Your browser is old and dusty. Try Google Chrome!

Details for sml0005

ORF sml0005
Accession NP_440395.1
Symbol psbK
Category Photosystem II
Definition photosystem II PsbK protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -112 -98 7.57108 0.101
NP_441061.1_2 Reverse -288 -302 2.2612 0.178
NP_441061.1_2 Forward -238 -224 1.17956 0.193
NP_440795.1_7 Forward -112 -105 14.6904 0.0123
NP_440795.1_7 Reverse -105 -112 14.6904 0.0123
NP_440795.1_7 Reverse -300 -307 10.8555 0.132
NP_440795.1_7 Reverse -275 -282 9.77388 0.169
NP_441418.1_6 Reverse -287 -306 -20.3551 0.111
NP_441418.1_6 Forward -308 -289 -29.1065 0.216
NP_441418.1_6 Reverse -185 -204 -29.4998 0.228
NP_441418.1_6 Reverse -104 -123 -29.8932 0.245
NP_441418.1_6 Forward -113 -94 -29.9915 0.249
NP_441418.1_6 Forward -233 -214 -30.4831 0.28
NP_440815.1_5 Forward -269 -250 12.5858 0.193
NP_441453.1_1 Reverse -97 -115 3.06666 0.278
NP_441453.1_4 Reverse -104 -112 16.539 0.00633
NP_441453.1_4 Forward -113 -105 16.539 0.00633
NP_441453.1_4 Forward -296 -288 7.19758 0.0757
NP_441453.1_4 Reverse -287 -295 6.70593 0.121
NP_441453.1_4 Forward -233 -225 3.85433 0.284
NP_441453.1_7 Reverse -295 -302 13.4121 0.23
NP_442151.1_6 Reverse -287 -301 11.701 0.0933
NP_442151.1_6 Reverse -104 -118 8.45605 0.172
NP_442151.1_6 Forward -113 -99 6.3911 0.236
NP_442151.1_6 Forward -296 -282 5.01447 0.298
NP_442838.1_7 Reverse -99 -118 -9.93197 0.232
NP_441818.1_9 Reverse -194 -213 4.81767 0.153
NP_441818.1_9 Reverse -200 -219 -2.85214 0.209
NP_440226.1_1 Forward -113 -94 3.34271 0.229
NP_441630.1_3 Reverse -96 -115 7.66927 0.122
NP_440120.1_8 Forward -84 -66 20.2753 0.0682
NP_442287.1_1 Reverse -346 -356 12.8609 0.3
NP_442173.1_1 Forward -112 -104 15.4574 0.00633
NP_442173.1_1 Reverse -105 -113 15.4574 0.00633
NP_442173.1_1 Forward -295 -287 5.82095 0.2
NP_442173.1_1 Reverse -288 -296 5.72262 0.203
NP_442752.1_4 Reverse -287 -294 13.8055 0.0199
NP_442752.1_4 Forward -113 -106 13.8055 0.0199
NP_442752.1_4 Reverse -104 -111 13.8055 0.0199
NP_442752.1_4 Reverse -373 -380 12.1338 0.0546
NP_442752.1_4 Reverse -224 -231 7.90559 0.144
NP_442752.1_4 Forward -233 -226 5.25066 0.256
NP_443027.1_4 Forward -115 -105 15.3197 0.0437
NP_443027.1_4 Reverse -102 -112 13.943 0.0452
NP_443027.1_4 Reverse -297 -307 12.9597 0.0595
NP_443027.1_4 Forward -235 -225 7.64985 0.238
NP_443027.1_4 Reverse -371 -381 5.87989 0.294
NP_441812.1_3 Reverse -298 -312 11.701 0.21
NP_441812.1_3 Forward -351 -337 11.111 0.215
NP_442975.1_10 Reverse -100 -114 21.3367 0.00107
NP_442975.1_10 Forward -300 -286 10.6187 0.0541
NP_440784.1_7 Forward -112 -105 15.9687 0.0123
NP_440784.1_7 Reverse -105 -112 15.9687 0.0123
NP_440784.1_7 Forward -295 -288 6.23397 0.241
NP_440784.1_7 Reverse -288 -295 6.13563 0.241
NP_441054.1_2 Reverse -249 -268 12.0942 0.249
NP_441054.1_2 Reverse -314 -333 9.14423 0.299
NP_441054.1_4 Reverse -46 -64 2.67408 0.169
NP_441476.1_5 Reverse -99 -118 -2.65548 0.231
NP_442062.1_8 Forward -113 -103 19.4496 0.000558
NP_442062.1_8 Forward -233 -223 12.7631 0.0287
NP_442062.1_8 Reverse -104 -114 10.3048 0.0493
NP_442062.1_8 Reverse -287 -297 7.84651 0.0871
NP_441859.1_3 Reverse -286 -305 10.0284 0.121
NP_440304.1_4 Forward -115 -105 18.9579 0.00406
NP_440304.1_4 Reverse -102 -112 9.91146 0.051
NP_442242.1_4 Forward -112 -105 14.3954 0.0124
NP_442242.1_4 Reverse -105 -112 14.3954 0.0124
NP_442242.1_4 Reverse -288 -295 12.4288 0.0393
NP_440044.1_8 Reverse -288 -307 13.7658 0.0333
NP_440044.1_8 Forward -295 -276 11.1109 0.0513
NP_440908.1_2 Forward -215 -202 14.5717 0.269
NP_441161.1_8 Reverse -184 -203 18.1907 0.23
NP_441200.1_4 Reverse -116 -135 6.19431 0.283
NP_441208.1_9 Forward -116 -102 16.8142 0.0647
NP_441208.1_9 Reverse -101 -115 7.76774 0.219
NP_441208.1_9 Forward -299 -285 6.09611 0.253
NP_441208.1_9 Reverse -284 -298 5.30946 0.271
NP_441594.1_6 Forward -305 -286 5.80098 0.205
NP_441594.1_6 Forward -122 -103 4.12936 0.222
NP_441594.1_6 Reverse -95 -114 2.0644 0.256
NP_441594.1_6 Forward -74 -55 1.67108 0.264
NP_442196.1_10 Forward -82 -63 15.9291 0.149
NP_442742.1_9 Forward -195 -176 -8.35868 0.265
NP_442110.1_7 Reverse -287 -301 7.86607 0.106
NP_442110.1_7 Reverse -104 -118 1.27789 0.233
NP_442110.1_7 Forward -113 -99 0.0979218 0.267
NP_441925.1_4 Reverse -348 -367 -8.6544 0.211
NP_440856.1_4 Forward -120 -101 7.17762 0.0709
NP_440856.1_4 Forward -240 -221 5.50599 0.0852
NP_441083.1_5 Forward -113 -103 11.3864 0.0159
NP_441083.1_5 Reverse -104 -114 11.2881 0.0159
NP_441083.1_5 Reverse -287 -297 10.6981 0.0184
NP_441083.1_5 Forward -296 -286 2.04498 0.195
NP_441083.1_5 Reverse -224 -234 -0.708283 0.276
NP_442827.1_8 Reverse -96 -115 16.1249 0.032
NP_441434.1_7 Forward -111 -97 5.1128 0.225
NP_441434.1_7 Forward -294 -280 2.94952 0.266
NP_441738.1_2 Forward -294 -287 15.28 0.0102
NP_441738.1_2 Forward -111 -104 15.28 0.0102
NP_441738.1_2 Reverse -106 -113 15.28 0.0102
NP_441558.1_5 Forward -115 -96 14.0608 0.0523
NP_440209.1_1 Reverse -104 -112 18.1123 0.00295
NP_440209.1_1 Forward -113 -105 18.1123 0.00295
NP_440209.1_1 Reverse -287 -295 14.8674 0.012
NP_440209.1_1 Forward -296 -288 8.57422 0.0425
NP_442889.1_8 Reverse -101 -115 3.63724 0.273
NP_440447.1_6 Reverse -177 -195 2.18243 0.243
NP_441713.1_1 Reverse -98 -117 -13.7669 0.257
NP_441713.1_1 Forward -119 -100 -14.3569 0.259
NP_441713.1_1 Forward -302 -283 -15.9302 0.275
NP_441770.1_10 Forward -235 -216 10.3242 0.232
NP_440178.1_7 Forward -114 -95 -3.44213 0.0466
NP_441792.1_5 Forward -279 -263 10.6783 0.217
NP_441792.1_5 Reverse -224 -240 9.49831 0.234
NP_441716.1_1 Reverse -104 -118 11.0127 0.0936
NP_442111.1_4 Reverse -103 -117 11.3077 0.0514
NP_441163.1_1 Reverse -216 -233 4.46302 0.287
NP_441163.1_4 Forward -278 -259 15.1471 0.255
NP_440906.1_5 Forward -112 -105 15.8704 0.0124
NP_440906.1_5 Reverse -105 -112 15.8704 0.0124
NP_440906.1_5 Forward -295 -288 12.0355 0.0724
NP_440906.1_5 Reverse -288 -295 12.0355 0.0724
NP_440747.1_10 Forward -116 -104 7.80712 0.00223
NP_440747.1_10 Reverse -101 -113 -2.02597 0.0196
NP_440747.1_10 Forward -299 -287 -2.22263 0.026
NP_440747.1_10 Forward -236 -224 -2.4193 0.0434
NP_440747.1_10 Reverse -284 -296 -4.28759 0.0903
NP_441130.1_10 Forward -115 -101 10.521 0.112
NP_441130.1_10 Reverse -102 -116 9.73436 0.12
NP_441486.1_1 Forward -299 -285 -2.85201 0.175
NP_441486.1_1 Reverse -101 -115 -3.44199 0.178
NP_441486.1_1 Reverse -284 -298 -4.32697 0.194
NP_442634.1_4 Reverse -102 -116 14.3559 0.0195
NP_442634.1_4 Forward -115 -101 4.22782 0.0819
NP_442634.1_4 Reverse -222 -236 -4.4253 0.201
NP_441265.1_3 Forward -119 -105 6.6861 0.181
NP_440403.1_10 Forward -113 -94 17.699 0.0938
NP_440842.1_10 Forward -75 -61 5.01447 0.251
NP_441014.1_10 Forward -114 -95 2.35861 0.216
NP_442848.1_1 Forward -302 -288 -3.44199 0.267
NP_442848.1_1 Reverse -98 -112 -4.32697 0.287
NP_443018.1_3 Forward -112 -105 14.8871 0.0123
NP_443018.1_3 Reverse -105 -112 14.8871 0.0123
NP_443018.1_3 Forward -349 -342 10.2655 0.107
NP_443018.1_3 Forward -295 -288 5.34899 0.212
