Your browser is old and dusty. Try Google Chrome!

Details for sml0003

ORF sml0003
Accession NP_440028.1
Symbol psbM
Category Photosystem II
Definition photosystem II reaction center M protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -230 -244 12.9793 0.0435
NP_441061.1_2 Forward -237 -223 -0.492064 0.231
NP_441061.1_2 Reverse -324 -338 -2.45868 0.293
NP_440557.1_1 Forward -52 -33 -0.0988766 0.265
NP_440795.1_7 Forward -237 -230 14.6904 0.0123
NP_440795.1_7 Reverse -230 -237 14.6904 0.0123
NP_440795.1_7 Forward -337 -330 8.8889 0.188
NP_441418.1_6 Forward -338 -319 -20.3551 0.111
NP_441418.1_6 Forward -238 -219 -20.945 0.133
NP_441418.1_6 Reverse -229 -248 -29.7948 0.238
NP_442291.1_5 Forward -239 -223 2.71347 0.121
NP_442291.1_5 Reverse -228 -244 -3.8747 0.257
NP_441343.1_7 Forward -280 -261 10.4225 0.113
NP_441453.1_1 Reverse -322 -340 14.9646 0.0938
NP_441453.1_4 Reverse -229 -237 16.539 0.00633
NP_441453.1_4 Forward -238 -230 16.539 0.00633
NP_441453.1_4 Forward -83 -75 4.24765 0.259
NP_441623.1_1 Forward -75 -57 -4.70074 0.275
NP_442151.1_1 Forward -293 -274 8.06259 0.27
NP_442151.1_6 Reverse -229 -243 18.1908 0.00782
NP_442151.1_6 Reverse -60 -74 10.4227 0.123
NP_442151.1_6 Forward -238 -224 6.98109 0.214
NP_442151.1_6 Forward -83 -69 5.60446 0.27
NP_441818.1_1 Reverse -230 -241 16.0861 0.0221
NP_441818.1_1 Forward -237 -226 9.30127 0.246
NP_441818.1_9 Forward -199 -180 -4.81876 0.244
NP_441818.1_9 Reverse -365 -384 -7.86702 0.274
NP_440226.1_1 Forward -238 -219 12.4875 0.0444
NP_442169.1_1 Forward -216 -197 1.67108 0.261
NP_442173.1_1 Forward -237 -229 15.4574 0.00633
NP_442173.1_1 Reverse -230 -238 15.4574 0.00633
NP_442752.1_4 Forward -238 -231 13.8055 0.0199
NP_442752.1_4 Reverse -229 -236 13.8055 0.0199
NP_443027.1_4 Reverse -227 -237 14.828 0.0437
NP_443027.1_4 Forward -240 -230 13.1564 0.0521
NP_441812.1_3 Forward -239 -225 16.2242 0.0755
NP_442975.1_10 Reverse -225 -239 13.077 0.0459
NP_442975.1_10 Forward -242 -228 4.03056 0.249
NP_440784.1_7 Forward -237 -230 15.9687 0.0123
NP_440784.1_7 Reverse -230 -237 15.9687 0.0123
NP_442909.1_7 Reverse -230 -244 13.8636 0.12
NP_442909.1_7 Forward -237 -223 5.99717 0.258
NP_440061.1_9 Reverse -227 -241 11.012 0.117
NP_440061.1_9 Forward -85 -71 7.86545 0.189
NP_440061.1_9 Forward -391 -377 5.21053 0.293
NP_440110.1_8 Forward -240 -221 -0.688862 0.228
NP_441054.1_4 Reverse -219 -237 2.67408 0.169
NP_440631.1_9 Reverse -337 -356 10.3196 0.286
NP_440878.1_9 Forward -93 -74 0.196116 0.196
NP_442062.1_8 Forward -238 -228 19.4496 0.000558
NP_442062.1_8 Reverse -229 -239 17.3846 0.00193
NP_442062.1_8 Forward -83 -73 10.2065 0.0504
NP_442974.1_1 Forward -103 -84 9.34008 0.242
NP_440304.1_4 Reverse -72 -82 14.0414 0.051
NP_440304.1_4 Reverse -227 -237 10.8948 0.051
NP_440304.1_4 Forward -240 -230 9.91146 0.051
NP_440304.1_4 Forward -391 -381 4.0116 0.281
NP_442242.1_4 Forward -237 -230 14.3954 0.0124
NP_442242.1_4 Reverse -230 -237 14.3954 0.0124
NP_440044.1_8 Reverse -230 -249 12.6841 0.0411
NP_440765.1_3 Forward -287 -268 11.1109 0.268
NP_442602.1_3 Forward -378 -359 -1.57384 0.245
NP_441208.1_9 Forward -241 -227 11.5043 0.15
NP_441594.1_6 Forward -247 -228 6.68596 0.187
NP_441594.1_6 Reverse -210 -229 -0.000545616 0.294
NP_442196.1_1 Forward -341 -322 20.944 0.0786
NP_440370.1_10 Forward -247 -228 9.53756 0.227
NP_442276.1_2 Forward -81 -62 4.22769 0.299
NP_440132.1_1 Forward -340 -322 19.7837 0.027
NP_442110.1_7 Reverse -229 -243 17.2075 0.0249
NP_442110.1_7 Forward -238 -224 1.67122 0.222
NP_441925.1_4 Reverse -189 -208 -9.04772 0.213
NP_441925.1_4 Reverse -190 -209 -14.2592 0.261
NP_441925.1_4 Reverse -256 -275 -17.0125 0.287
NP_440856.1_4 Forward -97 -78 -3.73712 0.238
NP_441083.1_5 Reverse -229 -239 20.3345 0.00053
NP_441083.1_5 Forward -238 -228 11.3864 0.0159
NP_442827.1_8 Reverse -221 -240 13.175 0.0415
NP_442827.1_8 Forward -246 -227 3.53858 0.144
NP_441434.1_7 Forward -236 -222 2.16287 0.288
NP_441738.1_2 Forward -236 -229 15.28 0.0102
NP_441738.1_2 Reverse -231 -238 15.28 0.0102
NP_441738.1_4 Forward -248 -229 6.78429 0.203
NP_441558.1_5 Reverse -227 -246 14.6508 0.0482
NP_441558.1_5 Reverse -72 -91 9.0459 0.132
NP_441558.1_5 Forward -240 -221 4.71934 0.271
NP_440209.1_1 Reverse -229 -237 18.1123 0.00295
NP_440209.1_1 Forward -238 -230 18.1123 0.00295
NP_442889.1_1 Forward -344 -325 -3.63879 0.146
NP_442889.1_8 Reverse -226 -240 4.52221 0.263
NP_441713.1_1 Forward -244 -225 -7.67036 0.135
NP_440178.1_7 Reverse -228 -247 -3.93378 0.0516
NP_440178.1_7 Forward -239 -220 -4.32711 0.0548
NP_442706.1_5 Forward -359 -340 13.0554 0.262
NP_442570.1_3 Forward -341 -322 -0.000545616 0.208
NP_441025.1_5 Reverse -236 -250 18.4858 0.179
NP_441792.1_1 Reverse -105 -124 4.62101 0.286
NP_441716.1_1 Forward -69 -55 7.27608 0.173
NP_441716.1_1 Reverse -60 -74 4.91614 0.246
NP_441716.1_1 Reverse -229 -243 3.73617 0.259
NP_442111.1_4 Forward -239 -225 8.06273 0.081
NP_441163.1_1 Reverse -221 -238 11.6411 0.183
NP_441163.1_4 Forward -80 -61 13.2109 0.278
NP_440906.1_5 Forward -237 -230 15.8704 0.0124
NP_440906.1_5 Reverse -230 -237 15.8704 0.0124
NP_440747.1_10 Forward -241 -229 7.51213 0.00286
NP_440747.1_10 Reverse -226 -238 -2.02597 0.0196
NP_440747.1_10 Forward -341 -329 -2.71429 0.0639
NP_441130.1_10 Reverse -227 -241 19.4691 0.0108
NP_441130.1_10 Forward -240 -226 8.75105 0.133
NP_441486.1_1 Reverse -226 -240 13.0776 0.00946
NP_441486.1_1 Forward -241 -227 11.406 0.0164
NP_442850.1_6 Forward -338 -319 18.6823 0.177
NP_440944.1_2 Reverse -217 -236 -2.85214 0.28
NP_442634.1_4 Forward -340 -326 4.22782 0.0819
NP_442634.1_4 Forward -240 -226 -3.63866 0.161
NP_442634.1_4 Reverse -378 -392 -6.09693 0.299
NP_440403.1_4 Forward -247 -228 -8.752 0.26
NP_440842.1_10 Forward -78 -64 4.12949 0.254
NP_440842.1_10 Reverse -65 -79 3.93283 0.254
NP_441014.1_5 Reverse -76 -94 13.6872 0.204
NP_441014.1_8 Forward -82 -63 -1.57384 0.224
NP_441014.1_8 Reverse -216 -235 -8.35868 0.283
NP_441014.1_10 Reverse -228 -247 -1.57461 0.262
NP_441014.1_10 Forward -239 -220 -3.14789 0.294
NP_442848.1_1 Forward -244 -230 24.0907 0.00195
NP_442848.1_1 Reverse -223 -237 -1.18038 0.263
