -219 -209 4.50326 0.245
NP_442191.1_4 Reverse -210 -224 17.3923 0.0219
NP_441077.1_6 Forward -114 -98 7.14018 0.233
NP_441077.1_6 Forward -121 -105 2.60905 0.276
NP_441077.1_6 Reverse -64 -80 2.12702 0.289
NP_441846.1_10 Forward -340 -321 -23.2067 0.279
NP_442530.1_2 Reverse -63 -73 13.2547 0.247
NP_440642.1_10 Reverse -110 -124 11.4053 0.145
NP_441013.1_2 Forward -223 -205 -1.55415 0.282
NP_440042.1_2 Reverse -199 -218 8.94757 0.184
NP_440533.1_6 Reverse -173 -192 7.47261 0.297
NP_441763.1_5 Reverse -323 -342 -4.42544 0.24
NP_442658.1_1 Forward -220 -210 7.35439 0.214
NP_441414.1_9 Forward -218 -199 14.9458 0.0118
NP_441958.1_5 Reverse -208 -218 1.55333 0.095
NP_441958.1_5 Forward -219 -209 0.865012 0.12
NP_441958.1_5 Reverse -154 -164 -1.78992 0.252
NP_441127.1_1 Reverse -255 -269 12.6843 0.206
NP_441127.1_1 Forward -26 -12 8.06273 0.3
NP_439990.1_5 Forward -93 -80 5.52582 0.289
NP_442911.1_2 Forward -228 -209 -3.63879 0.115
NP_442911.1_2 Reverse -199 -218 -9.14533 0.25
NP_443055.1_6 Reverse -313 -331 5.91824 0.172
NP_440138.1_1 Reverse -278 -296 5.81991 0.275
NP_441348.1_3 Reverse -204 -223 10.0292 0.215
NP_441099.1_5 Reverse -199 -218 -8.35868 0.193
NP_442002.1_9 Forward -219 -212 10.7572 0.185
NP_442431.1_10 Forward -333 -315 1.39578 0.254
NP_441000.1_6 Reverse -208 -222 -3.04867 0.221
NP_440147.1_4 Forward -220 -207 7.6891 0.064
NP_440147.1_4 Reverse -311 -324 5.52582 0.122
NP_441550.1_8 Reverse -207 -217 12.8609 0.0296
NP_441550.1_8 Forward -220 -210 7.55106 0.154
NP_441041.1_7 Forward -221 -209 10.0414 0.103
NP_440569.1_6 Reverse -174 -193 13.6675 0.102
NP_439966.1_7 Reverse -207 -217 13.5492 0.0263
NP_439966.1_7 Forward -220 -210 8.23937 0.14
NP_439966.1_9 Forward -220 -211 0.884706 0.253
NP_442941.1_3 Reverse -210 -220 0.963343 0.16
NP_441514.1_6 Reverse -93 -100 14.2971 0.248
NP_441079.1_7 Reverse -133 -152 -6.58946 0.28
NP_440647.1_5 Forward -200 -181 34.4153 0.00000536
NP_440647.1_6 Forward -43 -24 24.6805 0.00544
NP_440647.1_7 Forward -176 -157 27.9255 0.000455
NP_440647.1_9 Forward -220 -202 31.2884 0.00000561
NP_442068.1_4 Reverse -327 -346 7.27514 0.23
NP_441644.1_6 Reverse -209 -219 7.15773 0.133
NP_441644.1_6 Forward -218 -208 5.68278 0.18
NP_443049.1_6 Forward -219 -209 11.6409 0.24
NP_442215.1_2 Forward -188 -172 -0.43312 0.167
NP_442247.1_8 Forward -220 -206 8.35772 0.273
NP_440253.1_2 Reverse -209 -227 0.510803 0.184
NP_440929.1_8 Reverse -209 -218 7.07956 0.0713