NP_443018.1_3 Reverse -288 -295 5.34899 0.212
NP_441316.1_7 Reverse -102 -117 13.6479 0.0486
NP_441634.1_8 Forward -235 -221 11.3077 0.0624
NP_441634.1_8 Forward -352 -338 6.88276 0.114
NP_441634.1_8 Forward -115 -101 5.60446 0.114
NP_440376.1_1 Forward -113 -104 19.4693 0.000692
NP_440376.1_1 Reverse -104 -113 19.4693 0.000692
NP_440376.1_1 Forward -296 -287 9.73449 0.0365
NP_440376.1_1 Reverse -287 -296 9.73449 0.0365
NP_440376.1_1 Forward -233 -224 7.07956 0.0869
NP_440376.1_1 Reverse -224 -233 6.39124 0.1
NP_440376.1_1 Reverse -373 -382 4.0313 0.182
NP_440376.1_1 Reverse -185 -194 -1.18024 0.294
NP_441588.1_4 Forward -294 -284 6.96153 0.178
NP_441588.1_4 Forward -111 -101 6.96153 0.178
NP_442687.1_7 Reverse -103 -113 15.8113 0.0125
NP_442687.1_7 Forward -114 -104 9.02648 0.0994
NP_442687.1_7 Reverse -286 -296 7.45319 0.132
NP_442485.1_3 Reverse -288 -307 -3.83545 0.277
NP_442530.1_2 Reverse -234 -244 14.1397 0.207
NP_441422.1_7 Reverse -102 -119 4.56207 0.107
NP_441950.1_7 Reverse -203 -222 -1.57384 0.194
NP_442658.1_1 Reverse -102 -112 18.7607 0.00222
NP_442658.1_1 Forward -115 -105 15.9091 0.00966
NP_442658.1_1 Reverse -222 -232 13.6475 0.0352
NP_442658.1_1 Forward -270 -260 8.63269 0.184
NP_442658.1_1 Forward -298 -288 6.27276 0.234
NP_440141.1_8 Forward -373 -354 6.19431 0.268
NP_440617.1_3 Reverse -221 -240 1.67108 0.293
NP_440617.1_3 Forward -304 -285 1.67108 0.293
NP_442782.1_2 Reverse -224 -238 2.5562 0.275
NP_442205.1_9 Reverse -98 -114 0.0585348 0.264
NP_442205.1_9 Forward -119 -103 -1.3181 0.264
NP_441414.1_9 Forward -113 -94 -10.9153 0.297
NP_441487.1_6 Forward -121 -102 8.16093 0.195
NP_442937.1_5 Reverse -99 -118 10.4225 0.161
NP_441958.1_5 Forward -114 -104 21.2195 0.000805
NP_441958.1_5 Reverse -103 -113 12.2714 0.00183
NP_441958.1_5 Reverse -286 -296 11.6814 0.00361
NP_441958.1_5 Forward -297 -287 2.53664 0.0409
NP_441958.1_5 Forward -234 -224 1.65166 0.0872
NP_440203.1_5 Forward -353 -343 15.7125 0.0611
NP_440203.1_5 Forward -293 -283 10.206 0.235
NP_440203.1_5 Reverse -107 -117 9.12434 0.271
NP_440269.1_1 Reverse -194 -212 18.112 0.173
NP_440984.1_7 Reverse -219 -233 16.5192 0.0403
NP_440984.1_7 Reverse -282 -296 11.6026 0.122
NP_440984.1_7 Forward -301 -287 8.25939 0.152
NP_440984.1_7 Reverse -99 -113 6.88276 0.195
NP_439990.1_5 Forward -118 -105 9.85238 0.13
NP_442376.1_2 Reverse -99 -118 -11.7019 0.286
NP_442690.1_1 Forward -56 -37 -15.5368 0.28
NP_442911.1_2 Forward -123 -104 -7.67036 0.216
NP_442911.1_2 Forward -306 -287 -9.53865 0.258
NP_440153.1_5 Reverse -105 -119 4.32615 0.199
NP_441591.1_10 Forward -235 -216 7.57094 0.275
NP_441591.1_10 Forward -115 -96 6.78429 0.279
NP_442536.1_8 Reverse -188 -207 14.5524 0.207
NP_440200.1_5 Forward -207 -188 8.65258 0.231
NP_443055.1_6 Reverse -56 -74 2.96833 0.201
NP_443055.1_6 Reverse -96 -114 0.903388 0.238
NP_443055.1_6 Reverse -252 -270 0.805058 0.239
NP_443055.1_6 Forward -113 -95 0.215075 0.248
NP_440993.1_2 Forward -118 -102 15.1032 0.0631
NP_440993.1_2 Reverse -99 -115 3.00846 0.262
NP_440993.1_3 Forward -306 -287 6.09517 0.148
NP_441348.1_3 Reverse -368 -387 6.4893 0.277
NP_441099.1_5 Forward -123 -104 -1.27885 0.106
NP_441099.1_5 Reverse -94 -113 -5.40875 0.151
NP_442002.1_9 Reverse -103 -110 10.7572 0.185
NP_441294.1_7 Reverse -100 -114 13.7621 0.0568
NP_441294.1_7 Forward -300 -286 9.4426 0.244
NP_442438.1_10 Reverse -99 -113 12.1926 0.0412
NP_442438.1_10 Forward -301 -287 5.99778 0.123
NP_442438.1_10 Forward -118 -104 5.70279 0.129
NP_442438.1_10 Reverse -219 -233 5.60446 0.131
NP_442431.1_10 Reverse -197 -215 4.24738 0.206
NP_441000.1_6 Forward -114 -100 5.1128 0.0933
NP_441000.1_6 Reverse -103 -117 -5.11362 0.261
NP_440605.1_4 Forward -123 -104 15.027 0.202
NP_442771.1_1 Forward -115 -97 -4.79907 0.166
NP_442771.1_1 Reverse -102 -120 -5.09406 0.166
NP_442771.1_1 Forward -219 -201 -10.3056 0.254
NP_440147.1_4 Reverse -285 -298 12.9006 0.0326
NP_440147.1_4 Reverse -102 -115 12.2123 0.0326
NP_440147.1_4 Forward -115 -102 11.819 0.0326
NP_440147.1_4 Forward -235 -222 6.4108 0.0939
NP_441550.1_8 Forward -115 -105 17.4824 0.00754
NP_441550.1_8 Reverse -102 -112 10.501 0.066
NP_441550.1_8 Forward -298 -288 7.64939 0.153
NP_441550.1_8 Reverse -285 -295 5.97777 0.22
NP_441916.1_7 Reverse -104 -114 18.9579 0.00144
NP_441916.1_7 Forward -113 -103 18.4663 0.00144
NP_441916.1_7 Forward -296 -286 9.41981 0.0357
NP_441916.1_7 Reverse -224 -234 6.37155 0.0988
NP_441916.1_10 Reverse -221 -240 0.982764 0.27
NP_440206.1_10 Reverse -220 -239 18.289 0.199
NP_441041.1_4 Forward -113 -94 -0.688862 0.0969
NP_441041.1_4 Reverse -373 -392 -3.24547 0.12
NP_441041.1_4 Reverse -287 -306 -13.4719 0.288
NP_441041.1_4 Forward -308 -289 -13.9635 0.299
NP_441041.1_7 Reverse -101 -113 19.5648 0.00277
NP_441041.1_7 Forward -116 -104 14.9975 0.0309
NP_441041.1_7 Reverse -221 -233 9.06962 0.124
NP_441041.1_7 Forward -299 -287 8.58373 0.133
NP_441547.1_2 Forward -124 -106 7.78729 0.215
NP_442004.1_6 Reverse -104 -118 3.73617 0.232
NP_442004.1_6 Reverse -224 -238 3.63784 0.235
NP_441725.1_5 Forward -112 -102 9.02648 0.0553
NP_441725.1_5 Reverse -105 -115 8.92815 0.0553
NP_441725.1_5 Reverse -288 -298 -0.806614 0.271
NP_439966.1_7 Reverse -102 -112 17.4824 0.00636
NP_439966.1_7 Forward -115 -105 13.8442 0.0234
NP_439966.1_7 Forward -384 -374 6.86274 0.163
NP_439966.1_7 Forward -298 -288 5.87944 0.204
NP_439966.1_7 Reverse -222 -232 5.19112 0.24
NP_439966.1_9 Reverse -102 -111 10.7178 0.0863
NP_439966.1_9 Reverse -203 -212 6.98123 0.253
NP_439966.1_9 Forward -115 -106 0.983037 0.253
NP_442941.1_3 Reverse -300 -310 12.5664 0.0116
NP_442941.1_3 Reverse -105 -115 10.9931 0.0116
NP_442941.1_3 Forward -112 -102 2.53664 0.14
NP_442941.1_3 Forward -295 -285 1.35667 0.15
NP_442941.1_3 Reverse -288 -298 1.16001 0.15
NP_442941.1_3 Reverse -225 -235 -0.0199663 0.244
NP_440289.1_2 Reverse -101 -114 12.9006 0.0132
NP_440289.1_2 Forward -116 -103 -4.50394 0.288
NP_440289.1_2 Forward -299 -286 -4.89726 0.294
NP_440289.1_4 Forward -300 -281 9.93088 0.257
NP_440983.1_5 Forward -280 -261 -4.13045 0.252
NP_440260.1_8 Reverse -220 -238 6.50899 0.154
NP_442281.1_1 Reverse -99 -113 16.8135 0.00698
NP_442281.1_1 Reverse -219 -233 10.8154 0.0537
NP_442281.1_1 Forward -301 -287 5.50552 0.155
NP_442281.1_1 Forward -387 -373 1.5723 0.296
NP_441334.1_7 Forward -115 -96 -8.752 0.12
NP_441334.1_7 Reverse -102 -121 -10.227 0.12
NP_442256.1_2 Forward -298 -280 -8.83064 0.236
NP_440437.1_1 Forward -119 -100 9.14423 0.0525
NP_441457.1_7 Forward -115 -96 11.8975 0.111
NP_440498.1_1 Forward -203 -185 3.95239 0.137
NP_443030.1_4 Reverse -340 -359 -1.57384 0.231
NP_441644.1_6 Reverse -104 -114 19.0557 0.000803
NP_441644.1_6 Reverse -287 -297 13.0576 0.0244
NP_441644.1_6 Forward -296 -286 10.206 0.0628
NP_441644.1_6 Forward -113 -103 10.1076 0.0628
NP_441644.1_6 Reverse -224 -234 7.74772 0.117
NP_441644.1_6 Forward -65 -55 4.30615 0.242
NP_441644.1_6 Forward -238 -228 3.71617 0.267