NP_442848.1_4 Reverse -64 -78 8.84938 0.282
NP_442848.1_5 Reverse -278 -296 -1.75081 0.276
NP_441012.1_4 Forward -73 -60 13.4906 0.214
NP_441012.1_4 Reverse -147 -160 6.80412 0.276
NP_443018.1_3 Forward -237 -230 14.8871 0.0123
NP_443018.1_3 Reverse -230 -237 14.8871 0.0123
NP_443018.1_3 Forward -82 -75 10.7572 0.0907
NP_443018.1_3 Reverse -330 -337 4.56234 0.241
NP_443018.1_3 Reverse -75 -82 4.56234 0.241
NP_443018.1_3 Forward -337 -330 4.46401 0.244
NP_441316.1_7 Reverse -227 -242 -3.26502 0.273
NP_441634.1_8 Forward -240 -226 5.89945 0.114
NP_441634.1_8 Reverse -143 -157 2.75286 0.163
NP_441634.1_8 Reverse -227 -241 2.45787 0.167
NP_441634.1_8 Forward -340 -326 -2.16369 0.295
NP_440376.1_1 Forward -238 -229 19.4693 0.000692
NP_440376.1_1 Reverse -229 -238 19.4693 0.000692
NP_440376.1_1 Forward -389 -380 4.91628 0.147
NP_440376.1_1 Forward -288 -279 4.32629 0.163
NP_441588.1_4 Reverse -231 -241 8.63316 0.14
NP_442687.1_7 Reverse -228 -238 15.8113 0.0125
NP_442687.1_7 Forward -239 -229 8.92815 0.0994
NP_442687.1_7 Reverse -73 -83 8.1415 0.113
NP_442687.1_7 Reverse -59 -69 6.46988 0.165
NP_442485.1_3 Forward -392 -373 -3.73712 0.277
NP_441846.1_10 Forward -215 -196 -5.60541 0.19
NP_441846.1_10 Forward -217 -198 -13.3736 0.204
NP_441846.1_10 Forward -216 -197 -22.125 0.257
NP_442958.1_3 Reverse -218 -237 7.07928 0.17
NP_442958.1_3 Forward -249 -230 -0.983855 0.268
NP_442530.1_2 Forward -107 -97 12.6647 0.276
NP_441422.1_7 Reverse -227 -244 9.18362 0.0919
NP_441950.1_7 Reverse -373 -392 -8.35868 0.287
NP_442296.1_9 Reverse -87 -106 -3.3438 0.249
NP_442296.1_9 Reverse -75 -94 -4.13045 0.266
NP_441763.1_10 Reverse -218 -237 14.9449 0.118
NP_442658.1_1 Reverse -227 -237 15.9091 0.00966
NP_442658.1_1 Reverse -72 -82 15.2208 0.0156
NP_442658.1_1 Forward -240 -230 9.616 0.147
NP_442658.1_1 Forward -120 -110 4.99446 0.288
NP_442782.1_2 Forward -293 -279 8.35772 0.198
NP_442782.1_2 Forward -106 -92 7.37441 0.202
NP_442782.1_2 Forward -294 -280 6.48943 0.223
NP_442782.1_2 Forward -208 -194 5.50613 0.242
NP_442782.1_2 Reverse -279 -293 2.06454 0.278
NP_442205.1_9 Reverse -223 -239 2.8118 0.203
NP_441414.1_9 Forward -238 -219 -0.885524 0.0949
NP_441487.1_9 Forward -390 -371 -3.04881 0.298
NP_442937.1_2 Forward -68 -49 11.7983 0.293
NP_442937.1_5 Forward -243 -224 17.8957 0.0288
NP_441958.1_5 Forward -239 -229 12.2714 0.00183
NP_441958.1_5 Reverse -228 -238 12.2714 0.00183
NP_441958.1_5 Reverse -73 -83 -0.216628 0.186
NP_442836.1_5 Forward -244 -225 4.03102 0.22
NP_440203.1_5 Reverse -63 -73 8.43603 0.299
NP_439905.1_1 Forward -237 -224 13.0973 0.178
NP_439905.1_1 Forward -82 -69 7.09911 0.268
NP_440984.1_7 Reverse -224 -238 13.8643 0.0968
NP_439990.1_5 Forward -243 -230 11.819 0.126
NP_439990.1_5 Reverse -324 -337 5.32916 0.298
NP_442911.1_2 Forward -248 -229 7.07928 0.0267
NP_442911.1_2 Reverse -219 -238 -6.09707 0.175
NP_441580.1_6 Reverse -218 -237 1.17943 0.12
NP_441580.1_6 Forward -249 -230 -8.752 0.271
NP_440153.1_5 Forward -237 -223 11.996 0.0699
NP_440153.1_5 Reverse -230 -244 1.67122 0.245
NP_440153.1_8 Forward -83 -70 2.96921 0.21
NP_441591.1_10 Forward -240 -221 10.9142 0.185
NP_443055.1_6 Forward -83 -65 4.34495 0.182
NP_443055.1_6 Forward -246 -228 -1.45654 0.279
NP_442236.1_7 Reverse -366 -385 8.94757 0.253
NP_441099.1_5 Forward -248 -229 7.07928 0.0429
NP_442002.1_9 Reverse -228 -235 10.7572 0.185
NP_442002.1_9 Reverse -261 -268 10.3639 0.231
NP_441294.1_7 Reverse -225 -239 9.34661 0.249
NP_441646.1_1 Forward -245 -226 2.0644 0.221
NP_442438.1_10 Forward -243 -229 16.7159 0.0212
NP_442438.1_10 Reverse -224 -238 11.701 0.0448
NP_441000.1_6 Forward -239 -225 -4.13031 0.227
NP_441000.1_6 Reverse -228 -242 -4.91696 0.254
NP_442771.1_1 Reverse -58 -76 -6.86402 0.169
NP_442771.1_1 Forward -199 -181 -8.63398 0.2
NP_440147.1_4 Reverse -227 -240 12.8023 0.0326
NP_440147.1_4 Forward -85 -72 8.18076 0.0546
NP_440147.1_4 Forward -240 -227 0.805932 0.244
NP_441550.1_8 Forward -240 -230 16.7941 0.00906
NP_441550.1_8 Reverse -227 -237 6.0761 0.214
NP_441916.1_7 Forward -238 -228 18.4663 0.00144
NP_441916.1_7 Reverse -229 -239 10.3048 0.0261
NP_441916.1_7 Reverse -74 -84 3.91327 0.198
NP_441041.1_4 Reverse -229 -248 -2.85214 0.117
NP_441041.1_4 Forward -238 -219 -11.1119 0.241
NP_441041.1_7 Forward -241 -229 12.4708 0.0611
NP_441041.1_7 Reverse -377 -389 7.22324 0.171
NP_442396.1_5 Forward -99 -86 10.934 0.106
NP_442396.1_5 Reverse -225 -238 6.90245 0.215
NP_442004.1_6 Reverse -229 -243 9.14437 0.14
NP_442004.1_6 Forward -238 -224 1.96621 0.276
NP_440703.1_9 Forward -68 -55 8.67183 0.226
NP_441725.1_5 Forward -82 -72 14.6313 0.0247
NP_441725.1_5 Forward -237 -227 11.2881 0.0247
NP_441725.1_5 Reverse -230 -240 9.02648 0.0553
NP_441725.1_5 Reverse -61 -71 -0.609952 0.265
NP_439966.1_4 Forward -211 -192 5.30933 0.293
NP_439966.1_7 Reverse -227 -237 18.4657 0.00473
NP_439966.1_7 Forward -240 -230 14.8275 0.0177
NP_439966.1_9 Reverse -227 -236 0.983037 0.253
NP_439966.1_9 Forward -240 -231 0.884706 0.253
NP_440202.1_8 Reverse -286 -305 10.0008 0.297
NP_442941.1_3 Forward -237 -227 11.4848 0.0116
NP_442941.1_3 Reverse -230 -240 10.9931 0.0116
NP_442941.1_3 Reverse -330 -340 -0.314959 0.256
NP_440289.1_2 Reverse -226 -239 11.9173 0.0171
NP_440289.1_2 Forward -241 -228 4.93583 0.0636
NP_442281.1_1 Forward -243 -229 13.5686 0.0256
NP_442281.1_1 Reverse -224 -238 10.5204 0.0576
NP_442281.1_1 Forward -74 -60 5.70218 0.15
NP_441079.1_1 Reverse -279 -298 16.2241 0.211
NP_442847.1_3 Reverse -104 -123 5.80018 0.24
NP_442256.1_2 Forward -240 -222 -7.65067 0.214
NP_001035871.2_7 Forward -73 -63 12.0747 0.272
NP_440437.1_1 Reverse -223 -242 -0.590531 0.183
NP_440437.1_1 Forward -244 -225 -4.72043 0.266
NP_442012.1_1 Forward -395 -376 11.5042 0.0742
NP_440498.1_1 Reverse -220 -238 20.0787 0.0181
NP_442982.1_5 Forward -79 -60 15.9291 0.0748
NP_443030.1_4 Forward -395 -376 -6.39206 0.288
NP_441644.1_6 Reverse -229 -239 17.3841 0.00127
NP_441644.1_6 Forward -238 -228 10.1076 0.0628
NP_441644.1_6 Forward -69 -59 9.02601 0.0872
NP_441644.1_6 Forward -83 -73 7.64939 0.121
NP_441644.1_6 Forward -338 -328 5.48612 0.188