NP_442554.1_4 Reverse -256 -275 6.68596 0.291
NP_442554.1_8 Forward -217 -207 7.25653 0.0955
NP_442554.1_8 Reverse -210 -220 4.3066 0.189
NP_442554.1_8 Forward -61 -51 3.71661 0.215
NP_441762.1_7 Forward -219 -207 4.07055 0.0572
NP_442142.1_4 Forward -221 -208 2.87033 0.273
NP_442292.1_1 Reverse -210 -219 -0.196935 0.239
NP_443009.1_5 Forward -323 -312 4.38475 0.249
NP_442301.1_2 Forward -195 -176 7.17681 0.257
NP_441715.1_4 Reverse -210 -220 9.02648 0.105
NP_442076.1_8 Reverse -276 -295 8.65258 0.262
NP_441468.1_1 Forward -217 -210 6.13563 0.209
NP_441468.1_1 Reverse -210 -217 6.0373 0.223
NP_441020.2_6 Forward -174 -157 6.23369 0.27
NP_441020.2_6 Forward -34 -17 5.84037 0.289
NP_441015.1_10 Reverse -172 -191 -11.5053 0.298
NP_441673.1_1 Forward -218 -209 1.37636 0.114
NP_441673.1_1 Reverse -209 -218 1.1797 0.163
NP_441731.1_3 Forward -226 -207 2.3594 0.191
NP_441876.1_9 Forward -226 -216 13.3526 0.267
NP_441876.1_9 Reverse -167 -177 11.4843 0.275
NP_441764.1_8 Forward -235 -225 11.8849 0.284
NP_442868.1_6 Forward -220 -210 0.57002 0.217
NP_442427.1_8 Forward -331 -312 6.29264 0.244
NP_441944.1_2 Forward -23 -5 18.5039 0.169
NP_442808.1_1 Reverse -208 -218 9.71433 0.0481
NP_442050.1_5 Reverse -207 -217 14.0409 0.0259
NP_441114.1_3 Forward -320 -311 8.25953 0.231
NP_440558.1_2 Reverse -109 -128 -3.73712 0.238
NP_442789.1_4 Forward -141 -122 -3.44213 0.25
NP_442792.1_4 Reverse -177 -196 16.2241 0.141
NP_441878.1_6 Reverse -312 -322 -7.49312 0.231
NP_441036.1_8 Forward -219 -209 6.8632 0.213
NP_442650.1_2 Forward -127 -113 3.93283 0.194
NP_441557.1_5 Forward -218 -209 1.08137 0.0794
NP_441557.1_5 Reverse -209 -218 0.589713 0.134
NP_442066.2_9 Reverse -205 -218 18.0139 0.0209
NP_441458.1_8 Reverse -131 -150 6.61707 0.236
NP_442183.1_1 Forward -218 -204 8.35772 0.118
NP_442166.1_7 Reverse -210 -224 16.6175 0.141
NP_442444.1_6 Reverse -270 -288 14.4682 0.21
NP_442347.1_2 Reverse -210 -219 8.94785 0.0718
NP_440547.1_5 Reverse -3 -22 6.29264 0.281
NP_440235.1_6 Forward -156 -146 17.3053 0.198
NP_441633.1_3 Forward -220 -207 -4.11062 0.181
NP_440136.1_2 Forward -217 -210 6.23397 0.171
NP_440136.1_2 Reverse -210 -217 6.13563 0.193
NP_442998.1_5 Reverse -263 -273 11.9764 0.176
NP_442998.1_5 Forward -115 -105 8.04317 0.274
NP_442998.1_10 Reverse -211 -218 15.5754 0.0102
NP_440299.1_1 Reverse -114 -127 12.3101 0.0398
NP_441799.1_1 Reverse -205 -219 9.34041 0.0942
NP_441007.1_10 Reverse -174 -187 4.8375 0.182