NP_442215.1_2 Reverse -285 -301 -1.02311 0.177
NP_442215.1_2 Forward -282 -266 -5.15301 0.246
NP_442215.1_2 Forward -359 -343 -5.34967 0.249
NP_442215.1_2 Forward -298 -282 -5.74299 0.256
NP_442215.1_2 Reverse -102 -118 -6.43131 0.271
NP_440253.1_2 Forward -113 -95 10.4422 0.0396
NP_440253.1_2 Reverse -72 -90 0.805796 0.176
NP_440253.1_2 Reverse -287 -305 -3.32411 0.291
NP_440929.1_8 Forward -113 -104 19.2726 0.000701
NP_440929.1_8 Reverse -104 -113 19.2726 0.000701
NP_440929.1_8 Forward -296 -287 9.73449 0.0257
NP_440929.1_8 Reverse -287 -296 9.4395 0.0326
NP_442933.1_10 Forward -113 -104 17.601 0.00325
NP_442933.1_10 Reverse -104 -113 17.601 0.00325
NP_442933.1_10 Reverse -287 -296 13.9627 0.0192
NP_442933.1_10 Forward -296 -287 8.1612 0.0885
NP_442933.1_10 Reverse -224 -233 4.42462 0.246
NP_440382.1_2 Reverse -26 -45 6.39016 0.259
NP_441751.2_8 Reverse -105 -119 24.189 0.00426
NP_441751.2_8 Reverse -225 -239 -4.91696 0.187
NP_441751.2_8 Forward -112 -98 -5.31028 0.202
NP_442554.1_8 Reverse -105 -115 19.1546 0.00369
NP_442554.1_8 Forward -112 -102 16.008 0.0065
NP_442554.1_8 Reverse -288 -298 8.53483 0.074
NP_442554.1_8 Forward -295 -285 6.66654 0.111
NP_442554.1_8 Reverse -225 -235 6.37155 0.12
NP_442554.1_8 Forward -232 -222 5.48657 0.146
NP_442554.1_8 Forward -237 -227 4.20827 0.193
NP_442554.1_8 Reverse -230 -240 3.61828 0.218
NP_442554.1_9 Reverse -187 -206 15.2663 0.217
NP_442863.1_5 Reverse -362 -381 18.879 0.169
NP_442970.1_1 Forward -94 -80 10.1338 0.269
NP_441762.1_7 Forward -114 -102 12.527 0.0142
NP_441762.1_7 Reverse -103 -115 11.7404 0.0142
NP_441762.1_7 Reverse -286 -298 -7.04085 0.285
NP_441762.1_7 Forward -234 -222 -7.04085 0.285
NP_442142.1_4 Forward -116 -103 15.4566 0.0264
NP_442142.1_4 Reverse -101 -114 14.4733 0.0311
NP_442142.1_4 Forward -299 -286 13.0967 0.0397
NP_442142.1_4 Forward -206 -193 9.16348 0.101
NP_442142.1_4 Forward -236 -223 5.52525 0.188
NP_442142.1_4 Reverse -221 -234 3.46031 0.255
NP_442142.1_4 Forward -227 -214 2.96866 0.269
NP_442292.1_1 Reverse -105 -114 17.5026 0.00435
NP_442292.1_1 Forward -112 -103 9.63616 0.0183
NP_442292.1_1 Reverse -288 -297 8.65285 0.0335
NP_442292.1_1 Forward -295 -286 7.76787 0.0615
NP_442381.1_8 Forward -116 -97 -14.5535 0.283
NP_442381.1_8 Reverse -221 -240 -14.9469 0.29
NP_443009.1_5 Forward -114 -103 19.626 0.00102
NP_443009.1_5 Forward -234 -223 15.7911 0.0107
NP_443009.1_5 Forward -297 -286 11.5629 0.0624
NP_443009.1_5 Forward -309 -298 9.49793 0.0962
NP_443009.1_5 Reverse -103 -114 7.82632 0.118
NP_442301.1_2 Forward -288 -269 6.29183 0.263
NP_442408.2_1 Forward -296 -277 -5.21209 0.269
NP_441715.1_4 Forward -112 -102 9.32148 0.097
NP_441715.1_4 Reverse -105 -115 7.25653 0.108
NP_440357.1_3 Reverse -102 -121 -0.688862 0.296
NP_441198.1_8 Forward -115 -105 15.4199 0.0427
NP_440379.1_5 Reverse -220 -239 0.196116 0.172
NP_440464.1_10 Reverse -389 -399 12.6262 0.202
NP_441468.1_1 Forward -112 -105 15.8704 0.0124
NP_441468.1_1 Reverse -105 -112 15.8704 0.0124
NP_441468.1_1 Forward -295 -288 6.13563 0.209
NP_441468.1_1 Reverse -288 -295 6.0373 0.223
NP_441468.1_1 Reverse -225 -232 3.97235 0.277
NP_441020.2_6 Forward -115 -98 19.9017 0.00668
NP_441673.1_1 Forward -113 -104 20.8459 0.000698
NP_441673.1_1 Reverse -104 -113 20.8459 0.000698
NP_441673.1_1 Forward -296 -287 11.1111 0.0121
NP_441673.1_1 Reverse -287 -296 11.0128 0.018
NP_441673.1_1 Forward -233 -224 1.27803 0.155
NP_441673.1_1 Reverse -224 -233 1.27803 0.155
NP_441826.1_2 Forward -302 -288 6.19444 0.0946
NP_441826.1_2 Forward -119 -105 5.30946 0.0977
NP_442490.1_9 Reverse -287 -306 -0.787193 0.179
NP_441764.1_6 Forward -398 -387 17.6599 0.253
NP_442868.1_6 Forward -115 -105 8.63316 0.0555
NP_442868.1_6 Reverse -102 -112 8.53483 0.0555
NP_442868.1_6 Forward -298 -288 7.74818 0.0697
NP_442719.1_2 Reverse -80 -98 -4.11147 0.208
NP_442719.1_2 Reverse -81 -99 -10.1096 0.269
NP_442677.1_5 Reverse -271 -290 12.7825 0.269
NP_441612.1_2 Reverse -373 -383 12.2282 0.21
NP_441944.1_2 Forward -308 -290 16.165 0.262
NP_442808.1_1 Reverse -103 -113 18.4657 0.00201
NP_442808.1_1 Forward -114 -104 8.73102 0.0481
NP_442808.1_1 Forward -297 -287 7.35439 0.0814
NP_442808.1_1 Reverse -223 -233 6.66608 0.102
NP_442808.1_1 Forward -234 -224 3.61784 0.234
NP_442808.1_1 Forward -383 -373 2.24121 0.274
NP_440145.1_3 Reverse -94 -113 6.68596 0.0509
NP_440145.1_3 Forward -123 -104 -1.7705 0.156
NP_442542.1_9 Reverse -217 -231 11.602 0.111
NP_442050.1_5 Forward -115 -105 17.1874 0.00812
NP_442050.1_5 Reverse -102 -112 8.23937 0.234
NP_442050.1_8 Reverse -218 -237 12.626 0.272
NP_442342.1_9 Reverse -102 -118 7.92501 0.196
NP_442342.1_9 Reverse -62 -78 2.71347 0.283
NP_440334.1_1 Forward -47 -28 13.4162 0.298
NP_440558.1_2 Reverse -343 -362 -1.18052 0.211
NP_440558.1_2 Forward -242 -223 -2.0655 0.222
NP_440558.1_2 Forward -359 -340 -2.26216 0.225
NP_440558.1_2 Reverse -226 -245 -5.50708 0.26
NP_440558.1_2 Reverse -220 -239 -5.9004 0.267
NP_441048.1_6 Forward -183 -169 16.7227 0.296
NP_440093.1_10 Reverse -278 -296 18.407 0.225
NP_441518.1_3 Reverse -94 -113 2.75272 0.0578
NP_441878.1_6 Forward -114 -104 10.5014 0.0176
NP_441878.1_6 Reverse -103 -113 10.4031 0.0176
NP_441878.1_6 Reverse -184 -194 1.65166 0.0795
NP_441878.1_6 Reverse -223 -233 1.55333 0.0937
NP_441878.1_6 Forward -297 -287 0.668351 0.139
NP_441878.1_6 Reverse -286 -296 0.668351 0.139
NP_441878.1_6 Reverse -228 -238 -0.0199663 0.163
NP_441878.1_6 Forward -234 -224 -0.216628 0.169
NP_441878.1_6 Reverse -258 -268 -7.78811 0.266
NP_441878.1_6 Reverse -372 -382 -7.98478 0.285
NP_441878.1_10 Reverse -234 -248 11.111 0.289
NP_441036.1_8 Reverse -103 -113 17.7779 0.000554
NP_441036.1_8 Forward -114 -104 15.713 0.00724
NP_441036.1_8 Reverse -286 -296 6.8632 0.213
NP_441036.1_8 Forward -297 -287 6.76487 0.215
NP_441557.1_5 Forward -113 -104 19.9609 0.000699
NP_441557.1_5 Reverse -104 -113 19.9609 0.000699
NP_441557.1_5 Forward -296 -287 10.2261 0.0144
NP_441557.1_5 Reverse -287 -296 10.1278 0.0188
NP_441557.1_5 Forward -233 -224 0.393051 0.166
NP_441557.1_5 Reverse -224 -233 0.393051 0.166
NP_441445.1_1 Forward -122 -103 4.62101 0.191
NP_441445.1_1 Reverse -95 -114 0.392778 0.275
NP_442066.2_4 Reverse -104 -123 16.9124 0.0486
NP_442066.2_4 Forward -113 -94 1.17943 0.152
NP_442066.2_9 Reverse -100 -113 8.47575 0.185
NP_442066.2_9 Reverse -220 -233 7.88576 0.202
NP_442777.1_1 Reverse -64 -83 9.04509 0.199
NP_441308.1_8 Forward -115 -105 12.4681 0.218
NP_441308.1_8 Forward -310 -300 9.61647 0.226
NP_441308.1_8 Reverse -222 -232 9.22315 0.226
NP_441308.1_8 Reverse -102 -112 9.22315 0.226
NP_440101.1_3 Reverse -282 -301 0.491109 0.298
NP_440101.1_10 Reverse -98 -117 10.7175 0.146
NP_442830.1_5 Reverse -223 -237 -1.67261 0.299
NP_442183.1_1 Forward -113 -99 16.6175 0.0139
NP_442183.1_1 Forward -308 -294 6.09611 0.188
NP_441407.1_5 Reverse -94 -113 12.6841 0.147
NP_442397.1_1 Forward -97 -83 14.2126 0.291
NP_442444.1_6 Reverse -221 -239 13.8879 0.224
NP_441549.1_9 Reverse -100 -118 -6.66736 0.203