NP_441644.1_6 Reverse -292 -302 4.7978 0.224
NP_442215.1_2 Reverse -58 -74 7.04003 0.0699
NP_442215.1_2 Forward -240 -224 2.12349 0.122
NP_442215.1_2 Forward -85 -69 -0.236458 0.164
NP_442215.1_2 Reverse -227 -243 -1.61309 0.186
NP_441810.1_9 Forward -245 -226 0.392778 0.292
NP_442029.1_1 Reverse -48 -67 -9.34199 0.192
NP_442029.1_1 Forward -156 -137 -11.8003 0.233
NP_442029.1_6 Forward -243 -224 5.40766 0.25
NP_442247.1_8 Forward -371 -357 7.86607 0.292
NP_440253.1_2 Reverse -229 -247 11.8189 0.0302
NP_440929.1_8 Forward -238 -229 19.2726 0.000701
NP_440929.1_8 Reverse -229 -238 19.2726 0.000701
NP_442933.1_10 Forward -238 -229 17.601 0.00325
NP_442933.1_10 Reverse -229 -238 17.601 0.00325
NP_442933.1_10 Reverse -74 -83 4.52295 0.24
NP_441751.2_8 Reverse -230 -244 2.85119 0.0759
NP_442554.1_8 Reverse -230 -240 18.0729 0.00543
NP_442554.1_8 Forward -237 -227 13.8447 0.0145
NP_442554.1_8 Forward -82 -72 6.66654 0.111
NP_442554.1_8 Reverse -330 -340 5.97822 0.13
NP_442554.1_8 Forward -337 -327 5.48657 0.146
NP_442554.1_8 Reverse -61 -71 3.12662 0.239
NP_442554.1_8 Forward -68 -58 2.33998 0.274
NP_442863.1_3 Reverse -366 -384 16.0471 0.172
NP_441762.1_7 Reverse -228 -240 11.8387 0.0142
NP_441762.1_7 Forward -239 -227 2.89058 0.0676
NP_441762.1_7 Forward -84 -72 -6.15587 0.276
NP_441762.1_7 Forward -119 -107 -7.53251 0.293
NP_442142.1_4 Forward -241 -228 14.7683 0.0302
NP_442142.1_4 Reverse -226 -239 7.98351 0.125
NP_442142.1_4 Forward -72 -59 2.96866 0.269
NP_442142.1_4 Forward -62 -49 2.47701 0.29
NP_442292.1_1 Reverse -230 -239 18.486 0.00229
NP_442292.1_1 Forward -237 -228 9.63616 0.0183
NP_442292.1_1 Reverse -330 -339 5.80125 0.129
NP_442292.1_5 Forward -242 -223 -1.27885 0.261
NP_442476.1_6 Forward -237 -223 13.7659 0.0401
NP_442476.1_6 Reverse -230 -244 1.96621 0.199
NP_443009.1_5 Forward -239 -228 18.3477 0.00265
NP_443009.1_5 Reverse -73 -84 8.90795 0.0965
NP_443009.1_5 Forward -390 -379 4.67974 0.234
NP_442408.2_1 Forward -238 -219 1.17943 0.193
NP_441371.1_3 Forward -296 -278 5.82068 0.283
NP_441715.1_4 Forward -237 -227 16.303 0.0117
NP_441715.1_4 Reverse -230 -240 7.84651 0.107
NP_441448.1_1 Reverse -350 -369 6.4893 0.249
NP_441448.1_2 Forward -73 -54 -1.27961 0.273
NP_441198.1_8 Reverse -72 -82 13.2713 0.108
NP_441198.1_8 Reverse -327 -337 10.2438 0.289
NP_440379.1_5 Reverse -77 -96 -9.73531 0.264
NP_441468.1_1 Forward -237 -230 15.8704 0.0124
NP_441468.1_1 Reverse -230 -237 15.8704 0.0124
NP_441468.1_1 Reverse -87 -94 6.72562 0.126
NP_441468.1_1 Reverse -75 -82 4.07068 0.263
NP_441468.1_1 Forward -337 -330 3.97235 0.277
NP_441020.2_6 Reverse -378 -395 10.3636 0.146
NP_441020.2_6 Forward -240 -223 8.20031 0.205
NP_441020.2_6 Reverse -227 -244 8.20031 0.205
NP_441015.1_10 Forward -243 -224 5.211 0.115
NP_441015.1_10 Forward -123 -104 -8.85033 0.277
NP_441015.1_10 Reverse -69 -88 -9.047 0.278
NP_441015.1_10 Reverse -61 -80 -11.3086 0.294
NP_441673.1_1 Forward -238 -229 20.8459 0.000698
NP_441673.1_1 Reverse -229 -238 20.8459 0.000698
NP_441673.1_1 Reverse -279 -288 -8.06341 0.254
NP_441826.1_2 Forward -244 -230 13.9626 0.0213
NP_441826.1_2 Reverse -223 -237 10.1277 0.051
NP_441826.1_2 Reverse -229 -243 -0.295402 0.208
NP_441826.1_2 Forward -75 -61 -4.7203 0.299
NP_441330.1_1 Reverse -69 -88 -13.9635 0.209
NP_442868.1_6 Forward -240 -230 17.4829 0.012
NP_442868.1_6 Reverse -72 -82 3.81494 0.192
NP_442868.1_6 Reverse -227 -237 0.963343 0.205
NP_442868.1_6 Forward -340 -330 -0.118297 0.264
NP_441056.1_1 Reverse -229 -248 -5.60541 0.262
NP_441612.1_2 Reverse -229 -239 8.54929 0.21
NP_442559.1_3 Reverse -177 -196 16.5191 0.133
NP_442808.1_1 Reverse -228 -238 18.4657 0.00201
NP_442808.1_1 Forward -239 -229 8.63269 0.0481
NP_442808.1_1 Reverse -198 -208 1.65123 0.282
NP_441849.1_2 Forward -357 -338 -0.334645 0.291
NP_440145.1_3 Forward -248 -229 8.25926 0.0456
NP_442542.1_2 Forward -240 -227 4.54251 0.3
NP_442542.1_9 Reverse -222 -236 8.65209 0.152
NP_442050.1_5 Forward -240 -230 15.6142 0.01
NP_442050.1_5 Reverse -227 -237 9.12434 0.193
NP_440342.1_1 Forward -212 -193 11.8975 0.274
NP_441114.1_3 Forward -81 -72 7.57121 0.231
NP_440558.1_2 Reverse -326 -345 -4.72043 0.248
NP_442789.1_4 Reverse -378 -397 -0.885524 0.209
NP_441518.1_3 Forward -248 -229 -14.8485 0.283
NP_441878.1_6 Forward -70 -60 10.5014 0.0176
NP_441878.1_6 Forward -239 -229 10.4031 0.0176
NP_441878.1_6 Reverse -228 -238 10.4031 0.0176
NP_441878.1_6 Reverse -59 -69 10.4031 0.0176
NP_441878.1_6 Reverse -73 -83 2.24165 0.0462
NP_441878.1_6 Reverse -379 -389 -6.70647 0.194
NP_441878.1_6 Forward -339 -329 -7.59145 0.245
NP_441036.1_8 Reverse -228 -238 17.7779 0.000554
NP_441036.1_8 Forward -239 -229 8.33817 0.174
NP_442650.1_2 Reverse -229 -243 7.07942 0.13
NP_441557.1_5 Forward -238 -229 19.9609 0.000699
NP_441557.1_5 Reverse -229 -238 19.9609 0.000699
NP_441557.1_5 Reverse -74 -83 -0.786921 0.239
NP_441557.1_8 Reverse -286 -296 12.9592 0.23
NP_441445.1_1 Reverse -51 -70 12.4875 0.068
NP_442066.2_9 Forward -242 -229 8.08242 0.193
NP_441433.1_8 Reverse -236 -255 -1.27885 0.258
NP_441433.1_8 Forward -286 -267 -1.27885 0.258
NP_441433.1_8 Reverse -61 -80 -2.36049 0.268
NP_442419.1_2 Forward -243 -224 -0.787193 0.246
NP_441308.1_8 Reverse -227 -237 10.1081 0.22
NP_440101.1_3 Reverse -224 -243 9.63589 0.133
NP_440101.1_5 Reverse -222 -241 3.93269 0.196
NP_441564.1_10 Reverse -78 -97 15.1424 0.0845
NP_442183.1_1 Reverse -229 -243 15.5359 0.0202
NP_442183.1_1 Forward -238 -224 11.406 0.0702
NP_442183.1_1 Reverse -380 -394 5.01447 0.234
NP_440190.1_5 Reverse -348 -366 15.4571 0.254
NP_441116.1_9 Reverse -358 -372 13.1759 0.239
NP_441574.1_1 Forward -95 -76 -4.52377 0.252
NP_441574.1_1 Forward -294 -275 -5.40875 0.26
NP_441549.1_9 Reverse -225 -243 -6.66736 0.203
NP_441549.1_9 Forward -242 -224 -7.84733 0.214
NP_442347.1_2 Reverse -230 -239 12.4878 0.056
NP_442347.1_2 Forward -237 -228 11.1111 0.056
NP_442645.1_2 Forward -246 -227 -1.67217 0.0487
NP_442888.1_9 Reverse -229 -248 13.4708 0.257
NP_441037.1_4 Forward -120 -110 9.75413 0.21
NP_441037.1_4 Forward -240 -230 9.55921 0.21
NP_441037.1_4 Reverse -72 -82 7.9999 0.237