NP_441007.1_10 Reverse -204 -217 1.69091 0.203
NP_440087.1_1 Reverse -255 -274 -8.35868 0.278
NP_441559.1_8 Forward -223 -209 2.2612 0.147
NP_440915.1_6 Forward -222 -208 19.9608 0.00738
NP_442158.1_4 Forward -130 -120 10.7964 0.283
NP_441261.1_6 Reverse -341 -360 17.9095 0.195
NP_441261.1_6 Forward -362 -343 17.2346 0.195
NP_440702.1_2 Reverse -174 -193 -8.65367 0.299
NP_442386.1_9 Forward -219 -210 5.9975 0.23
NP_442386.1_9 Reverse -208 -217 4.52254 0.297
NP_441750.1_4 Forward -222 -203 0.58944 0.297
NP_441340.1_5 Forward -217 -210 13.5105 0.0314
NP_441340.1_5 Reverse -210 -217 5.84064 0.208
NP_441254.1_1 Forward -234 -221 11.7201 0.295
NP_442240.1_2 Reverse -180 -199 -19.8634 0.295
NP_440586.1_8 Reverse -210 -217 9.47853 0.146
NP_440586.1_8 Forward -217 -210 5.74197 0.283
NP_441262.1_3 Forward -218 -211 14.7888 0.0223
NP_443051.1_1 Forward -219 -210 7.47288 0.0571
NP_443051.1_1 Reverse -208 -217 0.29472 0.195
NP_439937.1_9 Forward -265 -248 -4.58339 0.157
NP_439937.1_9 Reverse -208 -225 -10.9749 0.237
NP_440408.1_7 Reverse -300 -319 15.6341 0.149
NP_440439.1_1 Forward -221 -208 6.70579 0.0743
NP_440439.1_1 Reverse -206 -219 -1.849 0.285
NP_442239.1_8 Reverse -173 -192 8.25926 0.249
NP_440372.1_2 Forward -217 -210 13.8055 0.0214
NP_440372.1_2 Reverse -210 -217 6.52896 0.188
NP_440271.1_2 Reverse -297 -316 -0.983855 0.297
NP_442285.1_7 Forward -132 -113 4.62101 0.275
NP_440316.1_10 Forward -219 -209 11.1898 0.214
NP_442488.1_1 Reverse -164 -183 11.4058 0.167
NP_442488.1_4 Reverse -264 -283 7.17762 0.298
NP_442493.1_6 Reverse -180 -198 14.9655 0.261
NP_442887.1_5 Reverse -237 -256 -9.53865 0.264
NP_442384.1_10 Reverse -209 -222 7.09911 0.0875
NP_442114.1_4 Reverse -209 -220 8.4168 0.197
NP_441018.1_7 Forward -71 -52 8.35759 0.249
NP_442790.1_4 Forward -227 -208 4.03102 0.0729
NP_442262.1_10 Reverse -210 -217 13.2155 0.0213
NP_442262.1_10 Forward -344 -337 8.20058 0.25
NP_440163.1_10 Forward -59 -49 13.7464 0.116
NP_440163.1_10 Forward -333 -323 8.53483 0.271
NP_441965.1_10 Reverse -206 -222 2.91013 0.28
NP_441965.1_10 Forward -26 -10 2.12349 0.289
NP_440297.1_9 Forward -66 -56 0.176696 0.282
NP_442078.1_9 Reverse -264 -281 12.6252 0.264
NP_440999.1_9 Forward -222 -208 -2.06536 0.257
NP_440888.1_2 Reverse -209 -223 11.307 0.0705
NP_440575.1_8 Reverse -102 -121 -7.27704 0.298
NP_441543.1_2 Reverse -210 -219 8.65285 0.0968
NP_440739.1_10 Reverse -276 -295 25.5147 0.00396
NP_441178.1_6 Forward -189 -170 11.6017 0.188