NP_441549.1_9 Forward -242 -224 -9.51896 0.252
NP_441238.1_10 Reverse -363 -377 10.0294 0.292
NP_442170.1_5 Forward -113 -94 13.3725 0.0371
NP_442347.1_2 Forward -307 -298 14.2577 0.056
NP_442347.1_2 Forward -112 -103 11.1111 0.056
NP_442347.1_2 Reverse -389 -398 8.35786 0.0927
NP_442347.1_2 Reverse -105 -114 3.34298 0.284
NP_440547.1_1 Reverse -350 -369 7.96345 0.28
NP_441037.1_4 Forward -115 -105 16.5761 0.0168
NP_441037.1_4 Reverse -102 -112 16.2838 0.0168
NP_441037.1_4 Reverse -285 -295 13.9448 0.0515
NP_441037.1_4 Reverse -222 -232 12.7753 0.0886
NP_442317.1_6 Forward -118 -99 5.11266 0.24
NP_441633.1_3 Reverse -102 -115 5.91914 0.0481
NP_441633.1_3 Forward -115 -102 3.95252 0.0699
NP_441633.1_3 Forward -235 -222 -5.19226 0.229
NP_441633.1_3 Forward -288 -275 -5.38892 0.236
NP_441633.1_3 Reverse -285 -298 -6.07724 0.236
NP_442764.1_8 Forward -174 -155 3.83436 0.262
NP_440136.1_2 Forward -112 -105 15.9687 0.0123
NP_440136.1_2 Reverse -105 -112 15.9687 0.0123
NP_440136.1_2 Forward -295 -288 6.23397 0.171
NP_440136.1_2 Reverse -288 -295 6.13563 0.193
NP_440136.1_2 Reverse -300 -307 3.97235 0.288
NP_442590.1_9 Reverse -71 -90 3.24438 0.296
NP_442998.1_5 Reverse -234 -244 10.0098 0.231
NP_442998.1_10 Forward -294 -287 15.5754 0.0102
NP_442998.1_10 Forward -111 -104 15.5754 0.0102
NP_442998.1_10 Reverse -106 -113 15.5754 0.0102
NP_442998.1_10 Reverse -289 -296 5.74231 0.255
NP_440899.1_8 Reverse -37 -56 -10.227 0.277
NP_440299.1_1 Forward -300 -287 10.7368 0.0541
NP_440299.1_1 Forward -117 -104 8.96682 0.0819
NP_441799.1_1 Forward -117 -103 17.2068 0.0115
NP_441799.1_1 Reverse -283 -297 10.9137 0.0648
NP_441799.1_1 Reverse -100 -114 10.0287 0.0797
NP_441799.1_1 Forward -237 -223 8.94708 0.103
NP_442802.1_6 Reverse -286 -305 2.85105 0.204
NP_441007.1_10 Reverse -282 -295 8.27909 0.115
NP_441007.1_10 Reverse -99 -112 5.52582 0.18
NP_441007.1_10 Forward -118 -105 3.95252 0.182
NP_441007.1_10 Reverse -219 -232 2.18257 0.195
NP_441007.1_10 Forward -301 -288 0.707601 0.219
NP_442334.1_2 Forward -75 -58 -5.27103 0.2
NP_440256.1_1 Forward -236 -217 0.982764 0.0791
NP_440256.1_1 Forward -116 -97 -0.787193 0.0961
NP_440256.1_1 Forward -299 -280 -7.37537 0.234
NP_441512.1_4 Forward -117 -98 19.6656 0.0476
NP_441512.1_4 Reverse -283 -302 7.17762 0.281
NP_441559.1_8 Forward -118 -104 8.45605 0.0676
NP_441559.1_8 Forward -238 -224 -0.0987402 0.172
NP_441559.1_8 Reverse -342 -356 -5.60527 0.267
NP_442756.1_7 Reverse -1 -20 7.37428 0.188
NP_441270.1_5 Reverse -307 -326 13.775 0.211
NP_440915.1_6 Reverse -100 -114 15.4376 0.0183
NP_440915.1_6 Forward -300 -286 13.3726 0.0187
NP_440915.1_6 Reverse -220 -234 11.8976 0.0236
NP_440915.1_6 Forward -117 -103 10.6193 0.0301
NP_440915.1_6 Reverse -343 -357 -1.5737 0.239
NP_440915.1_6 Forward -386 -372 -2.06536 0.258
NP_442158.1_2 Reverse -27 -46 14.0846 0.293
NP_440717.1_1 Forward -232 -213 5.30933 0.276
NP_441866.1_6 Reverse -147 -166 9.63507 0.238
NP_442866.1_1 Reverse -189 -208 -9.53865 0.294
NP_441464.1_8 Forward -113 -99 10.521 0.178
NP_441464.1_10 Reverse -315 -329 13.4709 0.199
NP_441464.1_10 Reverse -321 -335 10.816 0.238
NP_441464.1_10 Reverse -198 -212 10.3243 0.262
NP_440026.1_7 Forward -238 -223 16.4995 0.159
NP_440695.1_5 Forward -308 -289 -0.4922 0.284
NP_440695.1_5 Reverse -287 -306 -2.36049 0.299
NP_441939.1_3 Forward -112 -93 14.3558 0.0777
NP_441939.1_3 Reverse -288 -307 5.99764 0.255
NP_441199.1_3 Forward -378 -360 1.19912 0.231
NP_441199.1_6 Reverse -100 -119 14.9458 0.0389
NP_441199.1_6 Forward -117 -98 2.55606 0.198
NP_442993.1_1 Forward -113 -97 -0.0397962 0.0684
NP_442993.1_1 Reverse -104 -120 -9.38124 0.185
NP_442386.1_9 Reverse -103 -112 15.7322 0.0144
NP_442386.1_9 Reverse -223 -232 10.914 0.111
NP_442386.1_9 Forward -114 -105 6.39082 0.219
NP_441750.1_4 Reverse -217 -236 5.70265 0.185
NP_441340.1_5 Forward -112 -105 15.6737 0.0124
NP_441340.1_5 Reverse -105 -112 15.6737 0.0124
NP_441340.1_5 Reverse -288 -295 6.13563 0.175
NP_441340.1_5 Forward -295 -288 5.93897 0.198
NP_441947.1_10 Reverse -102 -120 -0.964162 0.284
NP_440168.1_8 Reverse -223 -242 3.53937 0.244
NP_440168.1_9 Forward -366 -347 -0.295539 0.273
NP_440327.1_6 Reverse -305 -324 9.73422 0.206
NP_440327.1_6 Forward -376 -357 3.53937 0.284
NP_442714.1_7 Reverse -347 -366 -0.885524 0.274
NP_440586.1_1 Forward -120 -101 -5.40875 0.285
NP_440586.1_8 Forward -112 -105 13.2151 0.026
NP_440586.1_8 Reverse -105 -112 13.2151 0.026
NP_440586.1_8 Reverse -288 -295 11.4451 0.0645
NP_440586.1_8 Forward -349 -342 9.08521 0.178
NP_440586.1_8 Forward -64 -57 7.51192 0.239
NP_442251.1_6 Forward -112 -105 15.2804 0.0124
NP_442251.1_6 Reverse -105 -112 15.2804 0.0124
NP_442251.1_6 Forward -295 -288 12.0355 0.0627
NP_441262.1_3 Reverse -287 -294 14.7888 0.0223
NP_441262.1_3 Reverse -104 -111 14.7888 0.0223
NP_441262.1_3 Forward -113 -106 14.7888 0.0223
NP_443051.1_1 Forward -114 -105 19.5676 0.00335
NP_443051.1_1 Reverse -103 -112 10.4228 0.00754
NP_443051.1_1 Reverse -286 -295 9.93116 0.0146
NP_443051.1_1 Forward -297 -288 0.688044 0.134
NP_443051.1_1 Forward -234 -225 -0.000272808 0.245
NP_443051.1_5 Reverse -20 -39 8.84924 0.235
NP_439996.1_6 Reverse -190 -209 8.01048 0.257
NP_441232.1_2 Reverse -314 -333 13.0775 0.153
NP_439937.1_8 Reverse -203 -222 -2.45882 0.259
NP_439937.1_9 Reverse -103 -120 2.69307 0.0798
NP_439937.1_9 Forward -357 -340 -12.9415 0.278
NP_440439.1_1 Forward -116 -103 17.5222 0.0105
NP_440439.1_1 Reverse -101 -114 9.36073 0.0465
NP_440439.1_1 Forward -236 -223 9.2624 0.0465
NP_440439.1_1 Forward -197 -184 -2.144 0.298
NP_442239.1_8 Reverse -193 -212 8.35759 0.249
NP_440372.1_2 Forward -112 -105 16.3621 0.0124
NP_440372.1_2 Reverse -105 -112 16.3621 0.0124
NP_440372.1_2 Reverse -288 -295 6.72562 0.0929
NP_440372.1_2 Forward -295 -288 6.62729 0.151
NP_440271.1_2 Forward -89 -70 0.294447 0.292
NP_440574.1_3 Reverse -282 -301 1.76941 0.179
NP_441803.1_2 Reverse -282 -301 2.55606 0.209
NP_441803.1_2 Forward -238 -219 0.491109 0.251
NP_439977.1_5 Reverse -98 -117 4.52268 0.152
NP_440139.1_1 Reverse -98 -117 0.883656 0.279
NP_441572.1_7 Reverse -218 -237 2.45773 0.133
NP_442384.1_10 Reverse -224 -237 15.1623 0.0113
NP_442384.1_10 Forward -296 -283 11.7207 0.0337
NP_442384.1_10 Reverse -104 -117 8.37742 0.0656
NP_442384.1_10 Forward -308 -295 0.60927 0.286
NP_442114.1_4 Forward -113 -102 12.1534 0.107
NP_440364.1_10 Reverse -216 -235 16.3224 0.244
NP_442262.1_10 Forward -112 -105 14.1988 0.0123
NP_442262.1_10 Reverse -105 -112 14.1988 0.0123
NP_442262.1_10 Forward -349 -342 9.18389 0.211
NP_441689.1_5 Forward -115 -105 8.43603 0.132
NP_441689.1_5 Forward -310 -300 8.23937 0.142
NP_442244.1_3 Reverse -290 -309 9.0459 0.148
NP_442244.1_6 Forward -286 -267 8.55425 0.225
NP_440344.1_10 Reverse -97 -114 0.235503 0.0365
NP_440344.1_10 Forward -303 -286 -8.71262 0.132
NP_440344.1_10 Forward -120 -103 -9.79426 0.156
NP_440344.1_10 Reverse -217 -234 -12.8425 0.267
NP_440282.1_10 Forward -204 -185 7.37428 0.125