NP_441037.1_4 Reverse -227 -237 7.02532 0.237
NP_442594.1_8 Forward -149 -130 7.37428 0.213
NP_441633.1_3 Reverse -227 -240 6.01747 0.0481
NP_441633.1_3 Forward -240 -227 1.29759 0.109
NP_441633.1_3 Forward -85 -72 -3.71729 0.177
NP_440136.1_2 Forward -237 -230 15.9687 0.0123
NP_440136.1_2 Reverse -230 -237 15.9687 0.0123
NP_442590.1_10 Reverse -223 -242 17.109 0.113
NP_442590.1_10 Reverse -53 -72 9.83255 0.19
NP_442590.1_10 Forward -238 -219 7.07928 0.232
NP_442998.1_10 Forward -236 -229 15.5754 0.0102
NP_442998.1_10 Reverse -231 -238 15.5754 0.0102
NP_440899.1_8 Reverse -112 -131 -8.16202 0.254
NP_440299.1_1 Forward -242 -229 13.5883 0.0298
NP_440299.1_1 Reverse -225 -238 8.08184 0.098
NP_440299.1_1 Reverse -325 -338 7.09854 0.121
NP_440299.1_1 Forward -87 -74 6.21356 0.149
NP_441799.1_1 Reverse -225 -239 14.7486 0.0222
NP_441799.1_1 Forward -242 -228 6.29216 0.176
NP_441799.1_9 Forward -239 -220 -0.295539 0.213
NP_441007.1_10 Forward -243 -230 12.409 0.0499
NP_441007.1_10 Reverse -224 -237 1.9859 0.202
NP_442333.2_5 Reverse -218 -237 -13.1769 0.251
NP_440256.1_1 Forward -241 -222 2.55606 0.0625
NP_440256.1_1 Forward -336 -317 -7.37537 0.234
NP_441559.1_8 Reverse -224 -238 -7.08024 0.283
NP_440915.1_6 Forward -242 -228 14.0609 0.0187
NP_440915.1_6 Forward -298 -284 -0.0987402 0.182
NP_440915.1_6 Reverse -82 -96 -1.77037 0.246
NP_441296.1_7 Reverse -62 -81 13.6675 0.267
NP_442866.1_1 Forward -88 -69 -8.94866 0.285
NP_441464.1_8 Forward -389 -375 6.78443 0.226
NP_441464.1_8 Forward -69 -55 5.70279 0.253
NP_440026.1_4 Reverse -57 -76 9.93088 0.24
NP_442453.1_6 Forward -379 -365 16.8516 0.176
NP_441939.1_3 Reverse -230 -249 11.0125 0.118
NP_442993.1_1 Forward -238 -222 0.353528 0.0642
NP_442993.1_1 Forward -294 -278 -10.6595 0.224
NP_440677.1_1 Forward -398 -379 5.80098 0.29
NP_442386.1_9 Reverse -228 -237 15.7322 0.0144
NP_442386.1_9 Forward -239 -230 13.8639 0.0289
NP_442386.1_9 Forward -295 -286 10.029 0.142
NP_442386.1_9 Reverse -323 -332 5.80084 0.237
NP_442386.1_9 Forward -84 -75 5.70251 0.241
NP_440570.1_4 Reverse -59 -77 2.28076 0.238
NP_441340.1_5 Forward -237 -230 15.6737 0.0124
NP_441340.1_5 Reverse -230 -237 15.6737 0.0124
NP_441340.1_5 Reverse -330 -337 11.0522 0.0749
NP_441340.1_5 Forward -82 -75 3.97235 0.274
NP_441271.1_8 Forward -379 -369 14.7297 0.266
NP_441947.1_10 Reverse -227 -245 -1.25915 0.3
NP_442484.1_2 Forward -94 -75 -1.47551 0.292
NP_440168.1_4 Forward -79 -60 0.294447 0.22
NP_442240.1_2 Forward -237 -218 -6.78538 0.122
NP_440161.1_10 Forward -88 -69 13.5586 0.295
NP_440586.1_8 Forward -237 -230 13.2151 0.026
NP_440586.1_8 Reverse -230 -237 13.2151 0.026
NP_442251.1_6 Forward -237 -230 15.2804 0.0124
NP_442251.1_6 Reverse -230 -237 15.2804 0.0124
NP_441262.1_3 Reverse -229 -236 14.7888 0.0223
NP_441262.1_3 Forward -238 -231 14.7888 0.0223
NP_440027.1_3 Reverse -219 -237 16.7346 0.0899
NP_440027.1_3 Forward -69 -51 4.93494 0.249
NP_443051.1_1 Reverse -228 -237 10.4228 0.00754
NP_443051.1_1 Forward -239 -230 10.4228 0.00754
NP_439937.1_9 Reverse -108 -125 -3.69841 0.157
NP_439937.1_9 Forward -70 -53 -6.55 0.157
NP_440439.1_1 Reverse -226 -239 10.639 0.0362
NP_440439.1_1 Forward -392 -379 1.78924 0.143
NP_440439.1_1 Forward -241 -228 1.39592 0.156
NP_439943.1_7 Reverse -230 -249 2.55606 0.292
NP_440372.1_2 Forward -237 -230 16.3621 0.0124
NP_440372.1_2 Reverse -230 -237 16.3621 0.0124
NP_440574.1_3 Reverse -224 -243 1.67108 0.179
NP_441789.1_7 Reverse -198 -217 -1.67294 0.253
NP_440316.1_10 Forward -216 -206 10.5998 0.226
NP_440316.1_10 Reverse -65 -75 9.32148 0.235
NP_440316.1_10 Reverse -73 -83 6.8632 0.251
NP_441803.1_2 Reverse -224 -243 15.3391 0.0392
NP_439977.1_5 Forward -244 -225 2.55606 0.171
NP_439977.1_5 Forward -89 -70 -1.86883 0.263
NP_440139.1_1 Reverse -223 -242 1.27698 0.266
NP_441572.1_7 Forward -75 -56 -0.590531 0.182
NP_442384.1_10 Forward -238 -225 15.4572 0.00986
NP_442384.1_10 Reverse -60 -73 6.31247 0.105
NP_442384.1_10 Forward -69 -56 4.73917 0.148
NP_442384.1_10 Reverse -250 -263 4.24752 0.163
NP_442384.1_10 Reverse -229 -242 3.95252 0.172
NP_442114.1_9 Reverse -78 -97 17.0107 0.169
NP_441877.1_7 Reverse -224 -243 4.71854 0.218
NP_441018.1_10 Reverse -202 -221 14.7483 0.236
NP_442262.1_10 Forward -237 -230 14.1988 0.0123
NP_442262.1_10 Reverse -230 -237 14.1988 0.0123
NP_442262.1_10 Forward -82 -75 9.87221 0.164
NP_442262.1_10 Reverse -330 -337 7.90559 0.266
NP_441689.1_5 Reverse -227 -237 8.53436 0.132
NP_441689.1_5 Forward -240 -230 5.87944 0.197
NP_440344.1_10 Forward -245 -228 0.530496 0.0353
NP_440282.1_3 Forward -88 -69 2.0644 0.274
NP_440531.1_6 Reverse -221 -240 3.83436 0.138
NP_440531.1_6 Forward -296 -277 -0.983855 0.226
NP_441060.1_3 Forward -211 -192 10.8159 0.217
NP_440189.1_10 Forward -86 -67 7.86593 0.242
NP_440562.1_3 Reverse -230 -247 7.90532 0.15
NP_441965.1_3 Forward -248 -229 7.7676 0.133
NP_441965.1_10 Forward -241 -225 13.7265 0.0977
NP_440297.1_9 Forward -237 -227 9.32148 0.0917
NP_440297.1_9 Reverse -61 -71 9.22315 0.0917
NP_440297.1_9 Forward -82 -72 7.25653 0.136
NP_440297.1_9 Forward -68 -58 -0.118297 0.282
NP_440297.1_9 Reverse -230 -240 -0.216628 0.282
NP_441896.1_3 Forward -247 -228 8.65258 0.0879
NP_440894.1_7 Reverse -352 -371 14.5516 0.162
NP_440894.1_10 Reverse -224 -243 16.5191 0.0698
NP_443036.1_3 Forward -263 -246 12.9202 0.299
NP_442067.1_4 Reverse -218 -237 3.34271 0.289
NP_440999.1_9 Reverse -225 -239 9.14437 0.0676
NP_440999.1_9 Forward -242 -228 4.81781 0.115
NP_440999.1_9 Reverse -108 -122 0.0979218 0.193
NP_440999.1_9 Reverse -325 -339 -0.295402 0.203
NP_440999.1_9 Forward -393 -379 -1.37704 0.236
NP_440888.1_2 Reverse -229 -243 20.0584 0.000881
NP_440888.1_2 Forward -238 -224 15.9285 0.00837
NP_440888.1_2 Reverse -285 -299 12.2903 0.0476
NP_440888.1_2 Reverse -109 -123 9.73373 0.116
NP_440888.1_2 Forward -83 -69 8.84875 0.145
NP_440888.1_2 Forward -95 -81 8.25877 0.167
NP_440888.1_2 Reverse -235 -249 6.58715 0.228
NP_440491.1_1 Reverse -226 -245 11.9848 0.158
NP_441268.1_1 Reverse -343 -362 13.7027 0.238
NP_442033.1_10 Reverse -378 -397 -5.60541 0.179
NP_442033.1_10 Reverse -217 -236 -6.09707 0.183