NP_441319.1_6 Reverse -207 -226 26.1555 0.00238
NP_441319.1_8 Forward -224 -206 8.57394 0.231
NP_442710.1_7 Forward -151 -132 -8.56828 0.299
NP_441469.1_8 Reverse -312 -321 6.39124 0.227
NP_441469.1_8 Forward -219 -210 6.39124 0.227
NP_442578.1_7 Forward -217 -210 6.0373 0.18
NP_441462.1_2 Forward -218 -208 16.2046 0.00406
NP_441621.1_7 Reverse -207 -221 -3.24533 0.188
NP_441621.1_7 Forward -220 -206 -3.93365 0.198
NP_443062.1_1 Reverse -209 -227 6.01073 0.211
NP_443062.1_1 Reverse -321 -339 4.84065 0.247
NP_442204.1_1 Forward -222 -211 11.5634 0.0565
NP_442204.1_2 Forward -228 -209 18.0924 0.144
NP_442803.1_2 Forward -307 -290 20.0984 0.156
NP_440516.1_8 Forward -218 -209 18.9776 0.00442
NP_440516.1_8 Reverse -209 -218 5.01461 0.118
NP_442428.1_5 Forward -217 -210 6.13563 0.209
NP_442428.1_5 Reverse -210 -217 6.0373 0.212
NP_441867.1_6 Reverse -255 -274 11.8975 0.0762
NP_440673.1_3 Reverse -211 -218 12.4288 0.0426
NP_440673.1_3 Forward -320 -313 6.72562 0.277
NP_441052.1_2 Reverse -209 -219 1.25834 0.249
NP_440436.1_4 Reverse -210 -219 8.55409 0.0997
NP_440436.1_4 Reverse -279 -288 4.52254 0.256
NP_441884.1_9 Forward -299 -280 -4.22878 0.0594
NP_440648.1_1 Forward -218 -199 30.0887 0.0000587
NP_440648.1_2 Forward -347 -328 28.9088 0.000286
NP_440648.1_3 Forward -278 -260 22.6353 0.0621
NP_440648.1_4 Forward -185 -166 23.0089 0.0361
NP_440648.1_5 Forward -314 -295 25.0739 0.00106
NP_440648.1_6 Forward -239 -220 29.6945 0.000455
NP_440648.1_7 Forward -38 -19 22.3206 0.0435
NP_440648.1_8 Forward -164 -145 19.1731 0.241
NP_440648.1_9 Forward -368 -349 20.5506 0.0941
NP_440648.1_10 Forward -259 -241 30.8951 0.00028
NP_441719.1_4 Forward -217 -210 6.82395 0.0855
NP_441719.1_4 Reverse -210 -217 6.52896 0.188
NP_441733.1_10 Reverse -206 -219 3.95252 0.28
NP_440129.1_10 Forward -225 -211 14.0609 0.0534
NP_442873.1_5 Forward -192 -173 8.55343 0.259
NP_442694.1_9 Reverse -235 -254 9.24257 0.255
NP_440288.1_4 Reverse -65 -84 10.1267 0.26
NP_441851.1_2 Reverse -213 -232 8.06259 0.181
NP_441668.1_4 Reverse -303 -322 3.14605 0.187
NP_442515.1_1 Reverse -312 -326 2.2612 0.14
NP_440431.1_3 Forward -25 -6 -9.047 0.24
NP_442237.1_2 Reverse -135 -154 22.486 0.0198
NP_440195.1_1 Reverse -167 -186 6.39097 0.0954
NP_440483.1_1 Forward -223 -204 -4.81876 0.221
NP_441078.1_4 Forward -218 -209 0.196389 0.205
NP_441078.1_4 Reverse -209 -218 -0.000272808 0.205
NP_442443.1_1 Reverse -249 -268 -0.688862 0.226
NP_441432.1_8 Reverse -305 -314 9.53783 0.0755