NP_441965.1_10 Reverse -221 -237 9.00665 0.123
NP_441965.1_10 Forward -299 -283 6.64671 0.167
NP_441965.1_10 Forward -311 -295 6.05672 0.187
NP_441965.1_10 Reverse -101 -117 2.71347 0.284
NP_440297.1_9 Forward -267 -257 7.45319 0.113
NP_440297.1_9 Forward -349 -339 -0.118297 0.282
NP_440297.1_9 Forward -112 -102 -0.216628 0.282
NP_440297.1_9 Reverse -342 -352 -0.216628 0.282
NP_440297.1_9 Reverse -105 -115 -0.314959 0.282
NP_441896.1_3 Reverse -95 -114 1.37609 0.217
NP_440999.1_9 Reverse -100 -114 11.6026 0.0438
NP_440999.1_9 Forward -300 -286 1.57289 0.162
NP_440999.1_9 Reverse -220 -234 -1.27871 0.232
NP_440888.1_2 Forward -113 -99 16.5185 0.00647
NP_440888.1_2 Reverse -104 -118 15.2402 0.0118
NP_440888.1_2 Forward -233 -219 14.1586 0.02
NP_440888.1_2 Reverse -287 -301 11.9953 0.0539
NP_440888.1_2 Forward -356 -342 9.43874 0.127
NP_440888.1_2 Forward -283 -269 5.99717 0.254
NP_442454.1_2 Forward -40 -21 7.97315 0.291
NP_440600.1_4 Reverse -279 -297 -2.73412 0.207
NP_440179.1_6 Reverse -105 -124 5.50599 0.238
NP_439969.1_3 Reverse -219 -238 -0.000545616 0.27
NP_442033.1_10 Reverse -102 -121 2.16274 0.0882
NP_441949.1_4 Reverse -195 -214 4.81767 0.281
NP_441543.1_2 Forward -112 -103 18.486 0.00236
NP_441543.1_2 Reverse -105 -114 15.9293 0.00518
NP_441543.1_2 Reverse -288 -297 7.47288 0.117
NP_441543.1_2 Forward -232 -223 6.48957 0.145
NP_441543.1_2 Forward -295 -286 6.19458 0.153
NP_442845.1_2 Forward -119 -105 13.2743 0.0955
NP_442845.1_2 Forward -239 -225 5.40779 0.233
NP_442845.1_2 Reverse -367 -381 5.30946 0.237
NP_441551.1_5 Reverse -100 -116 9.39927 0.21
NP_441469.1_1 Reverse -282 -301 14.6508 0.137
NP_441469.1_8 Reverse -103 -112 16.126 0.00797
NP_441469.1_8 Reverse -223 -232 14.7494 0.0342
NP_441469.1_8 Reverse -253 -262 8.94785 0.227
NP_441469.1_8 Forward -114 -105 6.5879 0.227
NP_442315.1_2 Reverse -368 -380 10.6587 0.291
NP_443064.1_6 Reverse -104 -114 10.8217 0.13
NP_443064.1_6 Forward -296 -286 9.75513 0.199
NP_442337.1_8 Reverse -259 -278 3.44104 0.216
NP_442578.1_7 Forward -112 -105 14.5921 0.026
NP_442578.1_7 Reverse -105 -112 14.5921 0.026
NP_442578.1_7 Reverse -288 -295 5.93897 0.183
NP_441462.1_2 Reverse -104 -114 20.2362 0.000805
NP_441462.1_2 Forward -113 -103 11.5831 0.00406
NP_441462.1_2 Forward -296 -286 10.5014 0.00824
NP_441462.1_2 Reverse -287 -297 2.14332 0.0801
NP_441462.1_2 Reverse -224 -234 0.668351 0.135
NP_441621.1_7 Reverse -102 -116 23.7957 0.00827
NP_441621.1_7 Forward -115 -101 6.48943 0.068
NP_441621.1_7 Reverse -222 -236 -5.11362 0.248
NP_443062.1_1 Reverse -104 -122 10.0085 0.122
NP_443062.1_1 Reverse -287 -305 7.47334 0.175
NP_443062.1_1 Forward -308 -290 7.37584 0.177
NP_443062.1_1 Forward -113 -95 6.69328 0.194
NP_442204.1_1 Reverse -283 -294 6.64685 0.157
NP_442204.1_1 Forward -272 -261 3.10693 0.266
NP_442204.1_1 Forward -117 -106 2.22195 0.266
NP_442204.1_5 Reverse -277 -296 6.4893 0.142
NP_442204.1_5 Reverse -214 -233 6.09597 0.147
NP_442204.1_5 Reverse -94 -113 1.76941 0.228
NP_441560.1_10 Reverse -251 -270 5.80098 0.292
NP_441351.1_8 Forward -226 -207 5.40766 0.202
NP_440516.1_8 Forward -113 -104 16.9127 0.00442
NP_440516.1_8 Reverse -104 -113 16.9127 0.00442
NP_440516.1_8 Reverse -287 -296 15.6344 0.00582
NP_440516.1_8 Forward -296 -287 7.47288 0.0581
NP_442428.1_5 Forward -112 -105 15.8704 0.0124
NP_442428.1_5 Reverse -105 -112 15.8704 0.0124
NP_442428.1_5 Reverse -225 -232 10.6589 0.0727
NP_442428.1_5 Forward -307 -300 9.57722 0.0852
NP_442428.1_5 Forward -295 -288 6.13563 0.209
NP_442428.1_5 Reverse -288 -295 6.0373 0.212
NP_440818.1_3 Reverse -376 -395 6.4893 0.121
NP_441790.1_3 Reverse -195 -214 -4.52377 0.291
NP_442120.1_10 Reverse -98 -117 -7.08038 0.217
NP_440673.1_2 Reverse -277 -296 12.3406 0.149
NP_440673.1_2 Reverse -94 -113 11.6578 0.167
NP_440673.1_3 Forward -294 -287 12.4288 0.0426
NP_440673.1_3 Forward -111 -104 12.4288 0.0426
NP_440673.1_3 Reverse -106 -113 12.4288 0.0426
NP_441714.1_3 Forward -303 -285 13.0964 0.25
NP_440865.1_9 Reverse -98 -117 -5.70374 0.216
NP_441052.1_2 Forward -113 -103 10.5014 0.0285
NP_441052.1_2 Reverse -104 -114 10.4031 0.0285
NP_441052.1_2 Reverse -287 -297 10.3048 0.0289
NP_441052.1_2 Reverse -224 -234 5.38824 0.12
NP_441052.1_2 Forward -397 -387 4.69992 0.149
NP_441052.1_2 Reverse -373 -383 4.0116 0.168
NP_441052.1_2 Forward -296 -286 0.668351 0.256
NP_442219.1_8 Forward -306 -287 8.07047 0.257
NP_442219.1_9 Forward -112 -103 8.35786 0.0681
NP_442219.1_9 Reverse -105 -114 8.25953 0.0681
NP_442219.1_9 Reverse -288 -297 7.96454 0.0696
NP_442219.1_9 Forward -282 -273 2.75299 0.233
NP_442219.1_9 Reverse -389 -398 2.35967 0.28
NP_440436.1_4 Forward -112 -103 18.1905 0.00233
NP_440436.1_4 Reverse -288 -297 13.9623 0.0193
NP_440436.1_4 Reverse -105 -114 9.24241 0.0871
NP_440436.1_4 Forward -295 -286 5.9975 0.174
NP_440436.1_4 Forward -232 -223 5.50585 0.195
NP_441884.1_8 Reverse -103 -122 -9.63698 0.268
NP_441884.1_9 Forward -299 -280 -14.1602 0.138
NP_441884.1_9 Reverse -101 -120 -22.0267 0.275
NP_441884.1_9 Reverse -284 -303 -22.6167 0.281
NP_440314.1_9 Reverse -348 -367 -8.16202 0.245
NP_441719.1_4 Forward -112 -105 16.3621 0.0124
NP_441719.1_4 Reverse -105 -112 16.3621 0.0124
NP_441719.1_4 Reverse -288 -295 6.72562 0.093
NP_441719.1_4 Forward -295 -288 6.62729 0.151
NP_441733.1_10 Forward -116 -103 15.6539 0.0564
NP_441733.1_10 Reverse -101 -114 10.5407 0.106
NP_441004.1_1 Reverse -188 -207 -12.8819 0.251
NP_441004.1_1 Reverse -367 -386 -13.4719 0.257
NP_441004.1_1 Reverse -271 -290 -17.1101 0.289
NP_441004.1_2 Forward -366 -347 -4.72043 0.296
NP_441004.1_3 Forward -113 -94 7.86593 0.204
NP_441004.1_3 Reverse -221 -240 1.86774 0.282
NP_442366.1_3 Reverse -103 -121 -2.3408 0.226
NP_442366.1_3 Reverse -286 -304 -3.22577 0.244
NP_442366.1_3 Forward -114 -96 -5.58572 0.289
NP_442366.1_5 Reverse -284 -294 17.2858 0.0141
NP_442873.1_2 Forward -300 -281 9.7334 0.266
NP_442873.1_9 Forward -306 -287 6.1935 0.259
NP_440296.1_10 Forward -299 -280 -13.0786 0.269
NP_441115.1_4 Reverse -286 -304 20.4712 0.00493
NP_441115.1_4 Reverse -103 -121 18.1112 0.0152
NP_440328.1_4 Forward -302 -283 5.40766 0.148
NP_443054.1_2 Forward -115 -101 12.586 0.0722
NP_443054.1_2 Forward -235 -221 9.2427 0.102
NP_442430.1_10 Reverse -94 -113 17.9932 0.072
NP_441851.1_10 Reverse -103 -113 16.008 0.00552
NP_441851.1_10 Reverse -223 -233 12.6647 0.046
NP_441851.1_10 Forward -114 -104 8.53483 0.114
NP_441851.1_10 Forward -297 -287 6.07655 0.187
NP_441851.1_10 Reverse -298 -308 4.99491 0.233
NP_442622.1_5 Reverse -222 -241 -5.50708 0.278
NP_441542.1_4 Forward -93 -79 5.01447 0.264
NP_442011.1_1 Reverse -103 -122 7.37428 0.186
NP_441668.1_4 Forward -248 -229 6.4893 0.163
NP_442515.1_1 Forward -114 -100 -3.34366 0.29
NP_440593.1_3 Forward -285 -266 -0.688862 0.209
NP_440593.1_3 Forward -301 -282 -1.37718 0.211
NP_440165.1_5 Reverse -286 -305 1.0811 0.134
NP_440165.1_5 Reverse -103 -122 -3.04881 0.22
NP_441349.1_10 Forward -123 -104 9.0459 0.0251
NP_441349.1_10 Reverse -277 -296 -2.65548 0.124