NP_442033.1_10 Forward -240 -221 -11.9969 0.261
NP_442033.1_10 Reverse -227 -246 -13.8652 0.291
NP_441123.1_6 Forward -77 -59 16.4404 0.132
NP_441543.1_2 Forward -237 -228 18.486 0.00236
NP_441543.1_2 Reverse -230 -239 16.9127 0.00359
NP_441543.1_2 Reverse -330 -339 11.6028 0.0504
NP_442845.1_2 Reverse -60 -74 15.3392 0.0729
NP_442845.1_2 Reverse -80 -94 13.0776 0.0999
NP_442845.1_2 Forward -244 -230 6.88276 0.201
NP_442845.1_2 Forward -339 -325 5.1128 0.243
NP_442845.1_2 Reverse -279 -293 3.53951 0.287
NP_441469.1_8 Reverse -228 -237 16.126 0.00797
NP_441469.1_8 Reverse -73 -82 9.63616 0.227
NP_441469.1_8 Forward -70 -61 7.66954 0.227
NP_441469.1_8 Forward -239 -230 6.48957 0.227
NP_441469.1_8 Reverse -323 -332 5.3096 0.277
NP_443064.1_6 Reverse -229 -239 12.5669 0.0796
NP_442578.1_7 Forward -237 -230 14.5921 0.026
NP_442578.1_7 Reverse -230 -237 14.5921 0.026
NP_440710.1_1 Forward -296 -278 -1.16082 0.179
NP_440710.1_1 Reverse -221 -239 -3.91409 0.208
NP_441462.1_2 Forward -238 -228 11.5831 0.00406
NP_441462.1_2 Reverse -229 -239 11.5831 0.00406
NP_441462.1_2 Forward -389 -379 -0.806614 0.254
NP_441621.1_7 Reverse -227 -241 -3.24533 0.188
NP_441621.1_7 Forward -240 -226 -3.44199 0.188
NP_441621.1_7 Reverse -327 -341 -5.50694 0.254
NP_441621.1_7 Reverse -378 -392 -6.49025 0.295
NP_443062.1_6 Forward -246 -227 1.67108 0.271
NP_443062.1_6 Reverse -52 -71 1.27776 0.276
NP_440519.1_8 Forward -338 -322 2.61514 0.261
NP_442204.1_5 Reverse -219 -238 17.2074 0.0362
NP_440255.1_3 Reverse -122 -132 15.4909 0.298
NP_440516.1_8 Forward -238 -229 16.9127 0.00442
NP_440516.1_8 Reverse -229 -238 16.9127 0.00442
NP_441785.1_1 Reverse -229 -243 14.8714 0.151
NP_442428.1_4 Reverse -228 -247 9.63589 0.158
NP_442428.1_5 Forward -237 -230 15.8704 0.0124
NP_442428.1_5 Reverse -230 -237 15.8704 0.0124
NP_442428.1_5 Reverse -75 -82 4.46401 0.267
NP_442428.1_5 Forward -337 -330 4.36568 0.271
NP_440818.1_1 Reverse -63 -82 8.75091 0.0459
NP_441443.1_2 Forward -91 -72 0.982764 0.25
NP_442859.1_2 Reverse -230 -249 5.70265 0.201
NP_442120.1_10 Forward -294 -275 -9.63698 0.244
NP_440673.1_2 Forward -248 -229 15.4623 0.0888
NP_440673.1_3 Forward -236 -229 12.4288 0.0426
NP_440673.1_3 Reverse -231 -238 12.4288 0.0426
NP_440673.1_3 Reverse -150 -157 8.98723 0.203
NP_440673.1_3 Forward -81 -74 8.98723 0.203
NP_440673.1_7 Reverse -218 -237 2.3594 0.228
NP_441052.1_2 Reverse -229 -239 19.9412 0.00106
NP_441052.1_2 Forward -238 -228 10.5014 0.0285
NP_441052.1_2 Reverse -60 -70 1.94665 0.221
NP_441052.1_2 Forward -69 -59 1.16001 0.25
NP_442219.1_8 Reverse -225 -244 15.9944 0.0974
NP_442219.1_9 Reverse -230 -239 17.7976 0.00718
NP_442219.1_9 Forward -237 -228 8.35786 0.0681
NP_440436.1_4 Forward -237 -228 18.1905 0.00233
NP_440436.1_4 Reverse -230 -239 17.2072 0.00233
NP_440436.1_4 Forward -82 -73 9.73406 0.0871
NP_440436.1_4 Reverse -330 -339 4.7192 0.244
NP_441884.1_8 Forward -216 -197 -14.0619 0.298
NP_441884.1_9 Forward -241 -222 -14.2585 0.138
NP_441884.1_9 Reverse -226 -245 -22.715 0.284
NP_441336.1_10 Reverse -76 -95 17.8957 0.0969
NP_442907.1_2 Reverse -230 -248 7.59063 0.286
NP_441719.1_4 Forward -237 -230 16.3621 0.0124
NP_441719.1_4 Reverse -230 -237 16.3621 0.0124
NP_441733.1_10 Forward -241 -228 19.6855 0.0151
NP_441004.1_1 Reverse -68 -87 5.01433 0.106
NP_441004.1_1 Forward -338 -319 -0.688862 0.124
NP_441004.1_1 Forward -287 -268 -6.68705 0.19
NP_441004.1_1 Forward -153 -134 -12.6852 0.25
NP_441004.1_1 Forward -203 -184 -14.8485 0.271
NP_441004.1_2 Reverse -63 -82 4.81767 0.195
NP_441004.1_3 Forward -144 -125 1.47442 0.292
NP_441004.1_4 Reverse -71 -81 19.7446 0.0335
NP_441004.1_5 Reverse -70 -84 14.1593 0.22
NP_441004.1_5 Forward -285 -271 14.1593 0.22
NP_442366.1_3 Forward -198 -180 -1.25915 0.208
NP_442366.1_3 Reverse -228 -246 -3.81576 0.258
NP_440296.1_10 Reverse -70 -89 -5.01543 0.214
NP_441115.1_4 Reverse -228 -246 8.17984 0.257
NP_441115.1_4 Forward -239 -221 7.29487 0.291
NP_442206.1_10 Forward -338 -323 0.373221 0.261
NP_440328.1_8 Forward -98 -79 15.0538 0.294
NP_443054.1_2 Reverse -227 -241 12.586 0.0722
NP_441966.1_8 Reverse -54 -72 -1.35749 0.198
NP_442586.1_7 Forward -87 -68 16.5643 0.287
NP_441851.1_10 Reverse -228 -238 16.008 0.00552
NP_441851.1_10 Forward -239 -229 15.8113 0.00552
NP_441851.1_10 Forward -295 -285 11.8781 0.0602
NP_441851.1_10 Reverse -73 -83 7.45319 0.14
NP_441851.1_10 Reverse -379 -389 4.50326 0.266
NP_441851.1_10 Forward -339 -329 4.3066 0.277
NP_442208.1_5 Reverse -59 -78 -8.55534 0.277
NP_442011.1_1 Forward -239 -220 0.0977854 0.268
NP_442856.1_6 Forward -79 -61 15.4563 0.199
NP_442856.1_7 Reverse -220 -239 -2.55715 0.236
NP_441668.1_4 Forward -291 -272 5.89931 0.164
NP_441668.1_4 Forward -131 -112 -2.45882 0.288
NP_442515.1_1 Forward -239 -225 11.111 0.0428
NP_442515.1_1 Forward -390 -376 0.589577 0.187
NP_442515.1_1 Reverse -228 -242 -4.4253 0.298
NP_441683.1_7 Forward -118 -99 -11.8003 0.284
NP_440593.1_3 Reverse -69 -88 0.294447 0.195
NP_440593.1_3 Forward -243 -224 -4.13045 0.245
NP_440593.1_3 Forward -237 -218 -5.60541 0.264
NP_440593.1_3 Forward -88 -69 -5.9004 0.268
NP_440463.1_6 Reverse -226 -245 17.994 0.0474
NP_440463.1_8 Reverse -322 -341 5.66045 0.277
NP_442709.1_3 Forward -226 -207 9.93088 0.121
NP_441046.1_2 Forward -249 -230 1.47442 0.256
NP_441349.1_10 Reverse -219 -238 -0.39387 0.0947
NP_441349.1_10 Forward -248 -229 -8.65367 0.278
NP_440155.1_3 Reverse -186 -205 3.53937 0.279
NP_441409.1_6 Reverse -223 -242 -9.34199 0.182
NP_440389.1_5 Reverse -222 -241 16.9464 0.186
NP_440432.1_9 Reverse -230 -245 -2.77337 0.175
NP_440432.1_9 Forward -82 -67 -3.16669 0.179
NP_442843.1_1 Forward -153 -134 -6.88371 0.245
NP_442843.1_1 Reverse -352 -371 -10.522 0.278
NP_442843.1_1 Reverse -75 -94 -11.2103 0.286
NP_442843.1_1 Forward -203 -184 -12.0953 0.298
NP_439960.1_10 Reverse -216 -234 -3.22577 0.269
NP_440474.1_8 Forward -237 -223 4.91554 0.263
NP_440431.1_3 Reverse -328 -347 -0.787193 0.148
NP_442450.1_5 Reverse -227 -237 9.32148 0.115
NP_440588.1_2 Forward -78 -59 2.3594 0.121
NP_440588.1_2 Reverse -100 -119 1.0811 0.139
NP_440588.1_2 Reverse -220 -239 0.0977854 0.149