NP_441432.1_8 Forward -219 -210 5.50626 0.151
NP_441432.1_8 Reverse -312 -321 3.53964 0.244
NP_441432.1_9 Reverse -132 -145 9.27706 0.28
NP_441333.1_1 Reverse -142 -152 16.6423 0.157
NP_442815.1_2 Forward -298 -280 4.54237 0.243
NP_442815.1_2 Forward -126 -108 3.3624 0.269
NP_442815.1_2 Reverse -253 -271 2.47742 0.295
NP_440760.1_1 Forward -218 -199 -23.305 0.293
NP_442797.1_6 Reverse -108 -127 13.1698 0.217
NP_441131.1_5 Reverse -305 -324 14.3558 0.0852
NP_442400.1_10 Reverse -384 -397 10.4704 0.261
NP_442489.1_2 Forward -191 -172 1.57275 0.285
NP_442489.1_7 Forward -218 -209 0.688044 0.152
NP_442489.1_7 Reverse -209 -218 0.688044 0.152
NP_441659.2_8 Forward -164 -154 2.63497 0.195
NP_441659.2_8 Forward -218 -208 1.84832 0.224
NP_441659.2_8 Reverse -118 -128 0.275027 0.27
NP_442849.1_3 Forward -88 -70 14.2771 0.139
NP_440708.1_6 Reverse -323 -342 -8.85033 0.259
NP_442346.1_5 Reverse -312 -322 10.5998 0.0917
NP_440010.1_4 Forward -63 -44 2.75194 0.222
NP_442311.1_5 Forward -29 -10 3.24438 0.247
NP_442603.1_7 Forward -218 -204 8.94708 0.161
NP_441888.1_7 Forward -223 -209 3.8345 0.225
NP_441948.1_4 Forward -225 -207 -3.32411 0.19
NP_441502.1_5 Reverse -214 -233 14.2574 0.184
NP_441833.1_4 Reverse -210 -217 6.52896 0.0924
NP_441833.1_4 Forward -217 -210 6.23397 0.163
NP_441329.1_6 Reverse -380 -399 1.57519 0.233
NP_442162.1_9 Forward -217 -210 12.9205 0.0282
NP_442162.1_9 Reverse -210 -217 12.9205 0.0282
NP_440671.1_4 Forward -336 -322 10.521 0.155
NP_442140.1_1 Reverse -109 -128 17.327 0.192
NP_442140.1_3 Reverse -210 -220 12.1731 0.0637
NP_440875.1_9 Reverse -211 -221 17.327 0.0126
NP_441813.1_5 Forward -220 -210 9.7148 0.0241
NP_441813.1_5 Reverse -207 -217 5.5849 0.118
NP_440590.1_4 Reverse -210 -223 5.82081 0.0585
NP_442497.1_10 Reverse -210 -219 0.589713 0.153
NP_442497.1_10 Forward -217 -208 -1.18024 0.256
NP_440821.1_4 Forward -220 -210 0.471689 0.174
NP_441239.1_9 Reverse -207 -219 15.8703 0.0178
NP_441239.1_9 Forward -266 -254 3.67722 0.279
NP_441212.1_7 Forward -64 -45 19.9606 0.139
NP_440604.1_6 Reverse -219 -238 -5.11376 0.267
NP_443012.1_10 Forward -308 -289 12.6841 0.175
NP_440212.1_9 Reverse -128 -147 1.52232 0.267
NP_440546.1_4 Forward -218 -208 15.6695 0.0459
NP_440546.1_4 Reverse -209 -219 6.55553 0.291
NP_440546.1_4 Forward -164 -154 6.45857 0.296
NP_440462.1_6 Reverse -207 -217 15.5163 0.0142
NP_440462.1_6 Forward -220 -210 7.74818 0.0699
NP_440868.1_4 Forward -222 -210 8.00379 0.0602