NP_441349.1_10 Forward -243 -224 -2.85214 0.127
NP_441409.1_6 Forward -119 -100 -6.78538 0.136
NP_440432.1_9 Forward -112 -97 8.92802 0.0427
NP_440432.1_9 Forward -232 -217 -2.97003 0.177
NP_440432.1_9 Forward -295 -280 -5.91996 0.275
NP_439960.1_4 Reverse -190 -209 13.8633 0.23
NP_439960.1_6 Forward -239 -220 13.0775 0.186
NP_440474.1_8 Forward -112 -98 19.1735 0.0423
NP_440474.1_8 Reverse -105 -119 9.53707 0.16
NP_440431.1_4 Reverse -22 -41 -7.68752 0.264
NP_440588.1_2 Forward -242 -223 12.1925 0.0281
NP_440588.1_2 Forward -122 -103 8.35759 0.0455
NP_440195.1_5 Reverse -98 -117 3.93269 0.273
NP_442006.1_2 Reverse -215 -232 -15.5958 0.228
NP_442006.1_2 Forward -81 -64 -18.3491 0.29
NP_441570.1_1 Forward -296 -278 -8.04399 0.101
NP_441570.1_1 Forward -113 -95 -9.81395 0.15
NP_441570.1_1 Reverse -287 -305 -12.8622 0.219
NP_441570.1_1 Reverse -104 -122 -15.3205 0.229
NP_441570.1_1 Reverse -185 -203 -17.5821 0.283
NP_441078.1_4 Forward -113 -104 19.6659 0.0007
NP_441078.1_4 Reverse -104 -113 19.6659 0.0007
NP_441078.1_4 Reverse -224 -233 14.8477 0.00707
NP_441078.1_4 Forward -296 -287 9.93116 0.0203
NP_441078.1_4 Reverse -287 -296 9.83282 0.0226
NP_441078.1_4 Forward -233 -224 0.589713 0.174
NP_441078.1_4 Forward -194 -185 -0.983583 0.213
NP_441078.1_4 Reverse -373 -382 -2.06522 0.295
NP_441078.1_4 Forward -382 -373 -2.06522 0.295
NP_441539.1_1 Forward -57 -43 12.0937 0.284
NP_440526.1_3 Reverse -288 -299 18.446 0.0306
NP_440526.1_3 Forward -112 -101 11.7595 0.0646
NP_440526.1_3 Reverse -105 -116 9.3996 0.0876
NP_440526.1_3 Forward -232 -221 2.02482 0.267
NP_441432.1_8 Forward -114 -105 16.8143 0.00595
NP_441432.1_8 Reverse -103 -112 8.25953 0.0755
NP_441432.1_8 Reverse -286 -295 7.17789 0.102
NP_441432.1_8 Forward -297 -288 7.07956 0.105
NP_441432.1_8 Forward -269 -260 5.60459 0.147
NP_441432.1_8 Reverse -346 -355 2.65466 0.292
NP_442320.1_8 Reverse -98 -112 16.4209 0.00839
NP_442320.1_8 Forward -302 -288 3.73617 0.0578
NP_441732.1_2 Reverse -283 -299 1.5335 0.0368
NP_441732.1_2 Forward -117 -101 -6.43131 0.0495
NP_442540.1_5 Forward -238 -219 12.7816 0.233
NP_440629.1_6 Forward -119 -100 14.5548 0.172
NP_442157.1_3 Reverse -62 -81 18.2882 0.225
NP_442178.1_2 Forward -211 -192 7.96426 0.083
NP_440913.1_1 Reverse -371 -389 9.16393 0.179
NP_440913.1_1 Forward -235 -217 8.86894 0.181
NP_440913.1_1 Forward -115 -97 6.60732 0.224
NP_443011.1_4 Reverse -190 -209 24.6805 0.00646
NP_442968.1_8 Reverse -260 -279 15.2408 0.145
NP_440713.1_4 Forward -123 -104 15.0441 0.081
NP_442489.1_7 Forward -113 -104 20.1576 0.000695
NP_442489.1_7 Reverse -104 -113 20.1576 0.000695
NP_442489.1_7 Forward -296 -287 10.6195 0.00984
NP_442489.1_7 Reverse -287 -296 10.3245 0.0193
NP_442489.1_7 Reverse -224 -233 8.06287 0.0371
NP_442489.1_7 Forward -233 -224 0.589713 0.17
NP_442489.1_7 Reverse -373 -382 -1.57357 0.213
NP_442079.1_7 Reverse -105 -124 1.47442 0.251
NP_440559.1_1 Forward -112 -103 8.75118 0.0586
NP_440559.1_1 Reverse -105 -114 8.65285 0.0586
NP_440559.1_1 Reverse -288 -297 7.96454 0.0739
NP_440559.1_1 Forward -295 -286 5.40793 0.14
NP_441659.2_8 Reverse -104 -114 20.9245 0.000805
NP_441659.2_8 Reverse -287 -297 14.828 0.00801
NP_441659.2_8 Forward -113 -103 11.9764 0.0147
NP_441659.2_8 Forward -296 -286 11.3864 0.0184
NP_441659.2_8 Reverse -224 -234 1.35667 0.242
NP_441659.2_8 Forward -233 -223 0.176696 0.271
NP_442913.1_10 Forward -305 -286 11.5042 0.0421
NP_442913.1_10 Reverse -278 -297 4.52268 0.0864
NP_442913.1_10 Reverse -215 -234 -5.21209 0.26
NP_439956.1_7 Forward -361 -342 3.04771 0.262
NP_440779.1_5 Forward -233 -216 -5.46769 0.149
NP_440779.1_5 Forward -113 -96 -13.4325 0.212
NP_442346.1_5 Forward -114 -104 16.303 0.00248
NP_442346.1_5 Reverse -286 -296 14.9263 0.00941
NP_442346.1_5 Reverse -103 -113 9.02648 0.118
NP_442346.1_5 Forward -297 -287 6.96153 0.187
NP_442346.1_5 Forward -234 -224 5.48657 0.243
NP_440545.1_3 Forward -117 -100 9.57695 0.0391
NP_440545.1_3 Reverse -100 -117 7.41366 0.0499
NP_440545.1_3 Forward -300 -283 -2.41943 0.184
NP_440545.1_3 Forward -237 -220 -4.58271 0.229
NP_441923.1_6 Reverse -192 -206 8.65272 0.278
NP_440486.1_5 Reverse -192 -211 9.24257 0.255
NP_441653.1_2 Forward -307 -288 13.5795 0.0959
NP_440010.1_10 Reverse -188 -207 11.8975 0.192
NP_440847.1_3 Reverse -64 -78 10.3237 0.298
NP_442603.1_7 Forward -65 -51 5.99717 0.264
NP_442603.1_7 Forward -209 -195 5.50552 0.29
NP_440946.1_6 Forward -375 -356 3.73603 0.294
NP_440449.1_6 Reverse -216 -234 10.2011 0.159
NP_440449.1_6 Reverse -96 -114 8.45036 0.201
NP_440449.1_6 Forward -304 -286 7.08868 0.232
NP_441948.1_4 Forward -120 -102 1.10079 0.134
NP_441833.1_4 Forward -112 -105 15.9687 0.0124
NP_441833.1_4 Reverse -105 -112 15.9687 0.0124
NP_441833.1_4 Forward -295 -288 14.1004 0.0258
NP_441833.1_4 Reverse -288 -295 6.13563 0.198
NP_443040.1_1 Reverse -24 -38 11.1503 0.277
NP_442799.1_8 Forward -343 -324 8.47633 0.264
NP_442162.1_9 Forward -112 -105 16.2637 0.0124
NP_442162.1_9 Reverse -105 -112 16.2637 0.0124
NP_442162.1_9 Forward -295 -288 6.62729 0.142
NP_442162.1_9 Reverse -288 -295 6.52896 0.178
NP_440671.1_4 Forward -119 -105 7.47274 0.217
NP_440671.1_5 Reverse -66 -80 15.8302 0.208
NP_442199.1_5 Reverse -96 -115 4.42435 0.106
NP_442199.1_5 Forward -241 -222 -1.57384 0.181
NP_442199.1_5 Reverse -221 -240 -4.6221 0.229
NP_442140.1_3 Forward -112 -102 17.4829 0.0159
NP_442140.1_3 Reverse -288 -298 12.0747 0.0664
NP_442140.1_3 Reverse -105 -115 7.94484 0.124
NP_442140.1_3 Forward -232 -222 3.91327 0.271
NP_442723.1_1 Forward -386 -367 6.98015 0.276
NP_440875.1_9 Forward -111 -101 17.619 0.0104
NP_440875.1_9 Reverse -106 -116 17.5217 0.0116
NP_440875.1_9 Reverse -226 -236 12.5575 0.113
NP_440875.1_9 Forward -236 -226 10.8055 0.196
NP_441813.1_5 Reverse -102 -112 10.0098 0.0208
NP_441813.1_5 Forward -115 -105 8.73149 0.0367
NP_441813.1_5 Forward -298 -288 -0.806614 0.285
NP_440594.1_8 Reverse -105 -118 10.9334 0.153
NP_440590.1_4 Reverse -288 -301 12.0157 0.0166
NP_440590.1_4 Forward -112 -99 11.9173 0.0173
NP_440590.1_4 Forward -232 -219 0.904263 0.14
NP_440590.1_4 Forward -295 -282 -1.45568 0.22
NP_440590.1_4 Reverse -105 -118 -3.4223 0.255
NP_440590.1_4 Reverse -374 -387 -5.97891 0.296
NP_440567.1_1 Forward -112 -98 11.8976 0.0265
NP_440567.1_1 Reverse -105 -119 10.3243 0.0377
NP_440567.1_1 Reverse -288 -302 6.19444 0.0871
NP_442497.1_10 Reverse -105 -114 17.601 0.00813
NP_442497.1_10 Forward -112 -103 10.4228 0.0087
NP_442497.1_10 Forward -295 -286 7.86621 0.0695
NP_442497.1_10 Reverse -288 -297 0.589713 0.153
NP_440821.1_4 Reverse -102 -112 18.7612 0.00422
NP_440821.1_4 Forward -115 -105 10.7964 0.0146
NP_440821.1_4 Forward -298 -288 8.23984 0.053
NP_440821.1_4 Reverse -297 -307 5.5849 0.109
NP_440821.1_4 Reverse -222 -232 -0.806614 0.296
NP_441239.1_9 Forward -115 -103 17.4436 0.0146
NP_441239.1_9 Reverse -102 -114 16.0669 0.0175
NP_441239.1_9 Reverse -227 -239 14.002 0.0318
NP_441239.1_9 Forward -235 -223 12.3303 0.0477