NP_440588.1_2 Reverse -57 -76 -4.72043 0.226
NP_440195.1_4 Forward -250 -231 8.94757 0.202
NP_440195.1_4 Forward -169 -150 4.81767 0.292
NP_442006.1_2 Forward -338 -321 -15.4975 0.227
NP_442006.1_2 Reverse -65 -82 -17.2674 0.271
NP_441003.1_9 Forward -78 -59 10.8159 0.213
NP_441570.1_1 Forward -238 -220 4.14905 0.021
NP_441570.1_1 Reverse -229 -247 -9.61729 0.142
NP_441570.1_1 Reverse -279 -297 -16.3038 0.242
NP_441570.1_1 Forward -215 -197 -16.9921 0.26
NP_441078.1_4 Forward -238 -229 19.6659 0.0007
NP_441078.1_4 Reverse -229 -238 19.6659 0.0007
NP_441078.1_4 Forward -338 -329 6.09625 0.0863
NP_441078.1_4 Forward -288 -279 -0.786921 0.207
NP_441078.1_4 Forward -69 -60 -1.47524 0.266
NP_441078.1_4 Reverse -279 -288 -1.57357 0.266
NP_441078.1_4 Reverse -380 -389 -1.6719 0.266
NP_441078.1_4 Reverse -74 -83 -1.6719 0.266
NP_441078.1_4 Reverse -60 -69 -1.77023 0.266
NP_441078.1_4 Reverse -329 -338 -2.06522 0.295
NP_442729.1_8 Reverse -225 -238 9.45906 0.125
NP_442729.1_8 Forward -242 -229 8.77074 0.125
NP_440707.1_6 Reverse -221 -240 11.995 0.237
NP_441094.1_6 Forward -295 -278 13.4111 0.186
NP_440526.1_3 Reverse -230 -241 20.0193 0.0113
NP_440526.1_3 Forward -82 -71 1.6315 0.267
NP_441432.1_8 Forward -239 -230 16.8143 0.00595
NP_441432.1_8 Forward -339 -330 12.7828 0.0354
NP_441432.1_8 Reverse -228 -237 8.25953 0.0755
NP_441432.1_8 Reverse -73 -82 6.5879 0.112
NP_441432.1_8 Forward -289 -280 3.14632 0.259
NP_442320.1_8 Forward -244 -230 15.5359 0.0102
NP_442320.1_8 Reverse -223 -237 -3.73699 0.131
NP_441732.1_2 Reverse -225 -241 1.82849 0.026
NP_441732.1_2 Forward -242 -226 -14.9861 0.145
NP_441732.1_2 Reverse -325 -341 -16.8544 0.207
NP_440629.1_4 Forward -381 -362 8.25926 0.271
NP_442003.1_4 Forward -237 -218 18.0924 0.141
NP_440760.1_1 Reverse -229 -248 -5.01543 0.0475
NP_442797.1_7 Reverse -271 -289 -0.275845 0.282
NP_440199.1_10 Reverse -226 -236 13.2547 0.108
NP_440199.1_10 Forward -241 -231 7.35486 0.231
NP_440578.1_8 Forward -215 -196 11.9958 0.246
NP_442400.1_3 Reverse -201 -220 10.9142 0.158
NP_440713.1_4 Forward -100 -81 0.884433 0.3
NP_442489.1_7 Forward -238 -229 20.1576 0.000695
NP_442489.1_7 Reverse -229 -238 20.1576 0.000695
NP_442489.1_7 Forward -338 -329 -1.6719 0.235
NP_442489.1_7 Forward -69 -60 -1.6719 0.235
NP_442489.1_7 Reverse -380 -389 -1.6719 0.235
NP_442489.1_7 Reverse -74 -83 -1.6719 0.235
NP_442489.1_7 Forward -288 -279 -1.77023 0.247
NP_442489.1_7 Reverse -60 -69 -1.77023 0.247
NP_442489.1_7 Forward -83 -74 -1.96689 0.28
NP_440559.1_1 Reverse -230 -239 17.4043 0.00658
NP_440559.1_1 Forward -237 -228 8.75118 0.0586
NP_441659.2_8 Reverse -229 -239 18.1713 0.00133
NP_441659.2_8 Forward -238 -228 11.9764 0.0147
NP_441659.2_8 Forward -83 -73 5.19158 0.113
NP_441022.1_1 Forward -105 -96 13.081 0.216
NP_441022.1_1 Reverse -281 -290 10.587 0.294
NP_442913.1_10 Reverse -220 -239 2.3594 0.126
NP_439956.1_7 Forward -344 -325 8.25926 0.257
NP_440029.1_4 Reverse -129 -148 19.3698 0.0784
NP_440779.1_5 Forward -83 -66 -14.2191 0.243
NP_442346.1_5 Forward -239 -229 16.6963 0.00248
NP_442346.1_5 Reverse -73 -83 13.943 0.0183
NP_442346.1_5 Forward -70 -60 12.6647 0.0375
NP_442346.1_5 Reverse -59 -69 11.5831 0.0634
NP_442346.1_5 Forward -339 -329 10.8948 0.0813
NP_442346.1_5 Reverse -228 -238 9.02648 0.118
NP_440545.1_3 Forward -242 -225 12.7235 0.0199
NP_440545.1_3 Reverse -56 -73 9.47861 0.0393
NP_440545.1_3 Reverse -325 -342 7.80699 0.0482
NP_440545.1_3 Reverse -376 -393 -2.91109 0.195
NP_440545.1_3 Forward -342 -325 -4.28772 0.223
NP_440545.1_3 Forward -73 -56 -6.746 0.287
NP_440831.1_3 Reverse -57 -76 5.41637 0.28
NP_440250.1_1 Reverse -275 -293 15.9488 0.116
NP_440459.1_2 Reverse -270 -287 15.9685 0.106
NP_440459.1_2 Forward -303 -286 14.5918 0.119
NP_440010.1_4 Reverse -225 -244 -2.75457 0.289
NP_441943.1_8 Reverse -64 -83 -3.63879 0.183
NP_441943.1_8 Forward -79 -60 -3.73712 0.183
NP_442551.1_4 Reverse -377 -392 13.2546 0.0946
NP_442551.1_4 Forward -71 -56 4.50312 0.245
NP_442551.1_4 Forward -240 -225 -2.38005 0.259
NP_442603.1_7 Forward -238 -224 10.5204 0.125
NP_441585.1_2 Forward -207 -188 16.0274 0.208
NP_441888.1_7 Forward -88 -74 0.982901 0.272
NP_441888.1_9 Reverse -86 -105 16.2148 0.26
NP_441948.1_4 Reverse -222 -240 -1.94747 0.156
NP_441502.1_3 Reverse -72 -91 7.17762 0.247
NP_441833.1_4 Forward -237 -230 15.9687 0.0124
NP_441833.1_4 Reverse -230 -237 15.9687 0.0124
NP_441895.1_10 Reverse -354 -373 -18.5851 0.282
NP_442162.1_9 Forward -237 -230 16.2637 0.0124
NP_442162.1_9 Reverse -230 -237 16.2637 0.0124
NP_440671.1_4 Forward -244 -230 8.55439 0.195
NP_441044.1_4 Reverse -185 -203 2.87075 0.238
NP_442943.1_1 Forward -357 -342 5.88103 0.21
NP_442199.1_5 Reverse -316 -335 -6.58872 0.277
NP_442140.1_3 Reverse -230 -240 13.5497 0.0542
NP_442140.1_3 Forward -237 -227 8.33817 0.119
NP_442140.1_3 Reverse -75 -85 5.28991 0.216
NP_442723.1_1 Reverse -190 -209 2.75194 0.283
NP_442723.1_1 Reverse -275 -294 1.17865 0.298
NP_442021.1_9 Reverse -188 -207 8.55425 0.187
NP_440875.1_9 Reverse -231 -241 8.66404 0.233
NP_441813.1_3 Forward -121 -102 13.4617 0.284
NP_441813.1_5 Reverse -227 -237 17.188 0.00979
NP_441813.1_5 Forward -240 -230 8.73149 0.0367
NP_440590.1_4 Reverse -230 -243 21.0621 0.00401
NP_440590.1_4 Forward -237 -224 3.65753 0.0702
NP_440590.1_4 Reverse -286 -299 -5.48725 0.28
NP_440567.1_1 Reverse -230 -244 9.63603 0.0422
NP_440567.1_1 Forward -237 -223 7.9644 0.0637
NP_442497.1_10 Forward -237 -228 10.4228 0.0087
NP_442497.1_10 Reverse -230 -239 10.4228 0.0087
NP_442497.1_10 Forward -82 -73 0.196389 0.208
NP_440821.1_4 Reverse -227 -237 19.0562 0.00399
NP_440821.1_4 Forward -240 -230 17.9746 0.00497
NP_440821.1_4 Reverse -72 -82 0.0783647 0.205
NP_441239.1_9 Reverse -227 -239 13.3137 0.037
NP_441239.1_9 Reverse -72 -84 10.5604 0.076
NP_441239.1_9 Forward -240 -228 9.67541 0.0987
NP_441239.1_9 Reverse -84 -96 8.00379 0.145
NP_441239.1_9 Reverse -327 -339 6.52882 0.185
NP_441239.1_9 Forward -85 -73 5.84051 0.206
NP_441239.1_9 Forward -71 -59 5.64384 0.213
NP_441239.1_9 Reverse -58 -70 4.75886 0.243
NP_441239.1_9 Forward -391 -379 3.18557 0.292