NP_440868.1_4 Reverse -205 -217 1.31728 0.186
NP_442499.1_1 Forward -329 -310 5.01433 0.226
NP_442479.1_9 Reverse -243 -262 -6.39206 0.266
NP_442479.1_9 Reverse -222 -241 -6.78538 0.266
NP_441848.1_4 Forward -240 -224 7.35968 0.29
NP_440653.1_3 Reverse -47 -66 11.0125 0.169
NP_442039.1_4 Forward -217 -210 11.6422 0.0747
NP_442039.1_4 Forward -31 -24 8.39725 0.202
NP_442039.1_7 Reverse -11 -21 7.64985 0.273
NP_442837.1_3 Forward -217 -210 6.0373 0.25
NP_442837.1_3 Reverse -210 -217 6.0373 0.25
NP_442053.1_1 Reverse -209 -218 14.4544 0.0114
NP_442053.1_1 Forward -218 -209 7.86621 0.0863
NP_440505.1_3 Forward -220 -210 14.3364 0.0224
NP_441701.1_3 Forward -339 -322 6.03703 0.294
NP_441252.1_6 Reverse -310 -317 14.3954 0.168
NP_442255.1_3 Forward -182 -163 13.7658 0.19
NP_442532.1_7 Forward -330 -316 7.27608 0.171
NP_442532.1_7 Forward -218 -204 3.44117 0.197
NP_440914.1_1 Forward -218 -208 10.8597 0.118
NP_441011.1_8 Forward -217 -208 11.5045 0.0778
NP_441011.1_8 Reverse -210 -219 7.07956 0.179
NP_440068.1_7 Forward -153 -135 17.3254 0.157
NP_442533.1_1 Forward -342 -323 -14.2585 0.241
NP_442533.1_6 Reverse -209 -218 4.42462 0.179
NP_442533.1_6 Reverse -313 -322 3.04799 0.228
NP_442322.1_4 Forward -194 -177 -7.92662 0.286
NP_441482.1_7 Forward -224 -210 -10.4235 0.209
NP_441028.1_6 Forward -100 -90 3.71617 0.281
NP_440115.1_6 Forward -221 -211 7.64985 0.146
NP_440007.1_9 Forward -222 -208 7.9644 0.193
NP_442492.1_2 Forward -218 -199 1.47442 0.226
NP_441106.1_1 Forward -219 -210 8.45619 0.0548
NP_439903.1_6 Reverse -275 -294 1.6703 0.241
NP_441286.1_1 Forward -219 -207 -5.27089 0.194
NP_440670.1_8 Forward -218 -209 8.75118 0.0606
NP_440670.1_8 Reverse -209 -218 6.19458 0.124
NP_440886.1_7 Forward -219 -209 6.86274 0.113
NP_440886.1_7 Reverse -208 -218 6.76441 0.114
NP_440886.1_7 Forward -265 -255 4.60114 0.227
NP_440886.1_7 Forward -192 -182 4.60114 0.227
NP_440907.2_8 Reverse -210 -220 6.17443 0.178
NP_441626.1_2 Forward -217 -210 12.2322 0.0511
NP_441626.1_2 Reverse -210 -217 5.93897 0.231
NP_440387.1_1 Forward -218 -202 -3.67804 0.164
NP_441431.1_2 Forward -221 -207 12.3887 0.12
NP_441488.1_7 Reverse -203 -222 6.88262 0.138
NP_441488.1_8 Forward -223 -209 9.43874 0.153
NP_441836.1_2 Reverse -272 -291 -3.04881 0.233
NP_441836.1_2 Reverse -203 -222 -3.83545 0.244
NP_441836.1_8 Reverse -240 -259 21.3373 0.0275
NP_442084.1_6 Forward -130 -112 6.41066 0.221
NP_440114.1_10 Forward -218 -204 9.93102 0.159