NP_441239.1_9 Reverse -107 -119 8.79043 0.122
NP_441239.1_9 Reverse -222 -234 5.74217 0.21
NP_440156.1_3 Reverse -92 -111 7.17762 0.253
NP_440542.1_2 Forward -39 -22 19.8034 0.136
NP_441727.1_3 Reverse -97 -116 3.93269 0.275
NP_441892.1_1 Forward -122 -105 0.530496 0.167
NP_441892.1_1 Reverse -95 -112 -2.41943 0.221
NP_441892.1_1 Reverse -278 -295 -5.46769 0.281
NP_440604.1_6 Reverse -104 -123 -5.11376 0.267
NP_442044.1_1 Forward -238 -219 -3.54046 0.176
NP_442044.1_1 Forward -73 -54 -10.4236 0.271
NP_440546.1_4 Reverse -104 -114 13.5365 0.0459
NP_440546.1_4 Forward -113 -103 11.8882 0.0679
NP_440546.1_4 Reverse -287 -297 8.00989 0.209
NP_440546.1_4 Forward -233 -223 6.94336 0.269
NP_440654.1_1 Forward -280 -261 8.35759 0.256
NP_442041.1_5 Reverse -218 -237 3.14605 0.244
NP_440462.1_4 Reverse -193 -207 8.94771 0.249
NP_440462.1_6 Forward -115 -105 19.4496 0.00371
NP_440462.1_6 Reverse -102 -112 17.9746 0.00578
NP_440462.1_6 Forward -235 -225 7.15819 0.089
NP_440462.1_6 Reverse -371 -381 4.69992 0.187
NP_440868.1_4 Forward -117 -105 14.4936 0.0176
NP_440868.1_4 Reverse -100 -112 9.77374 0.043
NP_440868.1_4 Reverse -283 -295 8.10212 0.0602
NP_440401.1_9 Forward -328 -321 14.5917 0.287
NP_441868.1_4 Forward -240 -226 15.5359 0.282
NP_442402.1_4 Forward -177 -158 -9.24438 0.287
NP_441848.1_7 Forward -388 -369 -3.83621 0.285
NP_441848.1_7 Reverse -238 -257 -4.22953 0.288
NP_441084.1_6 Reverse -227 -241 13.9011 0.115
NP_441084.1_6 Forward -115 -101 11.2833 0.208
NP_441084.1_6 Forward -235 -221 9.05325 0.295
NP_440653.1_10 Reverse -288 -307 6.98095 0.203
NP_440696.1_6 Reverse -275 -294 3.73603 0.288
NP_442039.1_4 Forward -112 -105 15.1821 0.0124
NP_442039.1_4 Reverse -105 -112 15.1821 0.0124
NP_442039.1_4 Reverse -186 -193 6.13563 0.297
NP_440825.1_6 Reverse -371 -390 9.93088 0.285
NP_442837.1_3 Forward -112 -105 15.7721 0.0124
NP_442837.1_3 Reverse -105 -112 15.7721 0.0124
NP_442837.1_3 Forward -307 -300 10.1672 0.0935
NP_442837.1_3 Reverse -389 -396 6.52896 0.2
NP_442837.1_3 Forward -295 -288 6.13563 0.25
NP_442837.1_3 Reverse -288 -295 5.93897 0.265
NP_440160.1_2 Reverse -160 -179 -1.27885 0.235
NP_442053.1_1 Forward -113 -104 18.3876 0.0007
NP_442053.1_1 Reverse -104 -113 18.3876 0.0007
NP_442053.1_1 Forward -296 -287 9.34117 0.0666
NP_442053.1_1 Reverse -287 -296 8.55452 0.0784
NP_442053.1_1 Forward -233 -224 5.21127 0.203
NP_442053.1_1 Forward -194 -185 3.83464 0.285
NP_440505.1_3 Forward -115 -105 15.418 0.0114
NP_440505.1_3 Reverse -102 -112 14.1397 0.0235
NP_440505.1_3 Forward -235 -225 7.05986 0.165
NP_440505.1_3 Forward -298 -288 6.8632 0.169
NP_440505.1_3 Reverse -285 -295 6.76487 0.169
NP_440505.1_7 Forward -174 -155 2.94938 0.222
NP_440505.1_7 Forward -237 -218 2.0644 0.237
NP_440505.1_7 Reverse -174 -193 -2.26216 0.289
NP_441203.1_1 Forward -295 -276 -14.5535 0.193
NP_442532.1_7 Forward -113 -99 6.19444 0.171
NP_440914.1_1 Reverse -104 -114 16.3248 0.00196
NP_440914.1_1 Forward -296 -286 14.7634 0.00997
NP_440914.1_1 Reverse -224 -234 14.5682 0.0112
NP_440914.1_1 Forward -113 -103 8.6151 0.186
NP_440914.1_1 Reverse -287 -297 7.83437 0.219
NP_441011.1_8 Forward -112 -103 16.9127 0.00602
NP_441011.1_8 Reverse -105 -114 16.6177 0.00602
NP_441011.1_8 Reverse -225 -234 9.53783 0.123
NP_441011.1_8 Forward -295 -286 6.8829 0.18
NP_442533.1_6 Forward -113 -104 17.2076 0.00137
NP_442533.1_6 Reverse -104 -113 17.2076 0.00137
NP_442533.1_6 Reverse -224 -233 15.536 0.00533
NP_442533.1_6 Forward -233 -224 7.76787 0.0883
NP_442533.1_6 Forward -296 -287 7.66954 0.0897
NP_442533.1_6 Reverse -287 -296 7.37455 0.0898
NP_442533.1_6 Forward -382 -373 7.17789 0.0948
NP_442533.1_6 Forward -238 -229 4.52295 0.179
NP_442232.1_3 Forward -121 -102 12.3892 0.052
NP_442232.1_3 Forward -241 -222 -7.57203 0.204
NP_442229.1_1 Forward -115 -101 8.94708 0.184
NP_441482.1_7 Forward -119 -105 -10.5218 0.209
NP_439944.1_9 Reverse -105 -115 17.7779 0.00341
NP_439944.1_9 Reverse -288 -298 17.188 0.00584
NP_439944.1_9 Forward -112 -102 10.4031 0.0887
NP_441697.1_5 Reverse -22 -41 -7.49654 0.246
NP_441028.1_6 Reverse -66 -76 7.64939 0.218
NP_440116.1_8 Reverse -288 -307 -4.13045 0.163
NP_440115.1_6 Forward -116 -106 16.9913 0.0288
NP_440115.1_6 Reverse -284 -294 6.37155 0.186
NP_439965.1_1 Forward -242 -223 -3.54046 0.182
NP_441347.1_5 Forward -239 -225 14.4536 0.238
NP_441347.1_5 Forward -119 -105 8.06211 0.298
NP_442492.1_2 Reverse -373 -392 3.04771 0.224
NP_442492.1_2 Reverse -287 -306 -0.983855 0.288
NP_441972.1_3 Forward -84 -65 11.6025 0.284
NP_441972.1_5 Reverse -288 -307 6.4893 0.0825
NP_441972.1_5 Forward -295 -276 -10.0303 0.296
NP_441106.1_1 Forward -114 -105 18.486 0.0028
NP_441106.1_1 Reverse -103 -112 18.191 0.0028
NP_441106.1_1 Reverse -286 -295 8.65285 0.0522
NP_441106.1_1 Forward -297 -288 6.29291 0.0927
NP_441106.1_1 Reverse -223 -232 5.21127 0.167
NP_439903.1_6 Forward -299 -280 0.883656 0.256
NP_442306.1_10 Forward -118 -99 8.06259 0.0294
NP_441286.1_1 Reverse -286 -298 9.67541 0.0217
NP_441286.1_1 Forward -114 -102 5.34885 0.0259
NP_441286.1_1 Reverse -103 -115 5.15219 0.0259
NP_441286.1_1 Forward -297 -285 -3.79593 0.146
NP_440670.1_8 Forward -113 -104 18.3876 0.000699
NP_440670.1_8 Reverse -104 -113 18.3876 0.000699
NP_440670.1_8 Forward -296 -287 16.5193 0.00214
NP_440670.1_8 Reverse -287 -296 9.4395 0.0559
NP_441479.1_1 Reverse -101 -120 14.7491 0.126
NP_441930.1_2 Forward -356 -346 11.8781 0.271
NP_440886.1_7 Reverse -103 -113 17.7774 0.0011
NP_440886.1_7 Forward -114 -104 8.04271 0.0805
NP_440886.1_7 Reverse -223 -233 5.38779 0.185
NP_440886.1_7 Reverse -286 -296 4.10949 0.253
NP_440828.1_1 Forward -294 -275 3.83357 0.219
NP_442614.1_2 Reverse -104 -118 7.76774 0.265
NP_439995.1_5 Reverse -94 -113 9.3409 0.235
NP_442072.1_9 Reverse -286 -304 -11.3872 0.0789
NP_442072.1_9 Reverse -103 -121 -11.8789 0.0799
NP_442072.1_9 Forward -114 -96 -12.0756 0.0812
NP_440513.1_4 Reverse -104 -123 8.94757 0.295
NP_442401.1_2 Forward -290 -271 8.84842 0.226
NP_441808.1_8 Reverse -188 -207 9.83255 0.242
NP_440907.2_8 Reverse -105 -115 19.1541 0.00362
NP_440907.2_8 Forward -112 -102 17.4824 0.00685
NP_440907.2_8 Forward -295 -285 6.56775 0.161
NP_440907.2_8 Forward -232 -222 4.89613 0.235
NP_441021.1_1 Reverse -288 -307 -8.85033 0.201
NP_441463.1_3 Reverse -94 -113 6.09597 0.0675
NP_441463.1_3 Reverse -289 -308 -0.983855 0.135
NP_441463.1_3 Forward -306 -287 -1.96717 0.147
NP_441463.1_3 Forward -123 -104 -5.80207 0.232
NP_441463.1_6 Reverse -345 -359 6.99573 0.265
NP_442893.1_4 Reverse -27 -46 -2.26292 0.281
NP_442061.1_5 Forward -88 -70 17.0172 0.289
NP_441626.1_2 Forward -112 -105 15.7721 0.0124
NP_441626.1_2 Reverse -105 -112 15.7721 0.0124
NP_441626.1_2 Forward -295 -288 6.0373 0.212
NP_441626.1_2 Reverse -288 -295 6.0373 0.212
NP_440107.1_6 Forward -207 -188 18.3865 0.145
NP_442794.1_1 Forward -300 -288 2.20226 0.299
NP_442615.1_1 Forward -122 -104 14.8671 0.00922
NP_442615.1_1 Forward -305 -287 5.42735 0.0386
NP_442615.1_1 Reverse -95 -113 4.14905 0.0489