NP_441951.1_4 Reverse -68 -87 4.03102 0.273
NP_441951.1_9 Reverse -180 -199 -1.18052 0.285
NP_441009.1_4 Forward -306 -287 10.1275 0.278
NP_441009.1_7 Forward -239 -220 11.2092 0.238
NP_440706.1_1 Forward -242 -223 -3.24547 0.258
NP_440400.1_1 Reverse -187 -206 5.70185 0.22
NP_442044.1_1 Reverse -324 -343 -6.58872 0.208
NP_442044.1_1 Forward -394 -375 -12.4886 0.273
NP_440796.1_3 Reverse -222 -240 10.5398 0.204
NP_442193.1_1 Reverse -74 -92 8.47561 0.272
NP_442193.1_8 Reverse -226 -245 13.6666 0.212
NP_442270.1_9 Forward -249 -230 -7.08038 0.213
NP_441508.1_4 Reverse -278 -292 14.2399 0.287
NP_441508.1_4 Forward -183 -169 13.9534 0.287
NP_442629.1_3 Forward -233 -214 1.0811 0.284
NP_441769.1_3 Forward -367 -348 -7.08111 0.291
NP_440900.1_3 Forward -287 -268 15.4374 0.259
NP_440949.1_7 Reverse -221 -240 8.94676 0.264
NP_442052.1_8 Reverse -72 -82 12.7631 0.253
NP_440546.1_4 Forward -238 -228 11.8882 0.0679
NP_440546.1_4 Reverse -229 -239 10.046 0.109
NP_440546.1_4 Reverse -66 -76 8.6886 0.176
NP_439974.1_4 Forward -249 -230 10.2259 0.24
NP_441230.1_5 Forward -243 -224 3.53937 0.198
NP_441230.1_5 Forward -80 -61 -0.197208 0.28
NP_440675.1_10 Reverse -51 -70 14.5524 0.228
NP_440441.1_2 Reverse -24 -43 17.9932 0.281
NP_440462.1_6 Reverse -227 -237 15.418 0.0142
NP_440462.1_6 Forward -240 -230 10.3048 0.0396
NP_440868.1_4 Reverse -225 -237 20.2952 0.00865
NP_440868.1_4 Forward -242 -230 0.432302 0.212
NP_441497.1_3 Reverse -272 -291 -11.8003 0.294
NP_441249.1_3 Reverse -72 -91 8.16093 0.275
NP_442479.1_9 Forward -290 -271 -11.5053 0.275
NP_441582.1_5 Forward -391 -372 6.58682 0.193
NP_441582.1_5 Reverse -107 -126 6.1935 0.2
NP_441474.1_1 Reverse -196 -215 2.45694 0.247
NP_441474.1_1 Forward -384 -365 -0.197979 0.255
NP_441474.1_1 Reverse -219 -238 -3.14789 0.294
NP_441848.1_4 Forward -114 -98 7.45517 0.288
NP_441848.1_7 Reverse -94 -113 3.04693 0.217
NP_441084.1_6 Reverse -84 -98 12.8346 0.152
NP_441084.1_6 Reverse -72 -86 11.1863 0.214
NP_440653.1_10 Forward -287 -268 8.35759 0.201
NP_440696.1_3 Reverse -56 -74 -1.94747 0.269
NP_440843.1_8 Forward -344 -325 15.1424 0.297
NP_442039.1_4 Forward -237 -230 15.1821 0.0124
NP_442039.1_4 Reverse -230 -237 15.1821 0.0124
NP_442039.1_7 Reverse -275 -285 15.713 0.211
NP_442039.1_7 Reverse -354 -364 10.9931 0.257
NP_441811.1_1 Reverse -263 -282 5.70265 0.28
NP_441811.1_8 Forward -244 -230 8.16106 0.238
NP_442380.1_10 Reverse -225 -243 8.7706 0.262
NP_442837.1_3 Forward -237 -230 15.7721 0.0124
NP_442837.1_3 Reverse -230 -237 15.7721 0.0124
NP_440160.1_2 Forward -294 -275 -8.65367 0.286
NP_442053.1_1 Forward -238 -229 18.3876 0.0007
NP_442053.1_1 Reverse -229 -238 18.3876 0.0007
NP_440505.1_3 Forward -240 -230 16.598 0.00683
NP_440505.1_3 Reverse -227 -237 13.8447 0.0247
NP_440505.1_4 Reverse -69 -88 17.34 0.261
NP_442360.1_5 Reverse -67 -77 14.0414 0.242
NP_442360.1_5 Reverse -242 -252 13.8447 0.258
NP_441252.1_6 Reverse -71 -78 11.9372 0.25
NP_441203.1_1 Forward -237 -218 -19.6667 0.297
NP_441203.1_1 Reverse -61 -80 -20.5517 0.297
NP_441203.1_2 Forward -306 -287 -5.11376 0.261
NP_440013.1_1 Forward -366 -347 8.84842 0.259
NP_440914.1_1 Reverse -229 -239 17.5935 0.000537
NP_440914.1_1 Forward -238 -228 8.6151 0.186
NP_441011.1_8 Forward -237 -228 16.9127 0.00602
NP_441011.1_8 Reverse -230 -239 8.25953 0.144
NP_441011.1_8 Reverse -75 -84 5.11294 0.283
NP_442533.1_1 Reverse -57 -76 -7.76869 0.197
NP_442533.1_1 Reverse -361 -380 -14.4552 0.243
NP_442533.1_6 Forward -238 -229 17.2076 0.00137
NP_442533.1_6 Reverse -229 -238 17.2076 0.00137
NP_442533.1_6 Forward -69 -60 13.9627 0.0155
NP_442533.1_6 Forward -95 -86 12.0944 0.0325
NP_442533.1_6 Reverse -60 -69 6.68623 0.105
NP_442533.1_6 Reverse -74 -83 5.60459 0.137
NP_442533.1_6 Reverse -380 -389 4.62128 0.179
NP_441482.1_7 Forward -244 -230 1.17956 0.0554
NP_441482.1_7 Forward -375 -361 -6.98191 0.193
NP_441482.1_7 Reverse -223 -237 -9.04686 0.193
NP_439944.1_8 Forward -122 -103 10.3242 0.298
NP_439944.1_9 Reverse -230 -240 19.1546 0.00329
NP_439944.1_9 Forward -337 -327 10.3048 0.0887
NP_439944.1_9 Forward -237 -227 10.3048 0.0887
NP_441028.1_6 Reverse -267 -277 5.48612 0.255
NP_442202.1_4 Forward -240 -226 18.071 0.104
NP_440116.1_8 Reverse -230 -249 -0.590531 0.111
NP_440115.1_6 Forward -241 -231 9.81313 0.115
NP_440007.1_9 Forward -342 -328 6.29277 0.229
NP_440007.1_9 Forward -291 -277 5.1128 0.265
NP_441602.1_3 Forward -243 -224 0.786102 0.217
NP_441602.1_3 Reverse -224 -243 0.0977854 0.219
NP_441170.1_4 Forward -230 -212 7.09898 0.194
NP_441170.1_4 Reverse -52 -70 2.37909 0.285
NP_441972.1_5 Reverse -230 -249 -4.42544 0.211
NP_441972.1_5 Reverse -75 -94 -4.6221 0.211
NP_441106.1_1 Reverse -228 -237 18.191 0.0028
NP_441106.1_1 Forward -239 -230 9.63616 0.0311
NP_439903.1_7 Forward -303 -284 5.40766 0.281
NP_442588.1_8 Forward -151 -132 6.98095 0.238
NP_442928.1_3 Reverse -59 -78 12.7098 0.256
NP_442306.1_10 Reverse -224 -243 -19.0768 0.197
NP_441286.1_1 Forward -239 -227 14.4936 0.00418
NP_441286.1_1 Reverse -228 -240 12.1337 0.0104
NP_440670.1_8 Forward -238 -229 18.3876 0.000699
NP_440670.1_8 Reverse -229 -238 18.3876 0.000699
NP_441705.1_4 Reverse -54 -73 10.8159 0.218
NP_440886.1_7 Reverse -228 -238 17.7774 0.0011
NP_440886.1_7 Forward -239 -229 7.94438 0.0805
NP_440886.1_7 Reverse -108 -118 6.0761 0.147
NP_440828.1_1 Forward -236 -217 -1.18128 0.284
NP_442614.1_2 Forward -238 -224 8.35772 0.255
NP_442072.1_9 Reverse -228 -246 5.23069 0.0167
NP_442072.1_9 Forward -239 -221 -23.2853 0.288
NP_442213.1_5 Forward -213 -194 0.392778 0.272
NP_441753.1_10 Reverse -220 -239 5.99764 0.186
NP_440028.1_3 Reverse -75 -94 18.2221 0.13
NP_440028.1_6 Forward -129 -111 15.4571 0.218
NP_440028.1_9 Forward -281 -262 18.289 0.25
NP_440907.2_8 Reverse -230 -240 10.8943 0.0969
NP_440907.2_8 Forward -237 -227 7.84605 0.117
NP_440907.2_8 Forward -337 -327 4.30615 0.269
NP_441021.1_1 Reverse -230 -249 2.3594 0.083
NP_441021.1_1 Forward -94 -75 -9.93197 0.224
NP_441021.1_8 Forward -243 -225 4.83737 0.215
NP_441463.1_3 Reverse -219 -238 -9.047 0.276
NP_441626.1_2 Forward -237 -230 15.7721 0.0124
NP_441626.1_2 Reverse -230 -237 15.7721 0.0124