NP_442698.1_10 Forward -125 -106 12.2908 0.231
NP_440766.1_4 Forward -222 -208 3.53951 0.146
NP_439988.1_7 Forward -186 -172 14.8469 0.292
NP_441237.1_9 Reverse -306 -316 10.2065 0.241
NP_442930.1_1 Forward -232 -222 13.3526 0.239
NP_442867.1_8 Forward -101 -82 6.78429 0.253
NP_440457.1_1 Forward -222 -210 9.87208 0.092
NP_442680.1_5 Forward -215 -196 5.83596 0.216
NP_442297.1_4 Forward -334 -315 19.5326 0.128
NP_442297.1_4 Forward -222 -203 17.5874 0.128
NP_442509.1_9 Reverse -209 -219 9.71433 0.192
NP_441489.1_3 Forward -160 -146 9.08335 0.232
NP_440554.1_4 Reverse -210 -220 13.5497 0.0245
NP_441885.1_5 Forward -218 -208 -0.0199663 0.186
NP_440191.1_4 Forward -279 -269 13.0511 0.282
NP_443000.1_7 Forward -220 -210 1.84832 0.228
NP_440275.1_3 Forward -220 -210 12.8614 0.0299
NP_440275.1_3 Forward -190 -180 1.84832 0.282
NP_441397.1_8 Reverse -61 -74 12.9532 0.251
NP_440679.1_10 Forward -337 -318 -14.4552 0.234
NP_441635.1_2 Forward -149 -130 10.7424 0.283
NP_439962.1_4 Forward -226 -207 -9.047 0.298
NP_441105.1_3 Forward -229 -210 -3.63879 0.184
NP_441105.1_3 Reverse -301 -320 -5.40875 0.219
NP_440216.1_1 Reverse -209 -223 -4.4253 0.111
NP_440216.1_9 Reverse -60 -69 7.27622 0.286
NP_440216.1_9 Forward -16 -7 6.39124 0.289
NP_440172.1_1 Reverse -313 -323 9.7148 0.0586
NP_440172.1_1 Forward -218 -208 8.82982 0.0586
NP_440249.1_2 Forward -233 -223 13.8442 0.29
NP_442015.1_10 Forward -222 -209 2.18257 0.199
NP_442015.1_10 Reverse -114 -127 0.117615 0.241
NP_441226.1_7 Forward -217 -210 12.7234 0.0312
NP_441226.1_7 Reverse -210 -217 11.5435 0.0757
NP_441111.1_7 Reverse -210 -218 8.86921 0.0589
NP_441766.1_2 Reverse -209 -218 14.7494 0.00772
NP_442417.1_5 Reverse -209 -223 8.65272 0.15
NP_440416.1_9 Forward -225 -206 -14.4552 0.176
NP_440261.1_5 Reverse -210 -223 -4.89726 0.178
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTATTCCGCTTTATTTTTAGGAGGTCATTAACCGCTTGTCTAAACAAGATTTAATTGAGATGGAAGGCACGGTGATGGAGTCATTGCCCAATGCCATGTTTAGAGTCGATCTTGACAATGGTTTCAACGTTTTGGCCCACATCTCCGGCAAAATTCGTCGTAATTACATCAAAATTCTCCCCGGCGATCGGGTCAAAGTAGAATTAACCCCCTACGACCTCACCAAGGGGCGCATAACCTATCGTCTTAAAAATAAAAAGTAGTTATTAATTTGACGGTGGCAAAGGTAAAAAATTAATGCTTCCCCTCAGTGGGGAGAGTTAATTTAATATTTGCCATGACACGGCCACGATAACTTGTTATAATTAAGAGCTTGCAGTGTTGCCAAAGAAAATCAGGC

CDS

ATGAAAGTTAGAGCTTCCGTTAAGAAAATGTGTGATAAGTGCCGCGTTATTCGTCGGCGCGGTCGTGTGATGGTTATCTGTTCCGCTAACCCCAAGCATAAACAGCGTCAAGGTTAG

Protein

MKVRASVKKMCDKCRVIRRRGRVMVICSANPKHKQRQG