NP_442615.1_1 Forward -242 -224 -1.45582 0.128
NP_442615.1_1 Reverse -278 -296 -2.14413 0.139
NP_442615.1_1 Reverse -215 -233 -6.07737 0.233
NP_441962.1_4 Forward -118 -99 -10.0303 0.223
NP_441962.1_4 Forward -238 -219 -10.7186 0.232
NP_441962.1_4 Reverse -224 -243 -13.1769 0.271
NP_440387.1_1 Reverse -104 -120 8.22001 0.0282
NP_440387.1_1 Forward -113 -97 7.04003 0.0282
NP_440387.1_1 Forward -296 -280 -5.54633 0.238
NP_441431.1_2 Reverse -101 -115 15.0436 0.0537
NP_441431.1_2 Forward -116 -102 13.7653 0.0806
NP_441488.1_7 Reverse -367 -386 5.40766 0.157
NP_441488.1_7 Forward -119 -100 0.982764 0.296
NP_441836.1_1 Forward -124 -105 17.9277 0.0643
NP_441993.1_1 Reverse -98 -117 3.70092 0.23
NP_441174.1_2 Forward -116 -102 21.4357 0.00137
NP_441174.1_2 Forward -236 -222 16.6175 0.0675
NP_440358.1_8 Reverse -329 -348 1.17943 0.254
NP_440114.1_10 Forward -113 -99 17.2075 0.0116
NP_440114.1_10 Forward -296 -282 13.1759 0.0632
NP_440114.1_10 Forward -233 -219 8.35772 0.207
NP_440114.1_10 Reverse -104 -118 6.48943 0.269
NP_442437.1_8 Forward -307 -288 5.211 0.256
NP_440287.1_6 Forward -305 -286 1.0811 0.283
NP_440293.1_9 Reverse -224 -238 11.3443 0.257
NP_440293.1_10 Reverse -199 -218 -1.37718 0.271
NP_440766.1_4 Forward -117 -103 6.6861 0.0991
NP_441237.1_9 Reverse -288 -298 10.8948 0.214
NP_441237.1_9 Reverse -347 -357 9.81313 0.265
NP_440643.1_6 Forward -279 -260 1.76941 0.265
NP_441133.1_1 Reverse -194 -213 15.4374 0.2
NP_439910.1_2 Reverse -96 -113 -11.7609 0.0788
NP_442867.1_8 Reverse -357 -376 7.7676 0.242
NP_440457.1_1 Forward -117 -105 9.28209 0.0929
NP_440798.1_6 Reverse -105 -118 8.27909 0.125
NP_440798.1_6 Forward -295 -282 4.34585 0.145
NP_440798.1_6 Forward -112 -99 2.47756 0.17
NP_441332.1_6 Reverse -63 -73 14.7447 0.141
NP_441436.1_6 Forward -113 -94 6.29264 0.29
NP_440473.1_9 Reverse -213 -232 -11.8003 0.295
NP_442509.1_9 Forward -113 -103 16.2041 0.00739
NP_442509.1_9 Reverse -104 -114 8.04271 0.192
NP_442509.1_9 Forward -296 -286 7.94438 0.195
NP_440554.1_4 Reverse -105 -115 15.418 0.0199
NP_440554.1_4 Forward -112 -102 13.943 0.0218
NP_441885.1_5 Forward -113 -103 11.4848 0.00668
NP_441885.1_5 Reverse -287 -297 11.3864 0.00668
NP_441885.1_5 Reverse -104 -114 11.3864 0.00668
NP_441885.1_5 Forward -296 -286 1.65166 0.106
NP_441885.1_5 Reverse -224 -234 -0.609952 0.215
NP_441428.1_8 Reverse -96 -115 14.8474 0.0903
NP_442341.1_7 Forward -234 -220 7.9644 0.0956
NP_442341.1_7 Forward -114 -100 3.8345 0.21
NP_442341.1_7 Forward -357 -343 2.2612 0.263
NP_442341.1_7 Reverse -286 -300 2.16287 0.267
NP_442341.1_7 Reverse -103 -117 1.08123 0.299
NP_441756.1_5 Reverse -220 -239 -4.6221 0.295
NP_441756.1_7 Forward -118 -99 17.2074 0.133
NP_442395.2_4 Reverse -103 -122 6.09517 0.151
NP_442395.2_4 Reverse -223 -242 3.73524 0.197
NP_442534.1_7 Reverse -96 -115 12.0942 0.181
NP_440409.1_1 Reverse -279 -298 1.86774 0.18
NP_440423.1_6 Forward -73 -54 -12.0953 0.184
NP_443000.1_7 Forward -115 -105 10.7964 0.0345
NP_443000.1_7 Forward -310 -300 4.3066 0.203
NP_443000.1_7 Reverse -102 -112 2.04498 0.226
NP_443000.1_7 Forward -235 -225 0.963343 0.278
NP_443000.1_7 Reverse -285 -295 0.865012 0.285
NP_443000.1_7 Forward -298 -288 0.668351 0.293
NP_441842.1_3 Reverse -186 -204 16.4404 0.193
NP_441842.1_10 Forward -303 -289 9.43936 0.192
NP_441842.1_10 Reverse -97 -111 9.34103 0.192
NP_441842.1_10 Reverse -280 -294 7.17775 0.264
NP_440275.1_3 Forward -115 -105 18.6629 0.0082
NP_440275.1_3 Reverse -102 -112 17.9746 0.0082
NP_440275.1_3 Forward -298 -288 14.828 0.02
NP_440091.1_1 Reverse -100 -112 20.1968 0.00953
NP_440091.1_1 Forward -300 -288 8.88877 0.0567
NP_440091.1_1 Forward -117 -105 3.38223 0.163
NP_440679.1_10 Reverse -187 -206 -20.65 0.286
NP_440679.1_10 Reverse -193 -212 -20.7484 0.286
NP_443010.1_10 Reverse -101 -118 9.72843 0.133
NP_441359.1_8 Reverse -149 -168 13.6666 0.297
NP_442451.1_2 Reverse -279 -298 -7.86702 0.24
NP_439962.1_4 Reverse -63 -82 -7.57203 0.29
NP_441105.1_3 Forward -244 -225 0.392778 0.125
NP_441105.1_3 Reverse -93 -112 -10.0303 0.3
NP_441105.1_5 Reverse -342 -360 14.8663 0.258
NP_440216.1_1 Reverse -104 -118 6.6861 0.0139
NP_440216.1_1 Forward -113 -99 6.29277 0.0156
NP_440216.1_1 Forward -296 -282 -1.08205 0.0293
NP_440216.1_1 Reverse -224 -238 -3.147 0.0729
NP_440216.1_1 Reverse -287 -301 -9.73518 0.145
NP_440216.1_1 Forward -233 -219 -11.3085 0.178
NP_440216.1_9 Forward -272 -263 13.8644 0.184
NP_440216.1_9 Reverse -343 -352 7.76787 0.286
NP_440216.1_9 Forward -349 -340 5.3096 0.298
NP_440172.1_1 Reverse -104 -114 17.5813 0.00421
NP_440172.1_1 Forward -113 -103 8.73149 0.0586
NP_440172.1_1 Forward -296 -286 8.04317 0.0692
NP_440172.1_1 Reverse -224 -234 5.5849 0.14
NP_440172.1_1 Reverse -287 -297 5.19158 0.149
NP_442015.1_10 Reverse -283 -296 -0.0790467 0.25
NP_441226.1_7 Forward -112 -105 14.4934 0.0123
NP_441226.1_7 Reverse -105 -112 14.4934 0.0123
NP_442222.1_3 Reverse -277 -296 17.0107 0.198
NP_441111.1_7 Forward -112 -104 18.7023 0.00294
NP_441111.1_7 Reverse -105 -113 18.7023 0.00294
NP_441111.1_7 Forward -295 -287 8.96754 0.0463
NP_441111.1_7 Reverse -288 -296 8.86921 0.0589
NP_442379.1_10 Reverse -97 -114 4.85706 0.14
NP_442379.1_10 Forward -120 -103 2.59545 0.213
NP_442379.1_10 Forward -303 -286 -3.99273 0.277
NP_441766.1_2 Forward -113 -104 17.5026 0.00297
NP_441766.1_2 Reverse -104 -113 17.5026 0.00297
NP_441766.1_2 Forward -296 -287 7.86621 0.0703
NP_441766.1_2 Reverse -287 -296 7.66954 0.0723
NP_442252.1_3 Forward -88 -70 13.4905 0.109
NP_442252.1_3 Forward -372 -354 11.3272 0.18
NP_442252.1_3 Reverse -97 -115 10.2456 0.222
NP_440416.1_1 Forward -113 -94 -7.57203 0.213
NP_440416.1_9 Forward -303 -284 -15.3402 0.189
NP_440416.1_9 Forward -240 -221 -18.3884 0.256
NP_443052.1_8 Reverse -94 -113 20.1573 0.00342
NP_443052.1_8 Forward -306 -287 -6.58872 0.143
NP_443052.1_8 Forward -75 -56 -13.5702 0.29
NP_443052.1_9 Reverse -61 -80 -6.68705 0.287
NP_442154.1_1 Reverse -192 -210 -13.2555 0.217
NP_442226.1_8 Forward -243 -233 12.6647 0.285
NP_441430.1_6 Forward -366 -347 10.0292 0.282
NP_442564.1_9 Forward -238 -224 15.5717 0.227
NP_440261.1_5 Reverse -105 -118 6.31247 0.038
NP_440261.1_5 Forward -295 -282 -2.93064 0.0983
NP_440261.1_5 Forward -112 -99 -10.6005 0.201
NP_440261.1_5 Reverse -288 -301 -10.8955 0.221
NP_440261.1_5 Forward -232 -219 -11.1904 0.246
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTCGGGATCAACACACTGTCCATCCCCTCAAACGGGGTATTGGGCGCATTGCCATGGAAGTTTGTAAGCAAAACCCCAACACTGACATTAAAGTGATCCCAGTGACGATCGCCTACAGTGACCCCTACCCAGGCAAAGGCACTTCAGTGGAAATTAATTTTGGCCAGGGCATCGCCGCTAGGGACTACGACCCCAGCACCATCAAGGCTAGCTCCCAAAAACTGACCCGTTGTTTGGCCCATAGAATGCAGAACCTTTACAGTTCCGAGAATGTCTCTCTGTGCGAGGCGATCGCCGCTTCGTGAATTTCGTCAAAACGGCTAATGGGGGAAGGGGCCATCATGATAAGATTTACCGTAAATTAAGATTTTATTCTTTGTCAGTCAGGAAACTCAAATA

CDS

ATGGAAACAATTTATTTGCTCGCTAAATTGCCGGAAGCCTATCAGATTTTTGACCCCCTGGTGGATGTTCTGCCGGTCATTCCCCTCTTCTTTTTGGCTTTGGCCTTTGTGTGGCAAGCGGCGGTTGGTTTTAAATAA

Protein

METIYLLAKLPEAYQIFDPLVDVLPVIPLFFLALAFVWQAAVGFK