NP_442221.1_6 Reverse -213 -230 15.1818 0.177
NP_442365.1_5 Forward -388 -369 9.83255 0.202
NP_442365.1_7 Reverse -225 -244 -3.04881 0.21
NP_442209.1_8 Reverse -182 -201 14.8474 0.176
NP_442794.1_1 Forward -342 -330 5.05386 0.236
NP_442794.1_1 Forward -242 -230 3.48056 0.286
NP_442615.1_1 Forward -247 -229 3.55906 0.0536
NP_441962.1_4 Forward -243 -224 4.52268 0.0974
NP_441962.1_4 Reverse -69 -88 -14.2585 0.285
NP_440387.1_1 Reverse -229 -245 13.1366 0.00945
NP_440387.1_1 Forward -238 -222 12.4482 0.0122
NP_440387.1_1 Reverse -380 -396 1.82849 0.0943
NP_440387.1_1 Reverse -279 -295 -4.46469 0.187
NP_440855.1_1 Forward -400 -381 -0.885524 0.266
NP_441431.1_2 Reverse -226 -240 7.57046 0.238
NP_441431.1_2 Forward -384 -370 6.88214 0.257
NP_441431.1_2 Forward -121 -107 6.19383 0.279
NP_441431.1_3 Forward -215 -196 3.93269 0.263
NP_442647.1_7 Reverse -215 -228 5.82081 0.257
NP_441993.1_1 Forward -238 -219 4.38312 0.221
NP_441993.1_1 Reverse -229 -248 4.18821 0.223
NP_441993.1_1 Forward -219 -200 0.777198 0.292
NP_440467.1_3 Forward -94 -75 10.6703 0.298
NP_440114.1_10 Forward -238 -224 13.5693 0.0531
NP_441510.2_2 Reverse -105 -124 12.6833 0.16
NP_441510.2_7 Reverse -223 -237 10.9137 0.28
NP_440293.1_10 Reverse -71 -90 9.0459 0.149
NP_440766.1_4 Forward -242 -228 17.6992 0.0255
NP_440766.1_5 Forward -186 -174 10.807 0.268
NP_440422.1_10 Forward -370 -351 4.78914 0.281
NP_441237.1_9 Reverse -230 -240 14.9263 0.0242
NP_441237.1_9 Forward -82 -72 14.1397 0.0488
NP_442743.1_5 Forward -293 -274 3.6377 0.252
NP_439910.1_2 Forward -246 -229 -13.6292 0.162
NP_440457.1_1 Forward -242 -230 5.34885 0.141
NP_440457.1_1 Reverse -70 -82 2.89058 0.205
NP_440457.1_1 Forward -209 -197 2.10393 0.217
NP_440457.1_1 Reverse -225 -237 1.80894 0.223
NP_440213.1_5 Forward -293 -274 6.88262 0.297
NP_440798.1_6 Forward -237 -224 6.1158 0.14
NP_441984.1_1 Forward -244 -226 8.57394 0.254
NP_441984.1_3 Reverse -225 -243 7.59063 0.245
NP_441984.1_6 Forward -81 -69 14.9853 0.219
NP_441889.1_4 Reverse -165 -184 0.58944 0.296
NP_441436.1_8 Forward -239 -220 10.0292 0.262
NP_442509.1_9 Forward -238 -228 16.2041 0.00739
NP_442509.1_9 Reverse -229 -239 8.14104 0.192
NP_441489.1_3 Forward -356 -342 10.0383 0.232
NP_442514.1_5 Forward -83 -64 -4.1312 0.238
NP_440554.1_4 Forward -237 -227 14.6313 0.02
NP_440554.1_4 Reverse -230 -240 6.37155 0.123
NP_441885.1_5 Reverse -229 -239 20.9245 0.000538
NP_441885.1_5 Forward -238 -228 11.4848 0.00668
NP_441885.1_5 Forward -288 -278 0.275027 0.174
NP_440478.1_9 Reverse -191 -210 8.55425 0.268
NP_442703.1_9 Forward -194 -176 4.9357 0.244
NP_442341.1_7 Reverse -228 -242 20.3541 0.00702
NP_442341.1_7 Forward -239 -225 15.6342 0.0218
NP_442341.1_9 Reverse -227 -241 5.80051 0.255
NP_442369.1_5 Reverse -34 -53 20.354 0.0609
NP_441173.1_9 Forward -285 -277 13.2937 0.17
NP_441173.1_9 Forward -364 -356 11.4254 0.226
NP_443000.1_7 Forward -240 -230 10.4031 0.0345
NP_443000.1_7 Reverse -227 -237 8.73149 0.0437
NP_440507.2_3 Forward -247 -228 8.94676 0.237
NP_440727.1_2 Reverse -221 -240 -0.295539 0.288
NP_441842.1_10 Reverse -222 -236 6.48943 0.286
NP_440275.1_3 Forward -240 -230 17.6796 0.0102
NP_440275.1_3 Reverse -227 -237 8.4365 0.0602
NP_440091.1_1 Forward -242 -230 10.7571 0.0429
NP_440091.1_1 Reverse -225 -237 8.29878 0.0653
NP_443010.1_10 Reverse -226 -243 7.89238 0.164
NP_442451.1_2 Reverse -221 -240 1.37609 0.146
NP_442451.1_2 Forward -246 -227 -11.6036 0.297
NP_439962.1_4 Forward -91 -72 -3.14714 0.246
NP_442495.1_3 Reverse -67 -85 11.8189 0.259
NP_440149.1_8 Forward -238 -219 14.0608 0.0273
NP_440149.1_8 Reverse -229 -248 0.884433 0.132
NP_440149.1_8 Reverse -74 -93 -5.21209 0.221
NP_441105.1_3 Forward -249 -230 6.98095 0.0565
NP_441105.1_3 Reverse -274 -293 -4.13045 0.192
NP_441105.1_3 Reverse -189 -208 -5.50708 0.22
NP_441105.1_3 Reverse -75 -94 -5.70374 0.223
NP_441105.1_3 Reverse -224 -243 -7.08038 0.245
NP_442373.1_2 Forward -205 -186 -5.9004 0.227
NP_440216.1_1 Forward -238 -224 8.55439 0.00592
NP_440216.1_1 Reverse -229 -243 -9.73518 0.145
NP_440216.1_9 Forward -152 -143 6.48957 0.289
NP_440172.1_1 Reverse -229 -239 15.0247 0.00945
NP_440172.1_1 Forward -238 -228 8.73149 0.0586
NP_440172.1_1 Forward -369 -359 6.17489 0.11
NP_440172.1_1 Reverse -74 -84 4.99491 0.157
NP_442015.1_10 Reverse -225 -238 9.75405 0.0449
NP_442015.1_10 Forward -73 -60 4.54251 0.167
NP_442015.1_10 Forward -242 -229 3.65753 0.178
NP_441226.1_7 Forward -237 -230 14.4934 0.0123
NP_441226.1_7 Reverse -230 -237 14.4934 0.0123
NP_441111.1_7 Forward -237 -229 18.7023 0.00294
NP_441111.1_7 Reverse -230 -238 18.7023 0.00294
NP_442379.1_10 Forward -245 -228 -0.944468 0.223
NP_441766.1_2 Forward -238 -229 17.5026 0.00297
NP_441766.1_2 Reverse -229 -238 17.5026 0.00297
NP_440416.1_9 Forward -266 -247 -14.9469 0.182
NP_440416.1_9 Forward -245 -226 -15.4385 0.191
NP_440416.1_9 Forward -76 -57 -15.5368 0.193
NP_440416.1_9 Forward -239 -220 -19.3717 0.274
NP_443052.1_8 Reverse -370 -389 -2.85214 0.0953
NP_443052.1_8 Forward -248 -229 -10.3253 0.207
NP_443052.1_8 Reverse -219 -238 -11.8003 0.237
NP_443052.1_9 Reverse -196 -215 -4.03212 0.254
NP_440072.1_5 Forward -215 -197 1.00246 0.236
NP_442552.1_1 Reverse -88 -107 0.884433 0.245
NP_440591.1_9 Forward -216 -198 9.45892 0.151
NP_440261.1_5 Forward -237 -224 6.80412 0.0316
NP_440261.1_5 Reverse -330 -343 -4.79893 0.17
NP_440261.1_5 Reverse -230 -243 -10.5021 0.201
NP_440261.1_5 Forward -82 -69 -10.5021 0.201
NP_440988.1_9 Forward -67 -48 17.5015 0.146
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCCGCATCGAGGGAACCGCCCCCTAGCTCAGCCAATTTCGCCAATTTGTTTAAATATTCCTGGCTATGGCATCGGAGGATGTATGGATCTAAATTCCACGTCACCGGGGAAGGCTTTTGCCAATGGAGGTAATTCGCTCCGGGCATCTTCCGTAAAGCAGTGGCGATCGCCGTCAGTCGGGCCGGACACTCGGGGTGGGTGGGGCCAGTTTCGTGGCGCAAAAACTCTGCGCTGTAAATAATAGCGACCATGGTAAGTGGTGGTGGATAGTAAAATTAGGCGGAGAAGGCGGAGCAAAAAGTTTGGCCAGCCCTTCAGCCATTGCCCCAGGGCCATGACCCACCAATGCTATTCTAGGTAGGGTATTGAGCCAAATTTAAGATCGAGGCAGTTTAGGCT

CDS

ATGCAAGTTAACAATCTCGGCTTTATAGCAAGTATTTTATTTGTGTTGGTGCCAACGGTTTTCCTGTTGATCCTGTTTATTCAAACCGGGAAACAAAGCGAAAGCTAA

Protein

MQVNNLGFIASILFVLVPTVFLLILFIQTGKQSES